F405622

General Info

Members Datasets Scaffolds Average Seq Length
320 217 640 302

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0115124|Ga0373925_0115124_890_1885
Length 331
Sequence LVDKAAPEPANAGIGGVAFTLALAVVAGALFLIGRLFVGSGNSYVFFAGYVVVQYVVLGTAWNILGGYTGYVNFGITAFFAIGAYSTVVLNKLAPVIPLPVMVLVGGVLAGLVGLGTGYLTLRLRGVFFSIATLALAVVVQTLITNWDYVGGARGAYVLRPKLAPLIGGDYIEYLCLVMLGLCVIAVATARAIERSALGYGFAAIRDDEAAAEAAGVPTLRLKLIATTLSGAFMGMAGAPLPFYVAYLDPASGFSLNYAVNAIAMPLIGGTSSWLGPIVGGVLVGGLQQYVSVTISSAVNVLITGLLLVTFVILAPQGIVGVIQARLRRRR

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 0
Rhizoplane 5.94
Rhizosphere 80.62
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0115124 3300037068 Bacteria 2082
2 Ga0070658_10014137 3300005327 Bacteria 6408
3 Ga0070683_100047837 3300005329 Bacteria 3953
4 Ga0070690_100093512 3300005330 Bacteria 1983
5 Ga0070680_100001388 3300005336 Bacteria 17507
6 Ga0070680_100044708 3300005336 Bacteria 3599
7 Ga0070669_100130724 3300005353 Bacteria 1925
8 Ga0070675_100472423 3300005354 Bacteria 1127
9 Ga0070688_100229069 3300005365 Bacteria 1314
10 Ga0070659_100196397 3300005366 Bacteria 1660
11 Ga0070709_10034982 3300005434 Bacteria 3050
12 Ga0070714_100016839 3300005435 Bacteria 5911
13 Ga0070714_100201654 3300005435 Bacteria 1820
14 Ga0070713_100008203 3300005436 Bacteria 7399
15 Ga0070713_100200885 3300005436 Bacteria 1800
16 Ga0070713_100335272 3300005436 Bacteria 1400
17 Ga0070710_10033736 3300005437 Bacteria 2781
18 Ga0070701_10026747 3300005438 Bacteria 2817
19 Ga0070711_100143950 3300005439 Bacteria 1790
20 Ga0070694_100133538 3300005444 Bacteria 1796
21 Ga0070708_100344701 3300005445 Bacteria 1404
22 Ga0070681_10002673 3300005458 Bacteria 16371
23 Ga0070681_10017123 3300005458 Bacteria 7245
24 Ga0070698_100001924 3300005471 Bacteria 23080
25 Ga0070699_100018896 3300005518 Bacteria 5925
26 Ga0070679_100003503 3300005530 Bacteria 14373
27 Ga0070679_100037432 3300005530 Bacteria 4820
28 Ga0070679_100076934 3300005530 Bacteria 3325
29 Ga0070695_100186792 3300005545 Bacteria 1472
30 Ga0070665_100267793 3300005548 Bacteria 1710
31 Ga0070704_100190748 3300005549 Bacteria 1647
32 Ga0068855_100091258 3300005563 Bacteria 3514
33 Ga0068855_100329282 3300005563 Bacteria 1686
34 Ga0068855_100429274 3300005563 Bacteria 1445
35 Ga0070664_100007439 3300005564 Bacteria 8840
36 Ga0068852_100118167 3300005616 Bacteria 2422
37 Ga0068859_100019800 3300005617 Bacteria 6755
38 Ga0068851_10121877 3300005834 Bacteria 1402
39 Ga0068858_100124469 3300005842 Bacteria 2413
40 Ga0081455_10000368 3300005937 Bacteria 59452
41 Ga0081539_10001642 3300005985 Bacteria 36366
42 Ga0081539_10047085 3300005985 Bacteria 2466
43 Ga0070717_10216289 3300006028 Bacteria 1683
44 Ga0075365_10005778 3300006038 Bacteria 6718
45 Ga0075365_10132648 3300006038 Bacteria 1724
46 Ga0075365_10231031 3300006038 Bacteria 1298
47 Ga0075368_10003775 3300006042 Bacteria 5091
48 Ga0075368_10039982 3300006042 Bacteria 1840
49 Ga0075363_100114675 3300006048 Bacteria 1500
50 Ga0075364_10005251 3300006051 Bacteria 7516
51 Ga0070716_100053077 3300006173 Bacteria 2310
52 Ga0070712_100016229 3300006175 Bacteria 4809
53 Ga0070712_100279601 3300006175 Bacteria 1344
54 Ga0075362_10024953 3300006177 Bacteria 2540
55 Ga0075362_10116897 3300006177 Bacteria 1259
56 Ga0075362_10122342 3300006177 Bacteria 1232
57 Ga0075367_10021320 3300006178 Bacteria 3619
58 Ga0075369_10000574 3300006186 Bacteria 11627
59 Ga0075369_10010495 3300006186 Bacteria 3623
60 Ga0075369_10023282 3300006186 Bacteria 2560
61 Ga0075366_10168219 3300006195 Bacteria 1330
62 Ga0075370_10020359 3300006353 Bacteria 3625
63 Ga0075370_10022325 3300006353 Bacteria 3474
64 Ga0075370_10033354 3300006353 Bacteria 2883
65 Ga0075428_100048916 3300006844 Bacteria 4640
66 Ga0075430_100000665 3300006846 Bacteria 26232
67 Ga0075430_100155691 3300006846 Bacteria 1903
68 Ga0075431_100041288 3300006847 Bacteria 4755
69 Ga0075433_10163477 3300006852 Bacteria 1981
70 Ga0075433_10338541 3300006852 Bacteria 1330
71 Ga0075429_100072393 3300006880 Bacteria 3002
72 Ga0075436_100074057 3300006914 Bacteria 2357
73 Ga0075436_100103366 3300006914 Bacteria 1985
74 Ga0097620_100019800 3300006931 Bacteria 6755
75 Ga0075435_100066335 3300007076 Bacteria 2936
76 Ga0105240_10030893 3300009093 Bacteria 6958
77 Ga0105240_10118659 3300009093 Bacteria 3188
78 Ga0111539_10476225 3300009094 Bacteria 1454
79 Ga0114129_10002493 3300009147 Bacteria 25548
80 Ga0114129_10092726 3300009147 Bacteria 4184
81 Ga0114129_10161083 3300009147 Bacteria 3065
82 Ga0114129_10381113 3300009147 Bacteria 1862
83 Ga0114129_10388979 3300009147 Bacteria 1840
84 Ga0105243_10431177 3300009148 Bacteria 1232
85 Ga0105241_10231053 3300009174 Bacteria 1559
86 Ga0105238_10053034 3300009551 Bacteria 4076
87 Ga0105238_10089133 3300009551 Bacteria 3072
88 Ga0105249_10241503 3300009553 Bacteria 1786
89 Ga0105239_10061470 3300010375 Bacteria 4123
90 Ga0105239_10489329 3300010375 Bacteria 1398
91 Ga0105239_10846017 3300010375 Bacteria 1049
92 Ga0157370_10012658 3300013104 Bacteria 8737
93 Ga0157370_10140301 3300013104 Bacteria 2252
94 Ga0157369_10255868 3300013105 Bacteria 1827
95 Ga0157372_10108888 3300013307 Bacteria 3172
96 Ga0157372_10436186 3300013307 Bacteria 1527
97 Ga0213872_10057851 3300021361 Bacteria 1755
98 Ga0213876_10012215 3300021384 Bacteria 4573
99 Ga0213876_10082801 3300021384 Bacteria 1697
100 Ga0213871_10013914 3300021441 Bacteria 1899
101 Ga0207426_1014592 3300025302 Bacteria 2874
102 Ga0207647_10128637 3300025904 Bacteria 1489
103 Ga0207705_10075765 3300025909 Bacteria 2444
104 Ga0207684_10041973 3300025910 Bacteria 3877
105 Ga0207707_10010790 3300025912 Bacteria 7939
106 Ga0207695_10054420 3300025913 Bacteria 4179
107 Ga0207693_10078635 3300025915 Bacteria 2581
108 Ga0207693_10102809 3300025915 Bacteria 2241
109 Ga0207663_10189748 3300025916 Bacteria 1475
110 Ga0207660_10030585 3300025917 Bacteria 3702
111 Ga0207660_10032358 3300025917 Bacteria 3610
112 Ga0207660_10243056 3300025917 Bacteria 1419
113 Ga0207652_10004944 3300025921 Bacteria 10792
114 Ga0207652_10009135 3300025921 Bacteria 7980
115 Ga0207694_10073452 3300025924 Bacteria 2676
116 Ga0207694_10089872 3300025924 Bacteria 2423
117 Ga0207659_10065179 3300025926 Bacteria 2639
118 Ga0207700_10005020 3300025928 Bacteria 7873
119 Ga0207700_10110678 3300025928 Bacteria 2209
120 Ga0207664_10020397 3300025929 Bacteria 4912
121 Ga0207664_10180896 3300025929 Bacteria 1810
122 Ga0207690_10140639 3300025932 Bacteria 1778
123 Ga0207706_10255789 3300025933 Bacteria 1529
124 Ga0207686_10168394 3300025934 Bacteria 1543
125 Ga0207665_10006466 3300025939 Bacteria 7774
126 Ga0207661_10080661 3300025944 Bacteria 2685
127 Ga0207667_10058968 3300025949 Bacteria 4023
128 Ga0207667_10254777 3300025949 Bacteria 1795
129 Ga0207651_10297441 3300025960 Bacteria 1341
130 Ga0207651_10331376 3300025960 Bacteria 1276
131 Ga0207703_10069052 3300026035 Bacteria 2913
132 Ga0207639_10042772 3300026041 Bacteria 3397
133 Ga0207702_10030263 3300026078 Bacteria 4511
134 Ga0207702_10191056 3300026078 Bacteria 1892
135 Ga0207698_10056806 3300026142 Bacteria 3023
136 Ga0207428_10004874 3300027907 Bacteria 12645
137 Ga0268266_10035883 3300028379 Bacteria 4217
138 Ga0265334_10004421 3300028573 Bacteria 6240
139 Ga0265340_10064369 3300031247 Bacteria 1748
140 Ga0373934_0001622 3300035086 Bacteria 8257
141 Ga0373923_0046482 3300035111 Bacteria 1806
142 Ga0373923_0083763 3300035111 Bacteria 1386
143 Ga0373932_0015862 3300035112 Bacteria 1916
144 Ga0373936_0012953 3300035113 Bacteria 3180
145 Ga0373953_0005198 3300035117 Bacteria 4206
146 Ga0373954_0018211 3300035118 Bacteria 3159
147 Ga0373956_0000404 3300035119 Bacteria 17613
148 Ga0373956_0013091 3300035119 Bacteria 3449
149 Ga0373957_0082442 3300035120 Bacteria 1271
150 Ga0373943_0059244 3300035170 Bacteria 1908
151 Ga0373946_0007658 3300035171 Bacteria 3956
152 Ga0373955_0015393 3300035172 Bacteria 3744
153 Ga0373935_0039812 3300035692 Bacteria 2947
154 Ga0373935_0090571 3300035692 Bacteria 2002
155 Ga0373935_0096171 3300035692 Bacteria 1946
156 Ga0373935_0109850 3300035692 Bacteria 1829
157 Ga0373927_0006591 3300035695 Bacteria 7911
158 Ga0373933_0042763 3300035724 Bacteria 2678
159 Ga0373937_0015651 3300036401 Bacteria 6715
160 Ga0373937_0051815 3300036401 Bacteria 3762
161 Ga0373937_0119854 3300036401 Bacteria 2452
162 Ga0373937_0174914 3300036401 Bacteria 2015
163 Ga0373925_0014018 3300037068 Bacteria 5802
164 Ga0373925_0115480 3300037068 Bacteria 2078
165 Ga0373925_0206339 3300037068 Bacteria 1564
166 Ga0373925_0210208 3300037068 Bacteria 1550
167 Ga0395900_0047923 3300037418 Bacteria 4401
168 Ga0395900_0093855 3300037418 Bacteria 3082
169 Ga0395898_0041198 3300037466 Bacteria 4562
170 Ga0395905_0173964 3300037471 Bacteria 2022
171 Ga0436364_0680861 3300037853 Bacteria 1017
172 Ga0436364_1319509 3300037853 Bacteria 2100
173 Ga0436364_1458897 3300037853 Bacteria 1732
174 Ga0395901_0001707 3300038443 Bacteria 22683
175 Ga0395901_0048060 3300038443 Bacteria 4431
176 Ga0395901_0309015 3300038443 Bacteria 1638
177 Ga0436365_0239293 3300039437 Bacteria 16184
178 Ga0436365_0381106 3300039437 Bacteria 7685
179 Ga0436365_1403587 3300039437 Bacteria 3250
180 Ga0436360_0497281 3300039438 Bacteria 1078
181 Ga0436360_1068656 3300039438 Bacteria 2162
182 Ga0436360_1173672 3300039438 Bacteria 10524
183 Ga0436361_0313119 3300039447 Bacteria 1862
184 Ga0436361_0803846 3300039447 Bacteria 1359
185 Ga0436361_0986989 3300039447 Bacteria 4284
186 Ga0436361_1173213 3300039447 Bacteria 1382
187 Ga0439465_0042045 3300041413 Bacteria 1480
188 Ga0439448_0080169 3300042005 Bacteria 1096
189 Ga0466963_0017386 3300044694 Bacteria 4483
190 Ga0466964_0061501 3300044706 Bacteria 1564
191 Ga0453684_0478588 3300044712 Bacteria 1382
192 Ga0466960_0030985 3300044901 Bacteria 2465
193 Ga0466967_0406387 3300045976 Bacteria 1325
194 Ga0495592_0248912 3300046454 Bacteria 1175
195 Ga0495641_0015749 3300046461 Bacteria 4016
196 Ga0495651_0002212 3300046462 Bacteria 15014
197 Ga0495639_0003461 3300046475 Bacteria 6836
198 Ga0495662_0039681 3300046476 Bacteria 2274
199 Ga0495662_0071195 3300046476 Bacteria 1685
200 Ga0495664_0027796 3300046477 Bacteria 3300
201 Ga0495608_0054626 3300046511 Bacteria 2640
202 Ga0495618_0147140 3300046514 Bacteria 1505
203 Ga0495628_0005593 3300046516 Bacteria 11002
204 Ga0495628_0202849 3300046516 Bacteria 1493
205 Ga0495630_0076406 3300046517 Bacteria 2523
206 Ga0495665_0019614 3300046531 Bacteria 3637
207 Ga0495586_0012409 3300046535 Bacteria 4519
208 Ga0495587_0021137 3300046536 Bacteria 4013
209 Ga0495587_0048762 3300046536 Bacteria 2508
210 Ga0495645_0000858 3300046543 Bacteria 20726
211 Ga0495667_0025997 3300046559 Bacteria 3943
212 Ga0495667_0043777 3300046559 Bacteria 2966
213 Ga0495635_0036562 3300046663 Bacteria 3403
214 Ga0495657_0031895 3300046675 Bacteria 3680
215 Ga0495657_0035610 3300046675 Bacteria 3448
216 Ga0495599_0001807 3300046678 Bacteria 12416
217 Ga0495599_0113172 3300046678 Bacteria 1689
218 Ga0495624_0007796 3300046690 Bacteria 7511
219 Ga0495636_0006331 3300047318 Bacteria 4650
220 Ga0495674_0045831 3300047319 Bacteria 3882
221 Ga0495674_0129173 3300047319 Bacteria 2130
222 Ga0495680_0051872 3300047322 Bacteria 3200
223 Ga0495675_0077740 3300047444 Bacteria 2090
224 Ga0495684_0439373 3300047471 Unclassified 909
225 Ga0496100_0007527 3300048903 Bacteria 6015
226 Ga0496101_0003618 3300048904 Bacteria 9646
227 Ga0496102_0001206 3300048905 Bacteria 23466
228 Ga0496103_0054156 3300048906 Bacteria 2487
229 Ga0496104_0001937 3300048907 Bacteria 17935
230 Ga0496106_0015450 3300048909 Bacteria 5651
231 Ga0496107_0000601 3300048910 Bacteria 20084
232 Ga0496108_0032146 3300048911 Bacteria 4357
233 Ga0496108_0068127 3300048911 Bacteria 3002
234 Ga0496109_0009002 3300048912 Bacteria 8501
235 Ga0496109_0064583 3300048912 Bacteria 3350
236 Ga0496110_0001677 3300048913 Bacteria 16256
237 Ga0496110_0018727 3300048913 Bacteria 5808
238 Ga0496111_0000535 3300048914 Bacteria 19672
239 Ga0496111_0044991 3300048914 Bacteria 3175
240 Ga0496112_0036888 3300048915 Bacteria 4769
241 Ga0496112_0102905 3300048915 Bacteria 2825
242 Ga0496114_0040909 3300048917 Bacteria 3840
243 Ga0496115_0092367 3300048918 Bacteria 2474
244 Ga0496119_0031179 3300048922 Bacteria 3581
245 Ga0496126_0093720 3300048929 Bacteria 2636
246 Ga0501031_0006362 3300049568 Bacteria 7703
247 Ga0501032_0058870 3300049569 Bacteria 2579
248 Ga0501033_0065641 3300049570 Bacteria 2670
249 Ga0501034_0000983 3300049571 Bacteria 40911
250 Ga0501034_0001248 3300049571 Bacteria 34572
251 Ga0501036_0051167 3300049572 Bacteria 3498
252 Ga0501038_0050090 3300049574 Bacteria 3610
253 Ga0501039_0004796 3300049575 Bacteria 10238
254 Ga0501040_0057721 3300049576 Bacteria 2665
255 Ga0501041_0019503 3300049577 Bacteria 4050
256 Ga0501043_0374753 3300049579 Bacteria 1078
257 Ga0501046_0033034 3300049580 Bacteria 4186
258 Ga0501047_0146897 3300049581 Bacteria 2234
259 Ga0501048_0009989 3300049582 Bacteria 7106
260 Ga0501068_0003725 3300049584 Bacteria 8248
261 Ga0501070_0179415 3300049586 Bacteria 1743
262 Ga0501070_0258146 3300049586 Bacteria 1425
263 Ga0501071_0019723 3300049587 Bacteria 4680
264 Ga0501072_0003852 3300049588 Bacteria 11338
265 Ga0501074_0140041 3300049590 Bacteria 1731
266 Ga0501075_0008660 3300049591 Bacteria 7091
267 Ga0501076_0013656 3300049592 Bacteria 6094
268 Ga0501076_0032570 3300049592 Bacteria 4068
269 Ga0501076_0046513 3300049592 Bacteria 3429
270 Ga0501077_0005408 3300049593 Bacteria 7765
271 Ga0501077_0010516 3300049593 Bacteria 5761
272 Ga0501079_0009679 3300049741 Bacteria 7308
273 Ga0501081_0057536 3300049743 Bacteria 2688
274 Ga0501081_0083624 3300049743 Bacteria 2237
275 Ga0501083_0284860 3300049744 Bacteria 1075
276 Ga0501044_0148660 3300049823 Bacteria 2326
277 Ga0501044_0206459 3300049823 Bacteria 1921
278 Ga0501045_0036907 3300049824 Bacteria 3550
279 Ga0501045_0244332 3300049824 Bacteria 1336
280 Ga0501045_0254102 3300049824 Bacteria 1308
281 nmdc:mga03683_11492_c1 3300050489 Bacteria 3207
282 nmdc:mga03n38_34808_c1 3300050490 Bacteria 2154
283 nmdc:mga00v17_19810_c1 3300050491 Bacteria 3847
284 nmdc:mga00v17_66690_c1 3300050491 Bacteria 2222
285 nmdc:mga0k408_103064_c1 3300050493 Bacteria 1363
286 nmdc:mga0k408_72518_c1 3300050493 Bacteria 2011
287 nmdc:mga06z11_48960_c1 3300050494 Bacteria 2154
288 nmdc:mga04h51_68850_c1 3300050495 Bacteria 1231
289 nmdc:mga07m45_18344_c1 3300050496 Bacteria 3775
290 nmdc:mga05p37_75404_c1 3300050507 Bacteria 4151
291 nmdc:mga09592_2063_c1 3300050508 Bacteria 16199
292 nmdc:mga09592_28838_c1 3300050508 Bacteria 4614
293 nmdc:mga09592_473003_c1 3300050508 Bacteria 1080
294 nmdc:mga0qj67_172785_c1 3300050509 Bacteria 1755
295 nmdc:mga0qj67_20_c1 3300050509 Bacteria 109238
296 nmdc:mga06r32_25894_c1 3300050510 Bacteria 5462
297 nmdc:mga08y16_289502_c1 3300050511 Bacteria 1689
298 nmdc:mga08y16_412675_c1 3300050511 Bacteria 1381
299 nmdc:mga08y16_516091_c1 3300050511 Bacteria 1212
300 nmdc:mga08y16_5771_c1 3300050511 Bacteria 12961
301 nmdc:mga0n895_414938_c1 3300050512 Bacteria 1361
302 nmdc:mga08x19_253073_c1 3300050514 Bacteria 1216
303 nmdc:mga08x19_79483_c1 3300050514 Bacteria 2151
304 nmdc:mga0a205_365377_c1 3300050515 Bacteria 1309
305 nmdc:mga0a205_421172_c1 3300050515 Bacteria 1197
306 nmdc:mga0sz30_18432_c1 3300050516 Bacteria 2793
307 Ga0495601_0003987 3300053077 Bacteria 8499
308 Ga0495595_0025684 3300053084 Bacteria 2612
309 Ga0495619_0018244 3300053085 Bacteria 4451
310 Ga0495619_0036106 3300053085 Bacteria 3217
311 Ga0500647_0026720 3300053091 Bacteria 2724
312 Ga0500651_0225098 3300053093 Bacteria 1099
313 Ga0500641_0055900 3300053096 Bacteria 1634
314 Ga0500620_008973 3300053155 Bacteria 2556
315 Ga0501084_0011282 3300054114 Bacteria 7396
316 Ga0501084_0063132 3300054114 Bacteria 3101
317 Ga0501082_0036048 3300060353 Bacteria 4262
318 Ga0501082_0072550 3300060353 Bacteria 2965
319 Ga0501082_0177201 3300060353 Bacteria 1854
320 Ga0530510_0006864 3300061734 Bacteria 7934
321 Ga0373925_0115124
322 Ga0070658_10014137
323 Ga0070683_100047837
324 Ga0070690_100093512
325 Ga0070680_100001388
326 Ga0070680_100044708
327 Ga0070669_100130724
328 Ga0070675_100472423
329 Ga0070688_100229069
330 Ga0070659_100196397
331 Ga0070709_10034982
332 Ga0070714_100016839
333 Ga0070714_100201654
334 Ga0070713_100008203
335 Ga0070713_100200885
336 Ga0070713_100335272
337 Ga0070710_10033736
338 Ga0070701_10026747
339 Ga0070711_100143950
340 Ga0070694_100133538
341 Ga0070708_100344701
342 Ga0070681_10002673
343 Ga0070681_10017123
344 Ga0070698_100001924
345 Ga0070699_100018896
346 Ga0070679_100003503
347 Ga0070679_100037432
348 Ga0070679_100076934
349 Ga0070695_100186792
350 Ga0070665_100267793
351 Ga0070704_100190748
352 Ga0068855_100091258
353 Ga0068855_100329282
354 Ga0068855_100429274
355 Ga0070664_100007439
356 Ga0068852_100118167
357 Ga0068859_100019800
358 Ga0068851_10121877
359 Ga0068858_100124469
360 Ga0081455_10000368
361 Ga0081539_10001642
362 Ga0081539_10047085
363 Ga0070717_10216289
364 Ga0075365_10005778
365 Ga0075365_10132648
366 Ga0075365_10231031
367 Ga0075368_10003775
368 Ga0075368_10039982
369 Ga0075363_100114675
370 Ga0075364_10005251
371 Ga0070716_100053077
372 Ga0070712_100016229
373 Ga0070712_100279601
374 Ga0075362_10024953
375 Ga0075362_10116897
376 Ga0075362_10122342
377 Ga0075367_10021320
378 Ga0075369_10000574
379 Ga0075369_10010495
380 Ga0075369_10023282
381 Ga0075366_10168219
382 Ga0075370_10020359
383 Ga0075370_10022325
384 Ga0075370_10033354
385 Ga0075428_100048916
386 Ga0075430_100000665
387 Ga0075430_100155691
388 Ga0075431_100041288
389 Ga0075433_10163477
390 Ga0075433_10338541
391 Ga0075429_100072393
392 Ga0075436_100074057
393 Ga0075436_100103366
394 Ga0097620_100019800
395 Ga0075435_100066335
396 Ga0105240_10030893
397 Ga0105240_10118659
398 Ga0111539_10476225
399 Ga0114129_10002493
400 Ga0114129_10092726
401 Ga0114129_10161083
402 Ga0114129_10381113
403 Ga0114129_10388979
404 Ga0105243_10431177
405 Ga0105241_10231053
406 Ga0105238_10053034
407 Ga0105238_10089133
408 Ga0105249_10241503
409 Ga0105239_10061470
410 Ga0105239_10489329
411 Ga0105239_10846017
412 Ga0157370_10012658
413 Ga0157370_10140301
414 Ga0157369_10255868
415 Ga0157372_10108888
416 Ga0157372_10436186
417 Ga0213872_10057851
418 Ga0213876_10012215
419 Ga0213876_10082801
420 Ga0213871_10013914
421 Ga0207426_1014592
422 Ga0207647_10128637
423 Ga0207705_10075765
424 Ga0207684_10041973
425 Ga0207707_10010790
426 Ga0207695_10054420
427 Ga0207693_10078635
428 Ga0207693_10102809
429 Ga0207663_10189748
430 Ga0207660_10030585
431 Ga0207660_10032358
432 Ga0207660_10243056
433 Ga0207652_10004944
434 Ga0207652_10009135
435 Ga0207694_10073452
436 Ga0207694_10089872
437 Ga0207659_10065179
438 Ga0207700_10005020
439 Ga0207700_10110678
440 Ga0207664_10020397
441 Ga0207664_10180896
442 Ga0207690_10140639
443 Ga0207706_10255789
444 Ga0207686_10168394
445 Ga0207665_10006466
446 Ga0207661_10080661
447 Ga0207667_10058968
448 Ga0207667_10254777
449 Ga0207651_10297441
450 Ga0207651_10331376
451 Ga0207703_10069052
452 Ga0207639_10042772
453 Ga0207702_10030263
454 Ga0207702_10191056
455 Ga0207698_10056806
456 Ga0207428_10004874
457 Ga0268266_10035883
458 Ga0265334_10004421
459 Ga0265340_10064369
460 Ga0373934_0001622
461 Ga0373923_0046482
462 Ga0373923_0083763
463 Ga0373932_0015862
464 Ga0373936_0012953
465 Ga0373953_0005198
466 Ga0373954_0018211
467 Ga0373956_0000404
468 Ga0373956_0013091
469 Ga0373957_0082442
470 Ga0373943_0059244
471 Ga0373946_0007658
472 Ga0373955_0015393
473 Ga0373935_0039812
474 Ga0373935_0090571
475 Ga0373935_0096171
476 Ga0373935_0109850
477 Ga0373927_0006591
478 Ga0373933_0042763
479 Ga0373937_0015651
480 Ga0373937_0051815
481 Ga0373937_0119854
482 Ga0373937_0174914
483 Ga0373925_0014018
484 Ga0373925_0115480
485 Ga0373925_0206339
486 Ga0373925_0210208
487 Ga0395900_0047923
488 Ga0395900_0093855
489 Ga0395898_0041198
490 Ga0395905_0173964
491 Ga0436364_0680861
492 Ga0436364_1319509
493 Ga0436364_1458897
494 Ga0395901_0001707
495 Ga0395901_0048060
496 Ga0395901_0309015
497 Ga0436365_0239293
498 Ga0436365_0381106
499 Ga0436365_1403587
500 Ga0436360_0497281
501 Ga0436360_1068656
502 Ga0436360_1173672
503 Ga0436361_0313119
504 Ga0436361_0803846
505 Ga0436361_0986989
506 Ga0436361_1173213
507 Ga0439465_0042045
508 Ga0439448_0080169
509 Ga0466963_0017386
510 Ga0466964_0061501
511 Ga0453684_0478588
512 Ga0466960_0030985
513 Ga0466967_0406387
514 Ga0495592_0248912
515 Ga0495641_0015749
516 Ga0495651_0002212
517 Ga0495639_0003461
518 Ga0495662_0039681
519 Ga0495662_0071195
520 Ga0495664_0027796
521 Ga0495608_0054626
522 Ga0495618_0147140
523 Ga0495628_0005593
524 Ga0495628_0202849
525 Ga0495630_0076406
526 Ga0495665_0019614
527 Ga0495586_0012409
528 Ga0495587_0021137
529 Ga0495587_0048762
530 Ga0495645_0000858
531 Ga0495667_0025997
532 Ga0495667_0043777
533 Ga0495635_0036562
534 Ga0495657_0031895
535 Ga0495657_0035610
536 Ga0495599_0001807
537 Ga0495599_0113172
538 Ga0495624_0007796
539 Ga0495636_0006331
540 Ga0495674_0045831
541 Ga0495674_0129173
542 Ga0495680_0051872
543 Ga0495675_0077740
544 Ga0495684_0439373
545 Ga0496100_0007527
546 Ga0496101_0003618
547 Ga0496102_0001206
548 Ga0496103_0054156
549 Ga0496104_0001937
550 Ga0496106_0015450
551 Ga0496107_0000601
552 Ga0496108_0032146
553 Ga0496108_0068127
554 Ga0496109_0009002
555 Ga0496109_0064583
556 Ga0496110_0001677
557 Ga0496110_0018727
558 Ga0496111_0000535
559 Ga0496111_0044991
560 Ga0496112_0036888
561 Ga0496112_0102905
562 Ga0496114_0040909
563 Ga0496115_0092367
564 Ga0496119_0031179
565 Ga0496126_0093720
566 Ga0501031_0006362
567 Ga0501032_0058870
568 Ga0501033_0065641
569 Ga0501034_0000983
570 Ga0501034_0001248
571 Ga0501036_0051167
572 Ga0501038_0050090
573 Ga0501039_0004796
574 Ga0501040_0057721
575 Ga0501041_0019503
576 Ga0501043_0374753
577 Ga0501046_0033034
578 Ga0501047_0146897
579 Ga0501048_0009989
580 Ga0501068_0003725
581 Ga0501070_0179415
582 Ga0501070_0258146
583 Ga0501071_0019723
584 Ga0501072_0003852
585 Ga0501074_0140041
586 Ga0501075_0008660
587 Ga0501076_0013656
588 Ga0501076_0032570
589 Ga0501076_0046513
590 Ga0501077_0005408
591 Ga0501077_0010516
592 Ga0501079_0009679
593 Ga0501081_0057536
594 Ga0501081_0083624
595 Ga0501083_0284860
596 Ga0501044_0148660
597 Ga0501044_0206459
598 Ga0501045_0036907
599 Ga0501045_0244332
600 Ga0501045_0254102
601 nmdc:mga03683_11492_c1
602 nmdc:mga03n38_34808_c1
603 nmdc:mga00v17_19810_c1
604 nmdc:mga00v17_66690_c1
605 nmdc:mga0k408_103064_c1
606 nmdc:mga0k408_72518_c1
607 nmdc:mga06z11_48960_c1
608 nmdc:mga04h51_68850_c1
609 nmdc:mga07m45_18344_c1
610 nmdc:mga05p37_75404_c1
611 nmdc:mga09592_2063_c1
612 nmdc:mga09592_28838_c1
613 nmdc:mga09592_473003_c1
614 nmdc:mga0qj67_172785_c1
615 nmdc:mga0qj67_20_c1
616 nmdc:mga06r32_25894_c1
617 nmdc:mga08y16_289502_c1
618 nmdc:mga08y16_412675_c1
619 nmdc:mga08y16_516091_c1
620 nmdc:mga08y16_5771_c1
621 nmdc:mga0n895_414938_c1
622 nmdc:mga08x19_253073_c1
623 nmdc:mga08x19_79483_c1
624 nmdc:mga0a205_365377_c1
625 nmdc:mga0a205_421172_c1
626 nmdc:mga0sz30_18432_c1
627 Ga0495601_0003987
628 Ga0495595_0025684
629 Ga0495619_0018244
630 Ga0495619_0036106
631 Ga0500647_0026720
632 Ga0500651_0225098
633 Ga0500641_0055900
634 Ga0500620_008973
635 Ga0501084_0011282
636 Ga0501084_0063132
637 Ga0501082_0036048
638 Ga0501082_0072550
639 Ga0501082_0177201
640 Ga0530510_0006864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

44

312

0.83

Map