F405589
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 320 | 235 | 278 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300031249|Ga0265339_10024353|Ga0265339_100243534 |
| Length | 219 |
| Sequence | MTVTHHPPENLLAGFASGLLEEAEHLVVGVHVAGCPGCRRFLHAIEQLAGTAIEEAAPVPMSEDAFDLVMAHVREMPPTGAPRPAPVRTVWPAPGRQDLPELLRRYRLGKRRRVAPGVSVQPIELSGSGKARAFLLQSAPGTRMLEHTHSGTELTCVLEGSFSHDAGRYGPGDFDYGDDDIDHRPVVGDEGPCLCLVAMTGDLRMNGFLGRLISPFVRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 4 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 5 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 6 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 7 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 8 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 9 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 10 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 11 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 12 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 13 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 14 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 15 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 16 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 17 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 18 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 19 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 20 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 21 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 22 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 23 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 24 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 25 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 26 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 27 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 28 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 29 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 30 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 31 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 32 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 33 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 34 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 35 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 36 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 37 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 81 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 82 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 83 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 84 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 87 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 115 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 123 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 127 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 130 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 135 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 144 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 145 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 188 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 189 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 190 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 207 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 208 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 209 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 210 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 211 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 218 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 219 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 220 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 221 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 222 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 223 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 224 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 225 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 226 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 227 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 228 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 230 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 231 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 232 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 233 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 234 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 235 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.88 |
| Metatranscriptomes | 0 |
| Isolates | 13.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.69 |
| Nodule | 7.5 |
| Rhizoplane | 4.06 |
| Rhizosphere | 55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000404 | 3300003215 | Bacteria | 28752 |
| 2 | JGI25153J46596_10000444 | 3300003215 | Bacteria | 26578 |
| 3 | JGI25153J46596_10000505 | 3300003215 | Bacteria | 24803 |
| 4 | JGI25153J46596_10005197 | 3300003215 | Bacteria | 6851 |
| 5 | rootH1_10083050 | 3300003323 | Bacteria | 2215 |
| 6 | Ga0055542_1008135 | 3300003762 | Bacteria | 2070 |
| 7 | Ga0055526_1028009 | 3300003771 | Bacteria | 1718 |
| 8 | Ga0055531_10001806 | 3300003794 | Bacteria | 15188 |
| 9 | Ga0065165_1003972 | 3300005262 | Bacteria | 9688 |
| 10 | Ga0070658_10027598 | 3300005327 | Bacteria | 4554 |
| 11 | Ga0070690_100308339 | 3300005330 | Bacteria | 1137 |
| 12 | Ga0070682_100466921 | 3300005337 | Bacteria | 970 |
| 13 | Ga0070661_100093021 | 3300005344 | Bacteria | 2234 |
| 14 | Ga0070692_10423429 | 3300005345 | Bacteria | 846 |
| 15 | Ga0070668_100805828 | 3300005347 | Unclassified | 835 |
| 16 | Ga0070663_100040772 | 3300005455 | Bacteria | 3252 |
| 17 | Ga0070685_10302776 | 3300005466 | Bacteria | 1078 |
| 18 | Ga0068853_100401989 | 3300005539 | Bacteria | 1282 |
| 19 | Ga0070664_100238796 | 3300005564 | Bacteria | 1631 |
| 20 | Ga0068854_100658007 | 3300005578 | Bacteria | 900 |
| 21 | Ga0068856_100076363 | 3300005614 | Bacteria | 3319 |
| 22 | Ga0068852_100005260 | 3300005616 | Bacteria | 9237 |
| 23 | Ga0068852_100153141 | 3300005616 | Bacteria | 2146 |
| 24 | Ga0068852_100714017 | 3300005616 | Bacteria | 1013 |
| 25 | Ga0068851_10163649 | 3300005834 | Bacteria | 1224 |
| 26 | Ga0068858_100034060 | 3300005842 | Bacteria | 4725 |
| 27 | Ga0081455_10018489 | 3300005937 | Bacteria | 6636 |
| 28 | Ga0081540_1000186 | 3300005983 | Bacteria | 64680 |
| 29 | Ga0075365_10037551 | 3300006038 | Bacteria | 3145 |
| 30 | Ga0075365_10090213 | 3300006038 | Bacteria | 2087 |
| 31 | Ga0075363_100065398 | 3300006048 | Bacteria | 1966 |
| 32 | Ga0075362_10168740 | 3300006177 | Bacteria | 1056 |
| 33 | Ga0075367_10175647 | 3300006178 | Bacteria | 1335 |
| 34 | Ga0075366_10031430 | 3300006195 | Bacteria | 3124 |
| 35 | Ga0075366_10165660 | 3300006195 | Bacteria | 1340 |
| 36 | Ga0068871_100670805 | 3300006358 | Unclassified | 948 |
| 37 | Ga0075428_100302906 | 3300006844 | Bacteria | 1718 |
| 38 | Ga0075435_100453924 | 3300007076 | Bacteria | 1105 |
| 39 | Ga0105240_10001648 | 3300009093 | Bacteria | 37903 |
| 40 | Ga0105240_12185250 | 3300009093 | Bacteria | 574 |
| 41 | Ga0111539_10036387 | 3300009094 | Bacteria | 5952 |
| 42 | Ga0105247_10055493 | 3300009101 | Bacteria | 2445 |
| 43 | Ga0105243_10092404 | 3300009148 | Bacteria | 2495 |
| 44 | Ga0105241_10041842 | 3300009174 | Bacteria | 3463 |
| 45 | Ga0105241_10053627 | 3300009174 | Bacteria | 3084 |
| 46 | Ga0105237_10001549 | 3300009545 | Bacteria | 30005 |
| 47 | Ga0105237_10061035 | 3300009545 | Bacteria | 3770 |
| 48 | Ga0105238_10168876 | 3300009551 | Bacteria | 2164 |
| 49 | Ga0105239_10082271 | 3300010375 | Bacteria | 3545 |
| 50 | Ga0105239_10097570 | 3300010375 | Bacteria | 3248 |
| 51 | Ga0105239_10232711 | 3300010375 | Bacteria | 2067 |
| 52 | Ga0105239_10377867 | 3300010375 | Bacteria | 1602 |
| 53 | Ga0105239_11525136 | 3300010375 | Bacteria | 772 |
| 54 | Ga0157369_10725821 | 3300013105 | Bacteria | 1023 |
| 55 | Ga0163162_10761146 | 3300013306 | Unclassified | 1087 |
| 56 | Ga0163163_10456518 | 3300014325 | Bacteria | 1338 |
| 57 | Ga0163163_11646402 | 3300014325 | Bacteria | 703 |
| 58 | Ga0157380_10743014 | 3300014326 | Bacteria | 991 |
| 59 | Ga0157376_10747114 | 3300014969 | Bacteria | 987 |
| 60 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 61 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 62 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 63 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 64 | Ga0213873_10002065 | 3300021358 | Bacteria | 3436 |
| 65 | Ga0213876_10059834 | 3300021384 | Bacteria | 2010 |
| 66 | Ga0213876_10133759 | 3300021384 | Bacteria | 1319 |
| 67 | Ga0213871_10001555 | 3300021441 | Bacteria | 3891 |
| 68 | Ga0209563_100932 | 3300025230 | Bacteria | 8632 |
| 69 | Ga0209677_101180 | 3300025253 | Bacteria | 11980 |
| 70 | Ga0209677_101275 | 3300025253 | Bacteria | 11294 |
| 71 | Ga0209677_103268 | 3300025253 | Bacteria | 5380 |
| 72 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 73 | Ga0209148_1015720 | 3300025254 | Bacteria | 1316 |
| 74 | Ga0209233_1002031 | 3300025261 | Bacteria | 7661 |
| 75 | Ga0209455_1001087 | 3300025272 | Bacteria | 13381 |
| 76 | Ga0209455_1009129 | 3300025272 | Bacteria | 2629 |
| 77 | Ga0209455_1009671 | 3300025272 | Bacteria | 2512 |
| 78 | Ga0209673_1030996 | 3300025273 | Bacteria | 1672 |
| 79 | Ga0209564_1014288 | 3300025295 | Bacteria | 3313 |
| 80 | Ga0209564_1032677 | 3300025295 | Bacteria | 1562 |
| 81 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 82 | Ga0209758_1000161 | 3300025297 | Bacteria | 154278 |
| 83 | Ga0209758_1000673 | 3300025297 | Bacteria | 51032 |
| 84 | Ga0209758_1003001 | 3300025297 | Bacteria | 16160 |
| 85 | Ga0209758_1017700 | 3300025297 | Bacteria | 3530 |
| 86 | Ga0209256_1002321 | 3300025299 | Bacteria | 15930 |
| 87 | Ga0207426_1007683 | 3300025302 | Bacteria | 4479 |
| 88 | Ga0207426_1082470 | 3300025302 | Bacteria | 869 |
| 89 | Ga0209257_1000762 | 3300025304 | Bacteria | 48195 |
| 90 | Ga0207656_10225937 | 3300025321 | Bacteria | 911 |
| 91 | Ga0207699_10577818 | 3300025906 | Bacteria | 817 |
| 92 | Ga0207654_10027508 | 3300025911 | Bacteria | 3091 |
| 93 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 94 | Ga0207671_10011529 | 3300025914 | Bacteria | 7183 |
| 95 | Ga0207657_10104894 | 3300025919 | Bacteria | 2341 |
| 96 | Ga0207649_10013845 | 3300025920 | Bacteria | 4510 |
| 97 | Ga0207644_10327623 | 3300025931 | Bacteria | 1240 |
| 98 | Ga0207709_10165525 | 3300025935 | Bacteria | 1546 |
| 99 | Ga0207669_10129310 | 3300025937 | Bacteria | 1732 |
| 100 | Ga0207668_10297999 | 3300025972 | Bacteria | 1330 |
| 101 | Ga0207640_10612334 | 3300025981 | Bacteria | 923 |
| 102 | Ga0207678_10026149 | 3300026067 | Bacteria | 5092 |
| 103 | Ga0207702_10352945 | 3300026078 | Bacteria | 1408 |
| 104 | Ga0207702_10687147 | 3300026078 | Bacteria | 1008 |
| 105 | Ga0207428_10094569 | 3300027907 | Bacteria | 2316 |
| 106 | Ga0268266_10609616 | 3300028379 | Bacteria | 1049 |
| 107 | Ga0265319_1005142 | 3300028563 | Bacteria | 6332 |
| 108 | Ga0265334_10011710 | 3300028573 | Bacteria | 3687 |
| 109 | Ga0265318_10045596 | 3300028577 | Bacteria | 1657 |
| 110 | Ga0265323_10001015 | 3300028653 | Bacteria | 14625 |
| 111 | Ga0265322_10026935 | 3300028654 | Bacteria | 1643 |
| 112 | Ga0265336_10001751 | 3300028666 | Bacteria | 9520 |
| 113 | Ga0265338_10000034 | 3300028800 | Bacteria | 244623 |
| 114 | Ga0265324_10002947 | 3300029957 | Bacteria | 8335 |
| 115 | Ga0265339_10024353 | 3300031249 | Bacteria | 3488 |
| 116 | Ga0265314_10069956 | 3300031711 | Bacteria | 2353 |
| 117 | Ga0265342_10006582 | 3300031712 | Bacteria | 8640 |
| 118 | Ga0373934_0003275 | 3300035086 | Bacteria | 5926 |
| 119 | Ga0373934_0016681 | 3300035086 | Bacteria | 2794 |
| 120 | Ga0373923_0000031 | 3300035111 | Bacteria | 21086 |
| 121 | Ga0373953_0000141 | 3300035117 | Bacteria | 18151 |
| 122 | Ga0373954_0000134 | 3300035118 | Bacteria | 25551 |
| 123 | Ga0373954_0068703 | 3300035118 | Unclassified | 1681 |
| 124 | Ga0373956_0000450 | 3300035119 | Bacteria | 16809 |
| 125 | Ga0373957_0100715 | 3300035120 | Bacteria | 1156 |
| 126 | Ga0373955_0006249 | 3300035172 | Bacteria | 5418 |
| 127 | Ga0373955_0012207 | 3300035172 | Bacteria | 4124 |
| 128 | Ga0373924_0011555 | 3300035410 | Bacteria | 3282 |
| 129 | Ga0373924_0045451 | 3300035410 | Bacteria | 1806 |
| 130 | Ga0373931_0074879 | 3300035691 | Bacteria | 1855 |
| 131 | Ga0373927_0010088 | 3300035695 | Bacteria | 6322 |
| 132 | Ga0373927_0015030 | 3300035695 | Bacteria | 5119 |
| 133 | Ga0373933_0000355 | 3300035724 | Bacteria | 29357 |
| 134 | Ga0373933_0363533 | 3300035724 | Bacteria | 941 |
| 135 | Ga0373937_0006901 | 3300036401 | Bacteria | 9800 |
| 136 | Ga0373937_0027559 | 3300036401 | Bacteria | 5138 |
| 137 | Ga0395899_0060232 | 3300037312 | Bacteria | 2797 |
| 138 | Ga0395900_0001627 | 3300037418 | Bacteria | 26397 |
| 139 | Ga0395898_0002504 | 3300037466 | Bacteria | 21600 |
| 140 | Ga0395905_0175198 | 3300037471 | Bacteria | 2014 |
| 141 | Ga0395901_0047905 | 3300038443 | Bacteria | 4438 |
| 142 | Ga0436365_1284928 | 3300039437 | Bacteria | 4419 |
| 143 | Ga0436365_1498211 | 3300039437 | Bacteria | 1483 |
| 144 | Ga0436360_0074838 | 3300039438 | Bacteria | 1977 |
| 145 | Ga0436360_0134404 | 3300039438 | Bacteria | 2963 |
| 146 | Ga0436363_1080701 | 3300039450 | Bacteria | 1378 |
| 147 | Ga0436362_0753495 | 3300039453 | Bacteria | 3283 |
| 148 | Ga0451853_4079112 | 3300041512 | Bacteria | 592 |
| 149 | Ga0466969_0020261 | 3300044656 | Bacteria | 3446 |
| 150 | Ga0466966_0001143 | 3300044684 | Bacteria | 17046 |
| 151 | Ga0466961_0000018 | 3300044693 | Bacteria | 109837 |
| 152 | Ga0466961_0113366 | 3300044693 | Bacteria | 1705 |
| 153 | Ga0466957_0192625 | 3300044842 | Bacteria | 1336 |
| 154 | Ga0466959_0008322 | 3300045049 | Bacteria | 7326 |
| 155 | Ga0495592_0000336 | 3300046454 | Bacteria | 38837 |
| 156 | Ga0495592_0118034 | 3300046454 | Bacteria | 1870 |
| 157 | Ga0495629_0000373 | 3300046459 | Bacteria | 37733 |
| 158 | Ga0495629_0000648 | 3300046459 | Bacteria | 28117 |
| 159 | Ga0495629_0184915 | 3300046459 | Bacteria | 1443 |
| 160 | Ga0495629_0380090 | 3300046459 | Bacteria | 961 |
| 161 | Ga0495651_0006679 | 3300046462 | Bacteria | 8819 |
| 162 | Ga0495651_0027820 | 3300046462 | Bacteria | 4406 |
| 163 | Ga0495653_0000280 | 3300046463 | Bacteria | 41492 |
| 164 | Ga0495580_0182778 | 3300046472 | Bacteria | 1448 |
| 165 | Ga0495664_0111252 | 3300046477 | Bacteria | 1653 |
| 166 | Ga0495664_0116256 | 3300046477 | Bacteria | 1617 |
| 167 | Ga0495606_0044898 | 3300046507 | Bacteria | 2935 |
| 168 | Ga0495608_0000429 | 3300046511 | Bacteria | 29273 |
| 169 | Ga0495618_0082661 | 3300046514 | Bacteria | 2051 |
| 170 | Ga0495618_0100595 | 3300046514 | Bacteria | 1850 |
| 171 | Ga0495628_0071316 | 3300046516 | Bacteria | 2708 |
| 172 | Ga0495630_0033410 | 3300046517 | Bacteria | 3837 |
| 173 | Ga0495652_0005440 | 3300046529 | Bacteria | 11999 |
| 174 | Ga0495652_0074144 | 3300046529 | Bacteria | 2831 |
| 175 | Ga0495652_0408575 | 3300046529 | Bacteria | 959 |
| 176 | Ga0495652_0715980 | 3300046529 | Bacteria | 672 |
| 177 | Ga0495640_0009490 | 3300046533 | Bacteria | 7579 |
| 178 | Ga0495640_0094133 | 3300046533 | Bacteria | 1973 |
| 179 | Ga0495640_0366947 | 3300046533 | Bacteria | 887 |
| 180 | Ga0495587_0000330 | 3300046536 | Bacteria | 33854 |
| 181 | Ga0495645_0012065 | 3300046543 | Bacteria | 6089 |
| 182 | Ga0495645_0092894 | 3300046543 | Bacteria | 2154 |
| 183 | Ga0495645_0188370 | 3300046543 | Bacteria | 1408 |
| 184 | Ga0495667_0000519 | 3300046559 | Bacteria | 24591 |
| 185 | Ga0495634_0033248 | 3300046642 | Bacteria | 3544 |
| 186 | Ga0495635_0000473 | 3300046663 | Bacteria | 25458 |
| 187 | Ga0495635_0022057 | 3300046663 | Bacteria | 4437 |
| 188 | Ga0495657_0001309 | 3300046675 | Bacteria | 21677 |
| 189 | Ga0495657_0159463 | 3300046675 | Bacteria | 1396 |
| 190 | Ga0495657_0267818 | 3300046675 | Bacteria | 1025 |
| 191 | Ga0495599_0000663 | 3300046678 | Bacteria | 19472 |
| 192 | Ga0495623_0015002 | 3300046679 | Bacteria | 5008 |
| 193 | Ga0495646_0002908 | 3300046680 | Bacteria | 10615 |
| 194 | Ga0495646_0110228 | 3300046680 | Bacteria | 1568 |
| 195 | Ga0495613_0027832 | 3300046689 | Bacteria | 4207 |
| 196 | Ga0495613_0032521 | 3300046689 | Bacteria | 3876 |
| 197 | Ga0495600_0000322 | 3300046809 | Bacteria | 25358 |
| 198 | Ga0495600_0021115 | 3300046809 | Bacteria | 4168 |
| 199 | Ga0495581_0210460 | 3300047315 | Unclassified | 1137 |
| 200 | Ga0495604_0001349 | 3300047317 | Bacteria | 20067 |
| 201 | Ga0495604_0038817 | 3300047317 | Bacteria | 3746 |
| 202 | Ga0495674_0018451 | 3300047319 | Bacteria | 6492 |
| 203 | Ga0495674_0022946 | 3300047319 | Bacteria | 5749 |
| 204 | Ga0495674_0110806 | 3300047319 | Bacteria | 2327 |
| 205 | Ga0495676_0175014 | 3300047321 | Bacteria | 1508 |
| 206 | Ga0495680_0001452 | 3300047322 | Bacteria | 25551 |
| 207 | Ga0495675_0025145 | 3300047444 | Bacteria | 3797 |
| 208 | Ga0495684_0001954 | 3300047471 | Bacteria | 16552 |
| 209 | Ga0495684_0045548 | 3300047471 | Bacteria | 3357 |
| 210 | Ga0495686_0193008 | 3300047472 | Bacteria | 1173 |
| 211 | Ga0495593_0000385 | 3300047673 | Bacteria | 24478 |
| 212 | Ga0495593_0031993 | 3300047673 | Bacteria | 2870 |
| 213 | Ga0495602_0003529 | 3300048088 | Bacteria | 16161 |
| 214 | Ga0495602_0096762 | 3300048088 | Bacteria | 2434 |
| 215 | Ga0496100_0245051 | 3300048903 | Unclassified | 1324 |
| 216 | Ga0496104_0023990 | 3300048907 | Bacteria | 5612 |
| 217 | Ga0496104_0024828 | 3300048907 | Bacteria | 5518 |
| 218 | Ga0496105_0001072 | 3300048908 | Bacteria | 18938 |
| 219 | Ga0496107_0764204 | 3300048910 | Bacteria | 709 |
| 220 | Ga0496110_0310232 | 3300048913 | Bacteria | 1437 |
| 221 | Ga0496110_1249449 | 3300048913 | Bacteria | 652 |
| 222 | Ga0496112_0074923 | 3300048915 | Bacteria | 3347 |
| 223 | Ga0496112_0354580 | 3300048915 | Bacteria | 1409 |
| 224 | Ga0496112_0357712 | 3300048915 | Bacteria | 1402 |
| 225 | Ga0496113_0257008 | 3300048916 | Bacteria | 1395 |
| 226 | Ga0496113_0518230 | 3300048916 | Unclassified | 957 |
| 227 | Ga0496114_0033665 | 3300048917 | Bacteria | 4224 |
| 228 | Ga0496117_0214590 | 3300048920 | Bacteria | 1076 |
| 229 | Ga0496118_0076900 | 3300048921 | Bacteria | 2370 |
| 230 | Ga0496118_0079494 | 3300048921 | Bacteria | 2314 |
| 231 | Ga0496119_0051250 | 3300048922 | Bacteria | 2538 |
| 232 | Ga0496120_0002979 | 3300048923 | Bacteria | 16113 |
| 233 | Ga0496121_0037280 | 3300048924 | Bacteria | 4321 |
| 234 | Ga0496121_0054217 | 3300048924 | Bacteria | 3353 |
| 235 | Ga0496121_0072836 | 3300048924 | Bacteria | 2756 |
| 236 | Ga0496124_0018782 | 3300048927 | Bacteria | 6460 |
| 237 | Ga0496124_0023911 | 3300048927 | Bacteria | 5565 |
| 238 | Ga0496125_0031553 | 3300048928 | Bacteria | 4721 |
| 239 | Ga0496125_0033936 | 3300048928 | Bacteria | 4506 |
| 240 | Ga0496126_0008292 | 3300048929 | Bacteria | 11222 |
| 241 | Ga0496126_0047701 | 3300048929 | Bacteria | 3921 |
| 242 | Ga0496126_0145246 | 3300048929 | Bacteria | 2038 |
| 243 | Ga0495682_0138707 | 3300049460 | Bacteria | 869 |
| 244 | Ga0501041_0089355 | 3300049577 | Bacteria | 1902 |
| 245 | Ga0501042_0376256 | 3300049578 | Bacteria | 1028 |
| 246 | Ga0501080_0223190 | 3300049742 | Bacteria | 1724 |
| 247 | nmdc:mga03683_77799_c1 | 3300050489 | Unclassified | 1427 |
| 248 | nmdc:mga03n38_99881_c1 | 3300050490 | Unclassified | 1398 |
| 249 | nmdc:mga0yw44_141686_c1 | 3300050492 | Bacteria | 1563 |
| 250 | nmdc:mga0yw44_258695_c1 | 3300050492 | Bacteria | 1160 |
| 251 | nmdc:mga0k408_31449_c1 | 3300050493 | Bacteria | 2580 |
| 252 | nmdc:mga07m45_384670_c1 | 3300050496 | Bacteria | 815 |
| 253 | nmdc:mga08y16_266387_c1 | 3300050511 | Bacteria | 1769 |
| 254 | nmdc:mga0n895_453578_c1 | 3300050512 | Unclassified | 1294 |
| 255 | nmdc:mga0sz30_415707_c1 | 3300050516 | Bacteria | 603 |
| 256 | Ga0495601_0004856 | 3300053077 | Bacteria | 7799 |
| 257 | Ga0495601_0060621 | 3300053077 | Bacteria | 2401 |
| 258 | Ga0495595_0000230 | 3300053084 | Bacteria | 22172 |
| 259 | Ga0495619_0000407 | 3300053085 | Bacteria | 29279 |
| 260 | Ga0500647_0108417 | 3300053091 | Bacteria | 1322 |
| 261 | Ga0500566_0095233 | 3300053094 | Bacteria | 1640 |
| 262 | Ga0500566_0363603 | 3300053094 | Bacteria | 659 |
| 263 | Ga0500640_006818 | 3300053095 | Bacteria | 4397 |
| 264 | Ga0500557_000164 | 3300053105 | Bacteria | 14527 |
| 265 | Ga0500572_001315 | 3300053111 | Bacteria | 6925 |
| 266 | Ga0500595_007590 | 3300053119 | Bacteria | 4492 |
| 267 | Ga0500607_070280 | 3300053121 | Bacteria | 1809 |
| 268 | Ga0500608_016364 | 3300053122 | Bacteria | 3349 |
| 269 | Ga0500614_005470 | 3300053123 | Bacteria | 2666 |
| 270 | Ga0500642_0000088 | 3300053130 | Bacteria | 47518 |
| 271 | Ga0500559_0003990 | 3300053136 | Bacteria | 7093 |
| 272 | Ga0500559_0099982 | 3300053136 | Bacteria | 1335 |
| 273 | Ga0500564_006556 | 3300053138 | Bacteria | 4861 |
| 274 | Ga0500619_041801 | 3300053154 | Bacteria | 1451 |
| 275 | Ga0500638_019549 | 3300053162 | Bacteria | 3176 |
| 276 | Ga0500638_067926 | 3300053162 | Bacteria | 1707 |
| 277 | Ga0500636_0001863 | 3300053177 | Bacteria | 11553 |
| 278 | Ga0500596_002396 | 3300053735 | Bacteria | 3695 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046529 | Ga0495652_0715980 | Ga0495652_0715980_92_655 | 169 |
| 2 | 3300009093 | Ga0105240_12185250 | Ga0105240_121852501 | 172 |
| 3 | 3300035118 | Ga0373954_0068703 | Ga0373954_0068703_26_550 | 172 |
| 4 | 3300041512 | Ga0451853_4079112 | Ga0451853_4079112_20_547 | 172 |
| 5 | 3300048913 | Ga0496110_1249449 | Ga0496110_1249449_19_543 | 172 |
| 6 | 3300050516 | nmdc:mga0sz30_415707_c1 | nmdc:mga0sz30_415707_c1_50_574 | 172 |
| 7 | 3300053094 | Ga0500566_0363603 | Ga0500566_0363603_31_555 | 172 |
| 8 | 3300048929 | Ga0496126_0047701 | Ga0496126_0047701_2437_3087 | 181 |
| 9 | 3300021320 | Ga0214544_1000007 | Ga0214544_1000007274 | 182 |
| 10 | 3300021321 | Ga0214542_1000007 | Ga0214542_1000007107 | 182 |
| 11 | 3300021324 | Ga0214545_1000006 | Ga0214545_1000006186 | 182 |
| 12 | 3300021327 | Ga0214543_1000009 | Ga0214543_1000009274 | 182 |
| 13 | 3300044656 | Ga0466969_0020261 | Ga0466969_0020261_1975_2622 | 188 |
| 14 | 3300044684 | Ga0466966_0001143 | Ga0466966_0001143_3388_4035 | 188 |
| 15 | 3300044693 | Ga0466961_0000018 | Ga0466961_0000018_15666_16313 | 188 |
| 16 | 3300045049 | Ga0466959_0008322 | Ga0466959_0008322_3209_3856 | 188 |
| 17 | 3300037312 | Ga0395899_0060232 | Ga0395899_0060232_1492_2139 | 196 |
| 18 | 3300037418 | Ga0395900_0001627 | Ga0395900_0001627_4382_5029 | 196 |
| 19 | 3300037466 | Ga0395898_0002504 | Ga0395898_0002504_3134_3781 | 196 |
| 20 | 3300037471 | Ga0395905_0175198 | Ga0395905_0175198_828_1475 | 196 |
| 21 | 3300038443 | Ga0395901_0047905 | Ga0395901_0047905_326_973 | 196 |
| 22 | 3300035695 | Ga0373927_0015030 | Ga0373927_0015030_2010_2660 | 198 |
| 23 | 3300035724 | Ga0373933_0363533 | Ga0373933_0363533_262_912 | 198 |
| 24 | 3300046454 | Ga0495592_0118034 | Ga0495592_0118034_87_737 | 198 |
| 25 | 3300046517 | Ga0495630_0033410 | Ga0495630_0033410_1777_2427 | 198 |
| 26 | 3300046543 | Ga0495645_0188370 | Ga0495645_0188370_348_998 | 198 |
| 27 | 3300047319 | Ga0495674_0018451 | Ga0495674_0018451_2464_3114 | 198 |
| 28 | 3300006178 | Ga0075367_10175647 | Ga0075367_101756471 | 199 |
| 29 | 3300006195 | Ga0075366_10165660 | Ga0075366_101656602 | 200 |
| 30 | 3300021384 | Ga0213876_10059834 | Ga0213876_100598341 | 200 |
| 31 | 3300039437 | Ga0436365_1284928 | Ga0436365_1284928_1522_2169 | 200 |
| 32 | 3300014969 | Ga0157376_10747114 | Ga0157376_107471142 | 202 |
| 33 | 3300047315 | Ga0495581_0210460 | Ga0495581_0210460_500_1117 | 202 |
| 34 | 3300048913 | Ga0496110_0310232 | Ga0496110_0310232_504_1151 | 202 |
| 35 | 3300053094 | Ga0500566_0095233 | Ga0500566_0095233_328_975 | 202 |
| 36 | 3300053095 | Ga0500640_006818 | Ga0500640_006818_1407_2054 | 202 |
| 37 | 3300053121 | Ga0500607_070280 | Ga0500607_070280_238_885 | 202 |
| 38 | 3300053122 | Ga0500608_016364 | Ga0500608_016364_2441_3088 | 202 |
| 39 | 3300053123 | Ga0500614_005470 | Ga0500614_005470_285_932 | 202 |
| 40 | 3300053138 | Ga0500564_006556 | Ga0500564_006556_2970_3617 | 202 |
| 41 | 3300053154 | Ga0500619_041801 | Ga0500619_041801_89_736 | 202 |
| 42 | 3300053162 | Ga0500638_019549 | Ga0500638_019549_1448_2095 | 202 |
| 43 | 3300053177 | Ga0500636_0001863 | Ga0500636_0001863_8477_9124 | 202 |
| 44 | 3300021358 | Ga0213873_10002065 | Ga0213873_100020653 | 203 |
| 45 | 3300021441 | Ga0213871_10001555 | Ga0213871_100015553 | 203 |
| 46 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008769 | 203 |
| 47 | 3300039438 | Ga0436360_0134404 | Ga0436360_0134404_1387_2034 | 203 |
| 48 | 3300039453 | Ga0436362_0753495 | Ga0436362_0753495_1127_1774 | 203 |
| 49 | 3300053091 | Ga0500647_0108417 | Ga0500647_0108417_62_712 | 203 |
| 50 | 3300053105 | Ga0500557_000164 | Ga0500557_000164_12933_13583 | 203 |
| 51 | 3300053130 | Ga0500642_0000088 | Ga0500642_0000088_32722_33372 | 203 |
| 52 | iso_pu_bacteria | 2844315083 | 2844315668 | 206 |
| 53 | iso_pu_bacteria | 2903727486 | 2903732638 | 206 |
| 54 | iso_pu_bacteria | 2906602504 | 2906605406 | 206 |
| 55 | iso_pu_bacteria | 3005718088 | 3005720138 | 206 |
| 56 | 3300009174 | Ga0105241_10041842 | Ga0105241_100418423 | 208 |
| 57 | 3300010375 | Ga0105239_10097570 | Ga0105239_100975703 | 208 |
| 58 | iso_pu_bacteria | 8006926726 | 8006926774 | 208 |
| 59 | 3300014326 | Ga0157380_10743014 | Ga0157380_107430141 | 209 |
| 60 | iso_pu_bacteria | 2507262055 | 2507504553 | 209 |
| 61 | iso_pu_bacteria | 2508501009 | 2508545976 | 209 |
| 62 | iso_pu_bacteria | 2791355196 | 2793063607 | 209 |
| 63 | iso_pu_bacteria | 2824600985 | 2824606387 | 209 |
| 64 | iso_pu_bacteria | 2824609381 | 2824616205 | 209 |
| 65 | iso_pu_bacteria | 2824617872 | 2824619504 | 209 |
| 66 | iso_pu_bacteria | 2824626560 | 2824627959 | 209 |
| 67 | iso_pu_bacteria | 2824635225 | 2824635997 | 209 |
| 68 | iso_pu_bacteria | 2824644064 | 2824646251 | 209 |
| 69 | iso_pu_bacteria | 2824653114 | 2824658503 | 209 |
| 70 | iso_pu_bacteria | 2824714736 | 2824720557 | 209 |
| 71 | iso_pu_bacteria | 2824723954 | 2824727561 | 209 |
| 72 | iso_pu_bacteria | 2824746037 | 2824747633 | 209 |
| 73 | iso_pu_bacteria | 2842038055 | 2842044210 | 209 |
| 74 | iso_pu_bacteria | 2842045827 | 2842051801 | 209 |
| 75 | iso_pu_bacteria | 2844315083 | 2844319987 | 209 |
| 76 | iso_pu_bacteria | 2849076700 | 2849082361 | 209 |
| 77 | iso_pu_bacteria | 2881364244 | 2881369769 | 209 |
| 78 | iso_pu_bacteria | 2888388044 | 2888392825 | 209 |
| 79 | iso_pu_bacteria | 2888419890 | 2888427122 | 209 |
| 80 | iso_pu_bacteria | 2903727486 | 2903730338 | 209 |
| 81 | iso_pu_bacteria | 2906602504 | 2906604727 | 209 |
| 82 | iso_pu_bacteria | 2908775508 | 2908782861 | 209 |
| 83 | iso_pu_bacteria | 2935608549 | 2935614296 | 209 |
| 84 | iso_pu_bacteria | 2935819856 | 2935826514 | 209 |
| 85 | iso_pu_bacteria | 2935847175 | 2935851192 | 209 |
| 86 | iso_pu_bacteria | 2935908558 | 2935913241 | 209 |
| 87 | iso_pu_bacteria | 2935916978 | 2935922663 | 209 |
| 88 | iso_pu_bacteria | 2935926038 | 2935930834 | 209 |
| 89 | iso_pu_bacteria | 2935934488 | 2935939832 | 209 |
| 90 | iso_pu_bacteria | 2935942939 | 2935946781 | 209 |
| 91 | iso_pu_bacteria | 2935951376 | 2935956018 | 209 |
| 92 | iso_pu_bacteria | 2935967501 | 2935972811 | 209 |
| 93 | iso_pu_bacteria | 3005506211 | 3005510739 | 209 |
| 94 | iso_pu_bacteria | 3005718088 | 3005723130 | 209 |
| 95 | iso_pu_bacteria | 8019687851 | 8019693351 | 209 |
| 96 | iso_pu_bacteria | 8056967851 | 8056975104 | 209 |
| 97 | 3300005330 | Ga0070690_100308339 | Ga0070690_1003083392 | 210 |
| 98 | 3300006358 | Ga0068871_100670805 | Ga0068871_1006708051 | 210 |
| 99 | 3300007076 | Ga0075435_100453924 | Ga0075435_1004539241 | 210 |
| 100 | 3300009545 | Ga0105237_10061035 | Ga0105237_100610352 | 210 |
| 101 | 3300010375 | Ga0105239_10082271 | Ga0105239_100822715 | 210 |
| 102 | 3300013306 | Ga0163162_10761146 | Ga0163162_107611462 | 210 |
| 103 | 3300025297 | Ga0209758_1017700 | Ga0209758_10177003 | 210 |
| 104 | 3300025937 | Ga0207669_10129310 | Ga0207669_101293102 | 210 |
| 105 | 3300028379 | Ga0268266_10609616 | Ga0268266_106096162 | 210 |
| 106 | 3300039437 | Ga0436365_1498211 | Ga0436365_1498211_215_853 | 210 |
| 107 | 3300048907 | Ga0496104_0023990 | Ga0496104_0023990_4433_5071 | 210 |
| 108 | 3300048910 | Ga0496107_0764204 | Ga0496107_0764204_35_673 | 210 |
| 109 | 3300048915 | Ga0496112_0074923 | Ga0496112_0074923_653_1291 | 210 |
| 110 | 3300049577 | Ga0501041_0089355 | Ga0501041_0089355_737_1375 | 210 |
| 111 | 3300049578 | Ga0501042_0376256 | Ga0501042_0376256_202_840 | 210 |
| 112 | 3300049742 | Ga0501080_0223190 | Ga0501080_0223190_562_1200 | 210 |
| 113 | 3300050512 | nmdc:mga0n895_453578_c1 | nmdc:mga0n895_453578_c1_289_927 | 210 |
| 114 | 3300005466 | Ga0070685_10302776 | Ga0070685_103027761 | 211 |
| 115 | 3300006038 | Ga0075365_10090213 | Ga0075365_100902132 | 211 |
| 116 | 3300006177 | Ga0075362_10168740 | Ga0075362_101687402 | 211 |
| 117 | 3300009148 | Ga0105243_10092404 | Ga0105243_100924042 | 211 |
| 118 | 3300025935 | Ga0207709_10165525 | Ga0207709_101655252 | 211 |
| 119 | 3300035691 | Ga0373931_0074879 | Ga0373931_0074879_766_1407 | 211 |
| 120 | 3300047472 | Ga0495686_0193008 | Ga0495686_0193008_133_777 | 211 |
| 121 | 3300048903 | Ga0496100_0245051 | Ga0496100_0245051_536_1177 | 211 |
| 122 | 3300048915 | Ga0496112_0357712 | Ga0496112_0357712_273_914 | 211 |
| 123 | 3300050489 | nmdc:mga03683_77799_c1 | nmdc:mga03683_77799_c1_515_1156 | 211 |
| 124 | 3300050492 | nmdc:mga0yw44_258695_c1 | nmdc:mga0yw44_258695_c1_482_1123 | 211 |
| 125 | 3300005539 | Ga0068853_100401989 | Ga0068853_1004019892 | 212 |
| 126 | 3300005616 | Ga0068852_100153141 | Ga0068852_1001531412 | 212 |
| 127 | 3300006844 | Ga0075428_100302906 | Ga0075428_1003029061 | 212 |
| 128 | 3300009094 | Ga0111539_10036387 | Ga0111539_100363877 | 212 |
| 129 | 3300021384 | Ga0213876_10133759 | Ga0213876_101337592 | 212 |
| 130 | 3300025253 | Ga0209677_101275 | Ga0209677_1012758 | 212 |
| 131 | 3300025254 | Ga0209148_1015720 | Ga0209148_10157201 | 212 |
| 132 | 3300025272 | Ga0209455_1009129 | Ga0209455_10091292 | 212 |
| 133 | 3300025272 | Ga0209455_1009671 | Ga0209455_10096712 | 212 |
| 134 | 3300027907 | Ga0207428_10094569 | Ga0207428_100945692 | 212 |
| 135 | 3300039450 | Ga0436363_1080701 | Ga0436363_1080701_621_1268 | 212 |
| 136 | 3300044693 | Ga0466961_0113366 | Ga0466961_0113366_1032_1682 | 212 |
| 137 | 3300048920 | Ga0496117_0214590 | Ga0496117_0214590_316_963 | 212 |
| 138 | 3300048921 | Ga0496118_0079494 | Ga0496118_0079494_1478_2125 | 212 |
| 139 | 3300048922 | Ga0496119_0051250 | Ga0496119_0051250_189_836 | 212 |
| 140 | 3300048924 | Ga0496121_0072836 | Ga0496121_0072836_784_1431 | 212 |
| 141 | 3300050511 | nmdc:mga08y16_266387_c1 | nmdc:mga08y16_266387_c1_866_1510 | 212 |
| 142 | 3300003215 | JGI25153J46596_10000404 | JGI25153J46596_1000040411 | 213 |
| 143 | 3300003215 | JGI25153J46596_10000444 | JGI25153J46596_1000044425 | 213 |
| 144 | 3300003215 | JGI25153J46596_10000505 | JGI25153J46596_1000050512 | 213 |
| 145 | 3300003215 | JGI25153J46596_10005197 | JGI25153J46596_100051973 | 213 |
| 146 | 3300003323 | rootH1_10083050 | rootH1_100830503 | 213 |
| 147 | 3300003762 | Ga0055542_1008135 | Ga0055542_10081353 | 213 |
| 148 | 3300003771 | Ga0055526_1028009 | Ga0055526_10280092 | 213 |
| 149 | 3300003794 | Ga0055531_10001806 | Ga0055531_100018065 | 213 |
| 150 | 3300005262 | Ga0065165_1003972 | Ga0065165_100397211 | 213 |
| 151 | 3300005327 | Ga0070658_10027598 | Ga0070658_100275982 | 213 |
| 152 | 3300005337 | Ga0070682_100466921 | Ga0070682_1004669212 | 213 |
| 153 | 3300005344 | Ga0070661_100093021 | Ga0070661_1000930214 | 213 |
| 154 | 3300005345 | Ga0070692_10423429 | Ga0070692_104234292 | 213 |
| 155 | 3300005347 | Ga0070668_100805828 | Ga0070668_1008058282 | 213 |
| 156 | 3300005455 | Ga0070663_100040772 | Ga0070663_1000407725 | 213 |
| 157 | 3300005564 | Ga0070664_100238796 | Ga0070664_1002387963 | 213 |
| 158 | 3300005578 | Ga0068854_100658007 | Ga0068854_1006580071 | 213 |
| 159 | 3300005614 | Ga0068856_100076363 | Ga0068856_1000763631 | 213 |
| 160 | 3300005616 | Ga0068852_100005260 | Ga0068852_1000052602 | 213 |
| 161 | 3300005616 | Ga0068852_100714017 | Ga0068852_1007140172 | 213 |
| 162 | 3300005834 | Ga0068851_10163649 | Ga0068851_101636492 | 213 |
| 163 | 3300005842 | Ga0068858_100034060 | Ga0068858_1000340601 | 213 |
| 164 | 3300005937 | Ga0081455_10018489 | Ga0081455_100184893 | 213 |
| 165 | 3300005983 | Ga0081540_1000186 | Ga0081540_100018699 | 213 |
| 166 | 3300006038 | Ga0075365_10037551 | Ga0075365_100375512 | 213 |
| 167 | 3300006048 | Ga0075363_100065398 | Ga0075363_1000653982 | 213 |
| 168 | 3300006195 | Ga0075366_10031430 | Ga0075366_100314305 | 213 |
| 169 | 3300009093 | Ga0105240_10001648 | Ga0105240_100016489 | 213 |
| 170 | 3300009101 | Ga0105247_10055493 | Ga0105247_100554932 | 213 |
| 171 | 3300009174 | Ga0105241_10053627 | Ga0105241_100536273 | 213 |
| 172 | 3300009545 | Ga0105237_10001549 | Ga0105237_100015498 | 213 |
| 173 | 3300009551 | Ga0105238_10168876 | Ga0105238_101688762 | 213 |
| 174 | 3300010375 | Ga0105239_10232711 | Ga0105239_102327113 | 213 |
| 175 | 3300010375 | Ga0105239_10377867 | Ga0105239_103778672 | 213 |
| 176 | 3300010375 | Ga0105239_11525136 | Ga0105239_115251362 | 213 |
| 177 | 3300013105 | Ga0157369_10725821 | Ga0157369_107258211 | 213 |
| 178 | 3300014325 | Ga0163163_10456518 | Ga0163163_104565182 | 213 |
| 179 | 3300014325 | Ga0163163_11646402 | Ga0163163_116464021 | 213 |
| 180 | 3300025230 | Ga0209563_100932 | Ga0209563_1009327 | 213 |
| 181 | 3300025253 | Ga0209677_101180 | Ga0209677_1011807 | 213 |
| 182 | 3300025253 | Ga0209677_103268 | Ga0209677_1032682 | 213 |
| 183 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018078 | 213 |
| 184 | 3300025261 | Ga0209233_1002031 | Ga0209233_10020316 | 213 |
| 185 | 3300025272 | Ga0209455_1001087 | Ga0209455_100108711 | 213 |
| 186 | 3300025273 | Ga0209673_1030996 | Ga0209673_10309962 | 213 |
| 187 | 3300025295 | Ga0209564_1014288 | Ga0209564_10142885 | 213 |
| 188 | 3300025295 | Ga0209564_1032677 | Ga0209564_10326773 | 213 |
| 189 | 3300025297 | Ga0209758_1000015 | Ga0209758_1000015637 | 213 |
| 190 | 3300025297 | Ga0209758_1000161 | Ga0209758_100016129 | 213 |
| 191 | 3300025297 | Ga0209758_1000673 | Ga0209758_100067338 | 213 |
| 192 | 3300025297 | Ga0209758_1003001 | Ga0209758_10030019 | 213 |
| 193 | 3300025299 | Ga0209256_1002321 | Ga0209256_10023218 | 213 |
| 194 | 3300025302 | Ga0207426_1007683 | Ga0207426_10076836 | 213 |
| 195 | 3300025302 | Ga0207426_1082470 | Ga0207426_10824701 | 213 |
| 196 | 3300025304 | Ga0209257_1000762 | Ga0209257_100076240 | 213 |
| 197 | 3300025321 | Ga0207656_10225937 | Ga0207656_102259372 | 213 |
| 198 | 3300025906 | Ga0207699_10577818 | Ga0207699_105778182 | 213 |
| 199 | 3300025911 | Ga0207654_10027508 | Ga0207654_100275081 | 213 |
| 200 | 3300025914 | Ga0207671_10011529 | Ga0207671_100115292 | 213 |
| 201 | 3300025919 | Ga0207657_10104894 | Ga0207657_101048943 | 213 |
| 202 | 3300025920 | Ga0207649_10013845 | Ga0207649_100138454 | 213 |
| 203 | 3300025931 | Ga0207644_10327623 | Ga0207644_103276232 | 213 |
| 204 | 3300025972 | Ga0207668_10297999 | Ga0207668_102979991 | 213 |
| 205 | 3300025981 | Ga0207640_10612334 | Ga0207640_106123342 | 213 |
| 206 | 3300026067 | Ga0207678_10026149 | Ga0207678_100261496 | 213 |
| 207 | 3300026078 | Ga0207702_10352945 | Ga0207702_103529452 | 213 |
| 208 | 3300026078 | Ga0207702_10687147 | Ga0207702_106871472 | 213 |
| 209 | 3300028563 | Ga0265319_1005142 | Ga0265319_10051424 | 213 |
| 210 | 3300028573 | Ga0265334_10011710 | Ga0265334_100117104 | 213 |
| 211 | 3300028577 | Ga0265318_10045596 | Ga0265318_100455962 | 213 |
| 212 | 3300028653 | Ga0265323_10001015 | Ga0265323_100010157 | 213 |
| 213 | 3300028654 | Ga0265322_10026935 | Ga0265322_100269353 | 213 |
| 214 | 3300028666 | Ga0265336_10001751 | Ga0265336_100017515 | 213 |
| 215 | 3300028800 | Ga0265338_10000034 | Ga0265338_10000034156 | 213 |
| 216 | 3300029957 | Ga0265324_10002947 | Ga0265324_100029476 | 213 |
| 217 | 3300031249 | Ga0265339_10024353 | Ga0265339_100243534 | 213 |
| 218 | 3300031711 | Ga0265314_10069956 | Ga0265314_100699564 | 213 |
| 219 | 3300031712 | Ga0265342_10006582 | Ga0265342_100065822 | 213 |
| 220 | 3300035086 | Ga0373934_0003275 | Ga0373934_0003275_2127_2777 | 213 |
| 221 | 3300035086 | Ga0373934_0016681 | Ga0373934_0016681_1370_2017 | 213 |
| 222 | 3300035111 | Ga0373923_0000031 | Ga0373923_0000031_8108_8758 | 213 |
| 223 | 3300035117 | Ga0373953_0000141 | Ga0373953_0000141_9220_9870 | 213 |
| 224 | 3300035118 | Ga0373954_0000134 | Ga0373954_0000134_15654_16304 | 213 |
| 225 | 3300035119 | Ga0373956_0000450 | Ga0373956_0000450_661_1311 | 213 |
| 226 | 3300035120 | Ga0373957_0100715 | Ga0373957_0100715_415_1065 | 213 |
| 227 | 3300035172 | Ga0373955_0006249 | Ga0373955_0006249_2602_3252 | 213 |
| 228 | 3300035172 | Ga0373955_0012207 | Ga0373955_0012207_1329_1976 | 213 |
| 229 | 3300035410 | Ga0373924_0011555 | Ga0373924_0011555_813_1460 | 213 |
| 230 | 3300035410 | Ga0373924_0045451 | Ga0373924_0045451_487_1137 | 213 |
| 231 | 3300035695 | Ga0373927_0010088 | Ga0373927_0010088_2921_3568 | 213 |
| 232 | 3300035724 | Ga0373933_0000355 | Ga0373933_0000355_13054_13704 | 213 |
| 233 | 3300036401 | Ga0373937_0006901 | Ga0373937_0006901_5098_5748 | 213 |
| 234 | 3300036401 | Ga0373937_0027559 | Ga0373937_0027559_1633_2280 | 213 |
| 235 | 3300039438 | Ga0436360_0074838 | Ga0436360_0074838_616_1260 | 213 |
| 236 | 3300044842 | Ga0466957_0192625 | Ga0466957_0192625_177_827 | 213 |
| 237 | 3300046454 | Ga0495592_0000336 | Ga0495592_0000336_21278_21928 | 213 |
| 238 | 3300046459 | Ga0495629_0000373 | Ga0495629_0000373_29190_29843 | 213 |
| 239 | 3300046459 | Ga0495629_0000648 | Ga0495629_0000648_18518_19168 | 213 |
| 240 | 3300046459 | Ga0495629_0184915 | Ga0495629_0184915_36_683 | 213 |
| 241 | 3300046459 | Ga0495629_0380090 | Ga0495629_0380090_226_873 | 213 |
| 242 | 3300046462 | Ga0495651_0006679 | Ga0495651_0006679_5393_6043 | 213 |
| 243 | 3300046462 | Ga0495651_0027820 | Ga0495651_0027820_2980_3633 | 213 |
| 244 | 3300046463 | Ga0495653_0000280 | Ga0495653_0000280_23246_23896 | 213 |
| 245 | 3300046472 | Ga0495580_0182778 | Ga0495580_0182778_746_1393 | 213 |
| 246 | 3300046477 | Ga0495664_0111252 | Ga0495664_0111252_106_753 | 213 |
| 247 | 3300046477 | Ga0495664_0116256 | Ga0495664_0116256_630_1283 | 213 |
| 248 | 3300046507 | Ga0495606_0044898 | Ga0495606_0044898_1013_1660 | 213 |
| 249 | 3300046511 | Ga0495608_0000429 | Ga0495608_0000429_15586_16236 | 213 |
| 250 | 3300046514 | Ga0495618_0082661 | Ga0495618_0082661_965_1618 | 213 |
| 251 | 3300046514 | Ga0495618_0100595 | Ga0495618_0100595_94_741 | 213 |
| 252 | 3300046516 | Ga0495628_0071316 | Ga0495628_0071316_1785_2432 | 213 |
| 253 | 3300046529 | Ga0495652_0005440 | Ga0495652_0005440_9247_9897 | 213 |
| 254 | 3300046529 | Ga0495652_0074144 | Ga0495652_0074144_2086_2733 | 213 |
| 255 | 3300046529 | Ga0495652_0408575 | Ga0495652_0408575_125_772 | 213 |
| 256 | 3300046533 | Ga0495640_0009490 | Ga0495640_0009490_691_1344 | 213 |
| 257 | 3300046533 | Ga0495640_0094133 | Ga0495640_0094133_312_962 | 213 |
| 258 | 3300046533 | Ga0495640_0366947 | Ga0495640_0366947_81_728 | 213 |
| 259 | 3300046536 | Ga0495587_0000330 | Ga0495587_0000330_17365_18015 | 213 |
| 260 | 3300046543 | Ga0495645_0012065 | Ga0495645_0012065_1660_2310 | 213 |
| 261 | 3300046543 | Ga0495645_0092894 | Ga0495645_0092894_650_1297 | 213 |
| 262 | 3300046559 | Ga0495667_0000519 | Ga0495667_0000519_17237_17887 | 213 |
| 263 | 3300046642 | Ga0495634_0033248 | Ga0495634_0033248_891_1544 | 213 |
| 264 | 3300046663 | Ga0495635_0000473 | Ga0495635_0000473_15566_16216 | 213 |
| 265 | 3300046663 | Ga0495635_0022057 | Ga0495635_0022057_774_1427 | 213 |
| 266 | 3300046675 | Ga0495657_0001309 | Ga0495657_0001309_15654_16304 | 213 |
| 267 | 3300046675 | Ga0495657_0159463 | Ga0495657_0159463_518_1171 | 213 |
| 268 | 3300046675 | Ga0495657_0267818 | Ga0495657_0267818_149_796 | 213 |
| 269 | 3300046678 | Ga0495599_0000663 | Ga0495599_0000663_6705_7355 | 213 |
| 270 | 3300046679 | Ga0495623_0015002 | Ga0495623_0015002_773_1423 | 213 |
| 271 | 3300046680 | Ga0495646_0002908 | Ga0495646_0002908_4893_5543 | 213 |
| 272 | 3300046680 | Ga0495646_0110228 | Ga0495646_0110228_610_1257 | 213 |
| 273 | 3300046689 | Ga0495613_0027832 | Ga0495613_0027832_2406_3056 | 213 |
| 274 | 3300046689 | Ga0495613_0032521 | Ga0495613_0032521_3086_3739 | 213 |
| 275 | 3300046809 | Ga0495600_0000322 | Ga0495600_0000322_7082_7732 | 213 |
| 276 | 3300046809 | Ga0495600_0021115 | Ga0495600_0021115_2620_3273 | 213 |
| 277 | 3300047317 | Ga0495604_0001349 | Ga0495604_0001349_16641_17291 | 213 |
| 278 | 3300047317 | Ga0495604_0038817 | Ga0495604_0038817_2231_2884 | 213 |
| 279 | 3300047319 | Ga0495674_0022946 | Ga0495674_0022946_3993_4640 | 213 |
| 280 | 3300047319 | Ga0495674_0110806 | Ga0495674_0110806_279_929 | 213 |
| 281 | 3300047321 | Ga0495676_0175014 | Ga0495676_0175014_461_1114 | 213 |
| 282 | 3300047322 | Ga0495680_0001452 | Ga0495680_0001452_15654_16304 | 213 |
| 283 | 3300047444 | Ga0495675_0025145 | Ga0495675_0025145_371_1021 | 213 |
| 284 | 3300047471 | Ga0495684_0001954 | Ga0495684_0001954_9198_9848 | 213 |
| 285 | 3300047471 | Ga0495684_0045548 | Ga0495684_0045548_182_832 | 213 |
| 286 | 3300047673 | Ga0495593_0000385 | Ga0495593_0000385_11532_12182 | 213 |
| 287 | 3300047673 | Ga0495593_0031993 | Ga0495593_0031993_1986_2633 | 213 |
| 288 | 3300048088 | Ga0495602_0003529 | Ga0495602_0003529_13164_13814 | 213 |
| 289 | 3300048088 | Ga0495602_0096762 | Ga0495602_0096762_1736_2389 | 213 |
| 290 | 3300048907 | Ga0496104_0024828 | Ga0496104_0024828_1706_2359 | 213 |
| 291 | 3300048908 | Ga0496105_0001072 | Ga0496105_0001072_15411_16064 | 213 |
| 292 | 3300048915 | Ga0496112_0354580 | Ga0496112_0354580_736_1386 | 213 |
| 293 | 3300048916 | Ga0496113_0257008 | Ga0496113_0257008_301_954 | 213 |
| 294 | 3300048916 | Ga0496113_0518230 | Ga0496113_0518230_217_867 | 213 |
| 295 | 3300048917 | Ga0496114_0033665 | Ga0496114_0033665_2697_3350 | 213 |
| 296 | 3300048921 | Ga0496118_0076900 | Ga0496118_0076900_958_1611 | 213 |
| 297 | 3300048923 | Ga0496120_0002979 | Ga0496120_0002979_7569_8222 | 213 |
| 298 | 3300048924 | Ga0496121_0037280 | Ga0496121_0037280_3037_3690 | 213 |
| 299 | 3300048924 | Ga0496121_0054217 | Ga0496121_0054217_1513_2163 | 213 |
| 300 | 3300048927 | Ga0496124_0018782 | Ga0496124_0018782_1920_2573 | 213 |
| 301 | 3300048927 | Ga0496124_0023911 | Ga0496124_0023911_4288_4938 | 213 |
| 302 | 3300048928 | Ga0496125_0031553 | Ga0496125_0031553_128_781 | 213 |
| 303 | 3300048928 | Ga0496125_0033936 | Ga0496125_0033936_264_914 | 213 |
| 304 | 3300048929 | Ga0496126_0008292 | Ga0496126_0008292_10005_10658 | 213 |
| 305 | 3300048929 | Ga0496126_0145246 | Ga0496126_0145246_124_777 | 213 |
| 306 | 3300049460 | Ga0495682_0138707 | Ga0495682_0138707_80_733 | 213 |
| 307 | 3300050490 | nmdc:mga03n38_99881_c1 | nmdc:mga03n38_99881_c1_565_1218 | 213 |
| 308 | 3300050492 | nmdc:mga0yw44_141686_c1 | nmdc:mga0yw44_141686_c1_744_1391 | 213 |
| 309 | 3300050493 | nmdc:mga0k408_31449_c1 | nmdc:mga0k408_31449_c1_1101_1742 | 213 |
| 310 | 3300050496 | nmdc:mga07m45_384670_c1 | nmdc:mga07m45_384670_c1_48_689 | 213 |
| 311 | 3300053077 | Ga0495601_0004856 | Ga0495601_0004856_3470_4120 | 213 |
| 312 | 3300053077 | Ga0495601_0060621 | Ga0495601_0060621_725_1372 | 213 |
| 313 | 3300053084 | Ga0495595_0000230 | Ga0495595_0000230_5986_6636 | 213 |
| 314 | 3300053085 | Ga0495619_0000407 | Ga0495619_0000407_15592_16242 | 213 |
| 315 | 3300053111 | Ga0500572_001315 | Ga0500572_001315_5219_5869 | 213 |
| 316 | 3300053119 | Ga0500595_007590 | Ga0500595_007590_1976_2629 | 213 |
| 317 | 3300053136 | Ga0500559_0003990 | Ga0500559_0003990_1216_1866 | 213 |
| 318 | 3300053136 | Ga0500559_0099982 | Ga0500559_0099982_509_1162 | 213 |
| 319 | 3300053162 | Ga0500638_067926 | Ga0500638_067926_812_1465 | 213 |
| 320 | 3300053735 | Ga0500596_002396 | Ga0500596_002396_2187_2837 | 213 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cjx-assembly1.cif.gz_A | crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution | 0.8492 | 111 | 202 |
| 2ilm-assembly1.cif.gz_A-2 | factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer | 0.848 | 126 | 192 |
| 5jwp-assembly1.cif.gz_A | crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide. | 0.8445 | 126 | 192 |
| 5op6-assembly1.cif.gz_A | factor inhibiting hif (fih) in complex with zinc and gsk128863 | 0.841 | 126 | 195 |
| 2q1z-assembly2.cif.gz_D | crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr | 0.8379 | 2 | 196 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z2sH02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9144 | 103 | 193 | 2.60.120.10 |
| 2z2sH02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8641 | 103 | 193 | 2.60.120.10 |
| af_Q7K4H4_195_438_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8611 | 125 | 194 | 2.60.120.650 |
| af_A0A0R0L0M3_22_151_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8502 | 124 | 192 | 2.60.120.10 |
| 5cadA02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8499 | 125 | 201 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V2RUN3-F1-model_v4 | Cupin domain-containing protein | 0.9289 | 105 | 194 |
|
| AF-A0A2D9NML3-F1-model_v4 | Transcriptional regulator | 0.9224 | 104 | 213 |
|
| AF-A0A3B9BV46-F1-model_v4 | Transcriptional regulator | 0.9158 | 104 | 213 |
|
| AF-A0A0E2ZX98-F1-model_v4 | deleted | 0.9076 | 104 | 200 |
|
| AF-A0A858Q960-F1-model_v4 | Cupin domain-containing protein | 0.9043 | 104 | 202 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar