F405589

General Info

Members Datasets Scaffolds Average Seq Length
320 235 278 211

Family's Representative Sequence

Representative Sequence 3300031249|Ga0265339_10024353|Ga0265339_100243534
Length 219
Sequence MTVTHHPPENLLAGFASGLLEEAEHLVVGVHVAGCPGCRRFLHAIEQLAGTAIEEAAPVPMSEDAFDLVMAHVREMPPTGAPRPAPVRTVWPAPGRQDLPELLRRYRLGKRRRVAPGVSVQPIELSGSGKARAFLLQSAPGTRMLEHTHSGTELTCVLEGSFSHDAGRYGPGDFDYGDDDIDHRPVVGDEGPCLCLVAMTGDLRMNGFLGRLISPFVRL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
4 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
5 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
6 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
7 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
8 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
9 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
10 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
11 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
12 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
13 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
14 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
15 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
16 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
17 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
18 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
19 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
20 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
21 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
22 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
23 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
24 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
25 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
26 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
27 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
28 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
29 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
30 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
31 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
32 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
33 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
34 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
35 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
81 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
82 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
83 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
218 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
219 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
220 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
221 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
224 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
225 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
229 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
230 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
233 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
234 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
235 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.88
Metatranscriptomes 0
Isolates 13.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.69
Nodule 7.5
Rhizoplane 4.06
Rhizosphere 55
Stem 0
Stem Tuber 0
Unclassified 13.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000404 3300003215 Bacteria 28752
2 JGI25153J46596_10000444 3300003215 Bacteria 26578
3 JGI25153J46596_10000505 3300003215 Bacteria 24803
4 JGI25153J46596_10005197 3300003215 Bacteria 6851
5 rootH1_10083050 3300003323 Bacteria 2215
6 Ga0055542_1008135 3300003762 Bacteria 2070
7 Ga0055526_1028009 3300003771 Bacteria 1718
8 Ga0055531_10001806 3300003794 Bacteria 15188
9 Ga0065165_1003972 3300005262 Bacteria 9688
10 Ga0070658_10027598 3300005327 Bacteria 4554
11 Ga0070690_100308339 3300005330 Bacteria 1137
12 Ga0070682_100466921 3300005337 Bacteria 970
13 Ga0070661_100093021 3300005344 Bacteria 2234
14 Ga0070692_10423429 3300005345 Bacteria 846
15 Ga0070668_100805828 3300005347 Unclassified 835
16 Ga0070663_100040772 3300005455 Bacteria 3252
17 Ga0070685_10302776 3300005466 Bacteria 1078
18 Ga0068853_100401989 3300005539 Bacteria 1282
19 Ga0070664_100238796 3300005564 Bacteria 1631
20 Ga0068854_100658007 3300005578 Bacteria 900
21 Ga0068856_100076363 3300005614 Bacteria 3319
22 Ga0068852_100005260 3300005616 Bacteria 9237
23 Ga0068852_100153141 3300005616 Bacteria 2146
24 Ga0068852_100714017 3300005616 Bacteria 1013
25 Ga0068851_10163649 3300005834 Bacteria 1224
26 Ga0068858_100034060 3300005842 Bacteria 4725
27 Ga0081455_10018489 3300005937 Bacteria 6636
28 Ga0081540_1000186 3300005983 Bacteria 64680
29 Ga0075365_10037551 3300006038 Bacteria 3145
30 Ga0075365_10090213 3300006038 Bacteria 2087
31 Ga0075363_100065398 3300006048 Bacteria 1966
32 Ga0075362_10168740 3300006177 Bacteria 1056
33 Ga0075367_10175647 3300006178 Bacteria 1335
34 Ga0075366_10031430 3300006195 Bacteria 3124
35 Ga0075366_10165660 3300006195 Bacteria 1340
36 Ga0068871_100670805 3300006358 Unclassified 948
37 Ga0075428_100302906 3300006844 Bacteria 1718
38 Ga0075435_100453924 3300007076 Bacteria 1105
39 Ga0105240_10001648 3300009093 Bacteria 37903
40 Ga0105240_12185250 3300009093 Bacteria 574
41 Ga0111539_10036387 3300009094 Bacteria 5952
42 Ga0105247_10055493 3300009101 Bacteria 2445
43 Ga0105243_10092404 3300009148 Bacteria 2495
44 Ga0105241_10041842 3300009174 Bacteria 3463
45 Ga0105241_10053627 3300009174 Bacteria 3084
46 Ga0105237_10001549 3300009545 Bacteria 30005
47 Ga0105237_10061035 3300009545 Bacteria 3770
48 Ga0105238_10168876 3300009551 Bacteria 2164
49 Ga0105239_10082271 3300010375 Bacteria 3545
50 Ga0105239_10097570 3300010375 Bacteria 3248
51 Ga0105239_10232711 3300010375 Bacteria 2067
52 Ga0105239_10377867 3300010375 Bacteria 1602
53 Ga0105239_11525136 3300010375 Bacteria 772
54 Ga0157369_10725821 3300013105 Bacteria 1023
55 Ga0163162_10761146 3300013306 Unclassified 1087
56 Ga0163163_10456518 3300014325 Bacteria 1338
57 Ga0163163_11646402 3300014325 Bacteria 703
58 Ga0157380_10743014 3300014326 Bacteria 991
59 Ga0157376_10747114 3300014969 Bacteria 987
60 Ga0214544_1000007 3300021320 Bacteria 379989
61 Ga0214542_1000007 3300021321 Bacteria 291816
62 Ga0214545_1000006 3300021324 Bacteria 291693
63 Ga0214543_1000009 3300021327 Bacteria 384302
64 Ga0213873_10002065 3300021358 Bacteria 3436
65 Ga0213876_10059834 3300021384 Bacteria 2010
66 Ga0213876_10133759 3300021384 Bacteria 1319
67 Ga0213871_10001555 3300021441 Bacteria 3891
68 Ga0209563_100932 3300025230 Bacteria 8632
69 Ga0209677_101180 3300025253 Bacteria 11980
70 Ga0209677_101275 3300025253 Bacteria 11294
71 Ga0209677_103268 3300025253 Bacteria 5380
72 Ga0209148_1000180 3300025254 Bacteria 124830
73 Ga0209148_1015720 3300025254 Bacteria 1316
74 Ga0209233_1002031 3300025261 Bacteria 7661
75 Ga0209455_1001087 3300025272 Bacteria 13381
76 Ga0209455_1009129 3300025272 Bacteria 2629
77 Ga0209455_1009671 3300025272 Bacteria 2512
78 Ga0209673_1030996 3300025273 Bacteria 1672
79 Ga0209564_1014288 3300025295 Bacteria 3313
80 Ga0209564_1032677 3300025295 Bacteria 1562
81 Ga0209758_1000015 3300025297 Bacteria 851943
82 Ga0209758_1000161 3300025297 Bacteria 154278
83 Ga0209758_1000673 3300025297 Bacteria 51032
84 Ga0209758_1003001 3300025297 Bacteria 16160
85 Ga0209758_1017700 3300025297 Bacteria 3530
86 Ga0209256_1002321 3300025299 Bacteria 15930
87 Ga0207426_1007683 3300025302 Bacteria 4479
88 Ga0207426_1082470 3300025302 Bacteria 869
89 Ga0209257_1000762 3300025304 Bacteria 48195
90 Ga0207656_10225937 3300025321 Bacteria 911
91 Ga0207699_10577818 3300025906 Bacteria 817
92 Ga0207654_10027508 3300025911 Bacteria 3091
93 Ga0207695_10000008 3300025913 Bacteria 1058268
94 Ga0207671_10011529 3300025914 Bacteria 7183
95 Ga0207657_10104894 3300025919 Bacteria 2341
96 Ga0207649_10013845 3300025920 Bacteria 4510
97 Ga0207644_10327623 3300025931 Bacteria 1240
98 Ga0207709_10165525 3300025935 Bacteria 1546
99 Ga0207669_10129310 3300025937 Bacteria 1732
100 Ga0207668_10297999 3300025972 Bacteria 1330
101 Ga0207640_10612334 3300025981 Bacteria 923
102 Ga0207678_10026149 3300026067 Bacteria 5092
103 Ga0207702_10352945 3300026078 Bacteria 1408
104 Ga0207702_10687147 3300026078 Bacteria 1008
105 Ga0207428_10094569 3300027907 Bacteria 2316
106 Ga0268266_10609616 3300028379 Bacteria 1049
107 Ga0265319_1005142 3300028563 Bacteria 6332
108 Ga0265334_10011710 3300028573 Bacteria 3687
109 Ga0265318_10045596 3300028577 Bacteria 1657
110 Ga0265323_10001015 3300028653 Bacteria 14625
111 Ga0265322_10026935 3300028654 Bacteria 1643
112 Ga0265336_10001751 3300028666 Bacteria 9520
113 Ga0265338_10000034 3300028800 Bacteria 244623
114 Ga0265324_10002947 3300029957 Bacteria 8335
115 Ga0265339_10024353 3300031249 Bacteria 3488
116 Ga0265314_10069956 3300031711 Bacteria 2353
117 Ga0265342_10006582 3300031712 Bacteria 8640
118 Ga0373934_0003275 3300035086 Bacteria 5926
119 Ga0373934_0016681 3300035086 Bacteria 2794
120 Ga0373923_0000031 3300035111 Bacteria 21086
121 Ga0373953_0000141 3300035117 Bacteria 18151
122 Ga0373954_0000134 3300035118 Bacteria 25551
123 Ga0373954_0068703 3300035118 Unclassified 1681
124 Ga0373956_0000450 3300035119 Bacteria 16809
125 Ga0373957_0100715 3300035120 Bacteria 1156
126 Ga0373955_0006249 3300035172 Bacteria 5418
127 Ga0373955_0012207 3300035172 Bacteria 4124
128 Ga0373924_0011555 3300035410 Bacteria 3282
129 Ga0373924_0045451 3300035410 Bacteria 1806
130 Ga0373931_0074879 3300035691 Bacteria 1855
131 Ga0373927_0010088 3300035695 Bacteria 6322
132 Ga0373927_0015030 3300035695 Bacteria 5119
133 Ga0373933_0000355 3300035724 Bacteria 29357
134 Ga0373933_0363533 3300035724 Bacteria 941
135 Ga0373937_0006901 3300036401 Bacteria 9800
136 Ga0373937_0027559 3300036401 Bacteria 5138
137 Ga0395899_0060232 3300037312 Bacteria 2797
138 Ga0395900_0001627 3300037418 Bacteria 26397
139 Ga0395898_0002504 3300037466 Bacteria 21600
140 Ga0395905_0175198 3300037471 Bacteria 2014
141 Ga0395901_0047905 3300038443 Bacteria 4438
142 Ga0436365_1284928 3300039437 Bacteria 4419
143 Ga0436365_1498211 3300039437 Bacteria 1483
144 Ga0436360_0074838 3300039438 Bacteria 1977
145 Ga0436360_0134404 3300039438 Bacteria 2963
146 Ga0436363_1080701 3300039450 Bacteria 1378
147 Ga0436362_0753495 3300039453 Bacteria 3283
148 Ga0451853_4079112 3300041512 Bacteria 592
149 Ga0466969_0020261 3300044656 Bacteria 3446
150 Ga0466966_0001143 3300044684 Bacteria 17046
151 Ga0466961_0000018 3300044693 Bacteria 109837
152 Ga0466961_0113366 3300044693 Bacteria 1705
153 Ga0466957_0192625 3300044842 Bacteria 1336
154 Ga0466959_0008322 3300045049 Bacteria 7326
155 Ga0495592_0000336 3300046454 Bacteria 38837
156 Ga0495592_0118034 3300046454 Bacteria 1870
157 Ga0495629_0000373 3300046459 Bacteria 37733
158 Ga0495629_0000648 3300046459 Bacteria 28117
159 Ga0495629_0184915 3300046459 Bacteria 1443
160 Ga0495629_0380090 3300046459 Bacteria 961
161 Ga0495651_0006679 3300046462 Bacteria 8819
162 Ga0495651_0027820 3300046462 Bacteria 4406
163 Ga0495653_0000280 3300046463 Bacteria 41492
164 Ga0495580_0182778 3300046472 Bacteria 1448
165 Ga0495664_0111252 3300046477 Bacteria 1653
166 Ga0495664_0116256 3300046477 Bacteria 1617
167 Ga0495606_0044898 3300046507 Bacteria 2935
168 Ga0495608_0000429 3300046511 Bacteria 29273
169 Ga0495618_0082661 3300046514 Bacteria 2051
170 Ga0495618_0100595 3300046514 Bacteria 1850
171 Ga0495628_0071316 3300046516 Bacteria 2708
172 Ga0495630_0033410 3300046517 Bacteria 3837
173 Ga0495652_0005440 3300046529 Bacteria 11999
174 Ga0495652_0074144 3300046529 Bacteria 2831
175 Ga0495652_0408575 3300046529 Bacteria 959
176 Ga0495652_0715980 3300046529 Bacteria 672
177 Ga0495640_0009490 3300046533 Bacteria 7579
178 Ga0495640_0094133 3300046533 Bacteria 1973
179 Ga0495640_0366947 3300046533 Bacteria 887
180 Ga0495587_0000330 3300046536 Bacteria 33854
181 Ga0495645_0012065 3300046543 Bacteria 6089
182 Ga0495645_0092894 3300046543 Bacteria 2154
183 Ga0495645_0188370 3300046543 Bacteria 1408
184 Ga0495667_0000519 3300046559 Bacteria 24591
185 Ga0495634_0033248 3300046642 Bacteria 3544
186 Ga0495635_0000473 3300046663 Bacteria 25458
187 Ga0495635_0022057 3300046663 Bacteria 4437
188 Ga0495657_0001309 3300046675 Bacteria 21677
189 Ga0495657_0159463 3300046675 Bacteria 1396
190 Ga0495657_0267818 3300046675 Bacteria 1025
191 Ga0495599_0000663 3300046678 Bacteria 19472
192 Ga0495623_0015002 3300046679 Bacteria 5008
193 Ga0495646_0002908 3300046680 Bacteria 10615
194 Ga0495646_0110228 3300046680 Bacteria 1568
195 Ga0495613_0027832 3300046689 Bacteria 4207
196 Ga0495613_0032521 3300046689 Bacteria 3876
197 Ga0495600_0000322 3300046809 Bacteria 25358
198 Ga0495600_0021115 3300046809 Bacteria 4168
199 Ga0495581_0210460 3300047315 Unclassified 1137
200 Ga0495604_0001349 3300047317 Bacteria 20067
201 Ga0495604_0038817 3300047317 Bacteria 3746
202 Ga0495674_0018451 3300047319 Bacteria 6492
203 Ga0495674_0022946 3300047319 Bacteria 5749
204 Ga0495674_0110806 3300047319 Bacteria 2327
205 Ga0495676_0175014 3300047321 Bacteria 1508
206 Ga0495680_0001452 3300047322 Bacteria 25551
207 Ga0495675_0025145 3300047444 Bacteria 3797
208 Ga0495684_0001954 3300047471 Bacteria 16552
209 Ga0495684_0045548 3300047471 Bacteria 3357
210 Ga0495686_0193008 3300047472 Bacteria 1173
211 Ga0495593_0000385 3300047673 Bacteria 24478
212 Ga0495593_0031993 3300047673 Bacteria 2870
213 Ga0495602_0003529 3300048088 Bacteria 16161
214 Ga0495602_0096762 3300048088 Bacteria 2434
215 Ga0496100_0245051 3300048903 Unclassified 1324
216 Ga0496104_0023990 3300048907 Bacteria 5612
217 Ga0496104_0024828 3300048907 Bacteria 5518
218 Ga0496105_0001072 3300048908 Bacteria 18938
219 Ga0496107_0764204 3300048910 Bacteria 709
220 Ga0496110_0310232 3300048913 Bacteria 1437
221 Ga0496110_1249449 3300048913 Bacteria 652
222 Ga0496112_0074923 3300048915 Bacteria 3347
223 Ga0496112_0354580 3300048915 Bacteria 1409
224 Ga0496112_0357712 3300048915 Bacteria 1402
225 Ga0496113_0257008 3300048916 Bacteria 1395
226 Ga0496113_0518230 3300048916 Unclassified 957
227 Ga0496114_0033665 3300048917 Bacteria 4224
228 Ga0496117_0214590 3300048920 Bacteria 1076
229 Ga0496118_0076900 3300048921 Bacteria 2370
230 Ga0496118_0079494 3300048921 Bacteria 2314
231 Ga0496119_0051250 3300048922 Bacteria 2538
232 Ga0496120_0002979 3300048923 Bacteria 16113
233 Ga0496121_0037280 3300048924 Bacteria 4321
234 Ga0496121_0054217 3300048924 Bacteria 3353
235 Ga0496121_0072836 3300048924 Bacteria 2756
236 Ga0496124_0018782 3300048927 Bacteria 6460
237 Ga0496124_0023911 3300048927 Bacteria 5565
238 Ga0496125_0031553 3300048928 Bacteria 4721
239 Ga0496125_0033936 3300048928 Bacteria 4506
240 Ga0496126_0008292 3300048929 Bacteria 11222
241 Ga0496126_0047701 3300048929 Bacteria 3921
242 Ga0496126_0145246 3300048929 Bacteria 2038
243 Ga0495682_0138707 3300049460 Bacteria 869
244 Ga0501041_0089355 3300049577 Bacteria 1902
245 Ga0501042_0376256 3300049578 Bacteria 1028
246 Ga0501080_0223190 3300049742 Bacteria 1724
247 nmdc:mga03683_77799_c1 3300050489 Unclassified 1427
248 nmdc:mga03n38_99881_c1 3300050490 Unclassified 1398
249 nmdc:mga0yw44_141686_c1 3300050492 Bacteria 1563
250 nmdc:mga0yw44_258695_c1 3300050492 Bacteria 1160
251 nmdc:mga0k408_31449_c1 3300050493 Bacteria 2580
252 nmdc:mga07m45_384670_c1 3300050496 Bacteria 815
253 nmdc:mga08y16_266387_c1 3300050511 Bacteria 1769
254 nmdc:mga0n895_453578_c1 3300050512 Unclassified 1294
255 nmdc:mga0sz30_415707_c1 3300050516 Bacteria 603
256 Ga0495601_0004856 3300053077 Bacteria 7799
257 Ga0495601_0060621 3300053077 Bacteria 2401
258 Ga0495595_0000230 3300053084 Bacteria 22172
259 Ga0495619_0000407 3300053085 Bacteria 29279
260 Ga0500647_0108417 3300053091 Bacteria 1322
261 Ga0500566_0095233 3300053094 Bacteria 1640
262 Ga0500566_0363603 3300053094 Bacteria 659
263 Ga0500640_006818 3300053095 Bacteria 4397
264 Ga0500557_000164 3300053105 Bacteria 14527
265 Ga0500572_001315 3300053111 Bacteria 6925
266 Ga0500595_007590 3300053119 Bacteria 4492
267 Ga0500607_070280 3300053121 Bacteria 1809
268 Ga0500608_016364 3300053122 Bacteria 3349
269 Ga0500614_005470 3300053123 Bacteria 2666
270 Ga0500642_0000088 3300053130 Bacteria 47518
271 Ga0500559_0003990 3300053136 Bacteria 7093
272 Ga0500559_0099982 3300053136 Bacteria 1335
273 Ga0500564_006556 3300053138 Bacteria 4861
274 Ga0500619_041801 3300053154 Bacteria 1451
275 Ga0500638_019549 3300053162 Bacteria 3176
276 Ga0500638_067926 3300053162 Bacteria 1707
277 Ga0500636_0001863 3300053177 Bacteria 11553
278 Ga0500596_002396 3300053735 Bacteria 3695

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0715980 Ga0495652_0715980_92_655 169
2 3300009093 Ga0105240_12185250 Ga0105240_121852501 172
3 3300035118 Ga0373954_0068703 Ga0373954_0068703_26_550 172
4 3300041512 Ga0451853_4079112 Ga0451853_4079112_20_547 172
5 3300048913 Ga0496110_1249449 Ga0496110_1249449_19_543 172
6 3300050516 nmdc:mga0sz30_415707_c1 nmdc:mga0sz30_415707_c1_50_574 172
7 3300053094 Ga0500566_0363603 Ga0500566_0363603_31_555 172
8 3300048929 Ga0496126_0047701 Ga0496126_0047701_2437_3087 181
9 3300021320 Ga0214544_1000007 Ga0214544_1000007274 182
10 3300021321 Ga0214542_1000007 Ga0214542_1000007107 182
11 3300021324 Ga0214545_1000006 Ga0214545_1000006186 182
12 3300021327 Ga0214543_1000009 Ga0214543_1000009274 182
13 3300044656 Ga0466969_0020261 Ga0466969_0020261_1975_2622 188
14 3300044684 Ga0466966_0001143 Ga0466966_0001143_3388_4035 188
15 3300044693 Ga0466961_0000018 Ga0466961_0000018_15666_16313 188
16 3300045049 Ga0466959_0008322 Ga0466959_0008322_3209_3856 188
17 3300037312 Ga0395899_0060232 Ga0395899_0060232_1492_2139 196
18 3300037418 Ga0395900_0001627 Ga0395900_0001627_4382_5029 196
19 3300037466 Ga0395898_0002504 Ga0395898_0002504_3134_3781 196
20 3300037471 Ga0395905_0175198 Ga0395905_0175198_828_1475 196
21 3300038443 Ga0395901_0047905 Ga0395901_0047905_326_973 196
22 3300035695 Ga0373927_0015030 Ga0373927_0015030_2010_2660 198
23 3300035724 Ga0373933_0363533 Ga0373933_0363533_262_912 198
24 3300046454 Ga0495592_0118034 Ga0495592_0118034_87_737 198
25 3300046517 Ga0495630_0033410 Ga0495630_0033410_1777_2427 198
26 3300046543 Ga0495645_0188370 Ga0495645_0188370_348_998 198
27 3300047319 Ga0495674_0018451 Ga0495674_0018451_2464_3114 198
28 3300006178 Ga0075367_10175647 Ga0075367_101756471 199
29 3300006195 Ga0075366_10165660 Ga0075366_101656602 200
30 3300021384 Ga0213876_10059834 Ga0213876_100598341 200
31 3300039437 Ga0436365_1284928 Ga0436365_1284928_1522_2169 200
32 3300014969 Ga0157376_10747114 Ga0157376_107471142 202
33 3300047315 Ga0495581_0210460 Ga0495581_0210460_500_1117 202
34 3300048913 Ga0496110_0310232 Ga0496110_0310232_504_1151 202
35 3300053094 Ga0500566_0095233 Ga0500566_0095233_328_975 202
36 3300053095 Ga0500640_006818 Ga0500640_006818_1407_2054 202
37 3300053121 Ga0500607_070280 Ga0500607_070280_238_885 202
38 3300053122 Ga0500608_016364 Ga0500608_016364_2441_3088 202
39 3300053123 Ga0500614_005470 Ga0500614_005470_285_932 202
40 3300053138 Ga0500564_006556 Ga0500564_006556_2970_3617 202
41 3300053154 Ga0500619_041801 Ga0500619_041801_89_736 202
42 3300053162 Ga0500638_019549 Ga0500638_019549_1448_2095 202
43 3300053177 Ga0500636_0001863 Ga0500636_0001863_8477_9124 202
44 3300021358 Ga0213873_10002065 Ga0213873_100020653 203
45 3300021441 Ga0213871_10001555 Ga0213871_100015553 203
46 3300025913 Ga0207695_10000008 Ga0207695_10000008769 203
47 3300039438 Ga0436360_0134404 Ga0436360_0134404_1387_2034 203
48 3300039453 Ga0436362_0753495 Ga0436362_0753495_1127_1774 203
49 3300053091 Ga0500647_0108417 Ga0500647_0108417_62_712 203
50 3300053105 Ga0500557_000164 Ga0500557_000164_12933_13583 203
51 3300053130 Ga0500642_0000088 Ga0500642_0000088_32722_33372 203
52 iso_pu_bacteria 2844315083 2844315668 206
53 iso_pu_bacteria 2903727486 2903732638 206
54 iso_pu_bacteria 2906602504 2906605406 206
55 iso_pu_bacteria 3005718088 3005720138 206
56 3300009174 Ga0105241_10041842 Ga0105241_100418423 208
57 3300010375 Ga0105239_10097570 Ga0105239_100975703 208
58 iso_pu_bacteria 8006926726 8006926774 208
59 3300014326 Ga0157380_10743014 Ga0157380_107430141 209
60 iso_pu_bacteria 2507262055 2507504553 209
61 iso_pu_bacteria 2508501009 2508545976 209
62 iso_pu_bacteria 2791355196 2793063607 209
63 iso_pu_bacteria 2824600985 2824606387 209
64 iso_pu_bacteria 2824609381 2824616205 209
65 iso_pu_bacteria 2824617872 2824619504 209
66 iso_pu_bacteria 2824626560 2824627959 209
67 iso_pu_bacteria 2824635225 2824635997 209
68 iso_pu_bacteria 2824644064 2824646251 209
69 iso_pu_bacteria 2824653114 2824658503 209
70 iso_pu_bacteria 2824714736 2824720557 209
71 iso_pu_bacteria 2824723954 2824727561 209
72 iso_pu_bacteria 2824746037 2824747633 209
73 iso_pu_bacteria 2842038055 2842044210 209
74 iso_pu_bacteria 2842045827 2842051801 209
75 iso_pu_bacteria 2844315083 2844319987 209
76 iso_pu_bacteria 2849076700 2849082361 209
77 iso_pu_bacteria 2881364244 2881369769 209
78 iso_pu_bacteria 2888388044 2888392825 209
79 iso_pu_bacteria 2888419890 2888427122 209
80 iso_pu_bacteria 2903727486 2903730338 209
81 iso_pu_bacteria 2906602504 2906604727 209
82 iso_pu_bacteria 2908775508 2908782861 209
83 iso_pu_bacteria 2935608549 2935614296 209
84 iso_pu_bacteria 2935819856 2935826514 209
85 iso_pu_bacteria 2935847175 2935851192 209
86 iso_pu_bacteria 2935908558 2935913241 209
87 iso_pu_bacteria 2935916978 2935922663 209
88 iso_pu_bacteria 2935926038 2935930834 209
89 iso_pu_bacteria 2935934488 2935939832 209
90 iso_pu_bacteria 2935942939 2935946781 209
91 iso_pu_bacteria 2935951376 2935956018 209
92 iso_pu_bacteria 2935967501 2935972811 209
93 iso_pu_bacteria 3005506211 3005510739 209
94 iso_pu_bacteria 3005718088 3005723130 209
95 iso_pu_bacteria 8019687851 8019693351 209
96 iso_pu_bacteria 8056967851 8056975104 209
97 3300005330 Ga0070690_100308339 Ga0070690_1003083392 210
98 3300006358 Ga0068871_100670805 Ga0068871_1006708051 210
99 3300007076 Ga0075435_100453924 Ga0075435_1004539241 210
100 3300009545 Ga0105237_10061035 Ga0105237_100610352 210
101 3300010375 Ga0105239_10082271 Ga0105239_100822715 210
102 3300013306 Ga0163162_10761146 Ga0163162_107611462 210
103 3300025297 Ga0209758_1017700 Ga0209758_10177003 210
104 3300025937 Ga0207669_10129310 Ga0207669_101293102 210
105 3300028379 Ga0268266_10609616 Ga0268266_106096162 210
106 3300039437 Ga0436365_1498211 Ga0436365_1498211_215_853 210
107 3300048907 Ga0496104_0023990 Ga0496104_0023990_4433_5071 210
108 3300048910 Ga0496107_0764204 Ga0496107_0764204_35_673 210
109 3300048915 Ga0496112_0074923 Ga0496112_0074923_653_1291 210
110 3300049577 Ga0501041_0089355 Ga0501041_0089355_737_1375 210
111 3300049578 Ga0501042_0376256 Ga0501042_0376256_202_840 210
112 3300049742 Ga0501080_0223190 Ga0501080_0223190_562_1200 210
113 3300050512 nmdc:mga0n895_453578_c1 nmdc:mga0n895_453578_c1_289_927 210
114 3300005466 Ga0070685_10302776 Ga0070685_103027761 211
115 3300006038 Ga0075365_10090213 Ga0075365_100902132 211
116 3300006177 Ga0075362_10168740 Ga0075362_101687402 211
117 3300009148 Ga0105243_10092404 Ga0105243_100924042 211
118 3300025935 Ga0207709_10165525 Ga0207709_101655252 211
119 3300035691 Ga0373931_0074879 Ga0373931_0074879_766_1407 211
120 3300047472 Ga0495686_0193008 Ga0495686_0193008_133_777 211
121 3300048903 Ga0496100_0245051 Ga0496100_0245051_536_1177 211
122 3300048915 Ga0496112_0357712 Ga0496112_0357712_273_914 211
123 3300050489 nmdc:mga03683_77799_c1 nmdc:mga03683_77799_c1_515_1156 211
124 3300050492 nmdc:mga0yw44_258695_c1 nmdc:mga0yw44_258695_c1_482_1123 211
125 3300005539 Ga0068853_100401989 Ga0068853_1004019892 212
126 3300005616 Ga0068852_100153141 Ga0068852_1001531412 212
127 3300006844 Ga0075428_100302906 Ga0075428_1003029061 212
128 3300009094 Ga0111539_10036387 Ga0111539_100363877 212
129 3300021384 Ga0213876_10133759 Ga0213876_101337592 212
130 3300025253 Ga0209677_101275 Ga0209677_1012758 212
131 3300025254 Ga0209148_1015720 Ga0209148_10157201 212
132 3300025272 Ga0209455_1009129 Ga0209455_10091292 212
133 3300025272 Ga0209455_1009671 Ga0209455_10096712 212
134 3300027907 Ga0207428_10094569 Ga0207428_100945692 212
135 3300039450 Ga0436363_1080701 Ga0436363_1080701_621_1268 212
136 3300044693 Ga0466961_0113366 Ga0466961_0113366_1032_1682 212
137 3300048920 Ga0496117_0214590 Ga0496117_0214590_316_963 212
138 3300048921 Ga0496118_0079494 Ga0496118_0079494_1478_2125 212
139 3300048922 Ga0496119_0051250 Ga0496119_0051250_189_836 212
140 3300048924 Ga0496121_0072836 Ga0496121_0072836_784_1431 212
141 3300050511 nmdc:mga08y16_266387_c1 nmdc:mga08y16_266387_c1_866_1510 212
142 3300003215 JGI25153J46596_10000404 JGI25153J46596_1000040411 213
143 3300003215 JGI25153J46596_10000444 JGI25153J46596_1000044425 213
144 3300003215 JGI25153J46596_10000505 JGI25153J46596_1000050512 213
145 3300003215 JGI25153J46596_10005197 JGI25153J46596_100051973 213
146 3300003323 rootH1_10083050 rootH1_100830503 213
147 3300003762 Ga0055542_1008135 Ga0055542_10081353 213
148 3300003771 Ga0055526_1028009 Ga0055526_10280092 213
149 3300003794 Ga0055531_10001806 Ga0055531_100018065 213
150 3300005262 Ga0065165_1003972 Ga0065165_100397211 213
151 3300005327 Ga0070658_10027598 Ga0070658_100275982 213
152 3300005337 Ga0070682_100466921 Ga0070682_1004669212 213
153 3300005344 Ga0070661_100093021 Ga0070661_1000930214 213
154 3300005345 Ga0070692_10423429 Ga0070692_104234292 213
155 3300005347 Ga0070668_100805828 Ga0070668_1008058282 213
156 3300005455 Ga0070663_100040772 Ga0070663_1000407725 213
157 3300005564 Ga0070664_100238796 Ga0070664_1002387963 213
158 3300005578 Ga0068854_100658007 Ga0068854_1006580071 213
159 3300005614 Ga0068856_100076363 Ga0068856_1000763631 213
160 3300005616 Ga0068852_100005260 Ga0068852_1000052602 213
161 3300005616 Ga0068852_100714017 Ga0068852_1007140172 213
162 3300005834 Ga0068851_10163649 Ga0068851_101636492 213
163 3300005842 Ga0068858_100034060 Ga0068858_1000340601 213
164 3300005937 Ga0081455_10018489 Ga0081455_100184893 213
165 3300005983 Ga0081540_1000186 Ga0081540_100018699 213
166 3300006038 Ga0075365_10037551 Ga0075365_100375512 213
167 3300006048 Ga0075363_100065398 Ga0075363_1000653982 213
168 3300006195 Ga0075366_10031430 Ga0075366_100314305 213
169 3300009093 Ga0105240_10001648 Ga0105240_100016489 213
170 3300009101 Ga0105247_10055493 Ga0105247_100554932 213
171 3300009174 Ga0105241_10053627 Ga0105241_100536273 213
172 3300009545 Ga0105237_10001549 Ga0105237_100015498 213
173 3300009551 Ga0105238_10168876 Ga0105238_101688762 213
174 3300010375 Ga0105239_10232711 Ga0105239_102327113 213
175 3300010375 Ga0105239_10377867 Ga0105239_103778672 213
176 3300010375 Ga0105239_11525136 Ga0105239_115251362 213
177 3300013105 Ga0157369_10725821 Ga0157369_107258211 213
178 3300014325 Ga0163163_10456518 Ga0163163_104565182 213
179 3300014325 Ga0163163_11646402 Ga0163163_116464021 213
180 3300025230 Ga0209563_100932 Ga0209563_1009327 213
181 3300025253 Ga0209677_101180 Ga0209677_1011807 213
182 3300025253 Ga0209677_103268 Ga0209677_1032682 213
183 3300025254 Ga0209148_1000180 Ga0209148_100018078 213
184 3300025261 Ga0209233_1002031 Ga0209233_10020316 213
185 3300025272 Ga0209455_1001087 Ga0209455_100108711 213
186 3300025273 Ga0209673_1030996 Ga0209673_10309962 213
187 3300025295 Ga0209564_1014288 Ga0209564_10142885 213
188 3300025295 Ga0209564_1032677 Ga0209564_10326773 213
189 3300025297 Ga0209758_1000015 Ga0209758_1000015637 213
190 3300025297 Ga0209758_1000161 Ga0209758_100016129 213
191 3300025297 Ga0209758_1000673 Ga0209758_100067338 213
192 3300025297 Ga0209758_1003001 Ga0209758_10030019 213
193 3300025299 Ga0209256_1002321 Ga0209256_10023218 213
194 3300025302 Ga0207426_1007683 Ga0207426_10076836 213
195 3300025302 Ga0207426_1082470 Ga0207426_10824701 213
196 3300025304 Ga0209257_1000762 Ga0209257_100076240 213
197 3300025321 Ga0207656_10225937 Ga0207656_102259372 213
198 3300025906 Ga0207699_10577818 Ga0207699_105778182 213
199 3300025911 Ga0207654_10027508 Ga0207654_100275081 213
200 3300025914 Ga0207671_10011529 Ga0207671_100115292 213
201 3300025919 Ga0207657_10104894 Ga0207657_101048943 213
202 3300025920 Ga0207649_10013845 Ga0207649_100138454 213
203 3300025931 Ga0207644_10327623 Ga0207644_103276232 213
204 3300025972 Ga0207668_10297999 Ga0207668_102979991 213
205 3300025981 Ga0207640_10612334 Ga0207640_106123342 213
206 3300026067 Ga0207678_10026149 Ga0207678_100261496 213
207 3300026078 Ga0207702_10352945 Ga0207702_103529452 213
208 3300026078 Ga0207702_10687147 Ga0207702_106871472 213
209 3300028563 Ga0265319_1005142 Ga0265319_10051424 213
210 3300028573 Ga0265334_10011710 Ga0265334_100117104 213
211 3300028577 Ga0265318_10045596 Ga0265318_100455962 213
212 3300028653 Ga0265323_10001015 Ga0265323_100010157 213
213 3300028654 Ga0265322_10026935 Ga0265322_100269353 213
214 3300028666 Ga0265336_10001751 Ga0265336_100017515 213
215 3300028800 Ga0265338_10000034 Ga0265338_10000034156 213
216 3300029957 Ga0265324_10002947 Ga0265324_100029476 213
217 3300031249 Ga0265339_10024353 Ga0265339_100243534 213
218 3300031711 Ga0265314_10069956 Ga0265314_100699564 213
219 3300031712 Ga0265342_10006582 Ga0265342_100065822 213
220 3300035086 Ga0373934_0003275 Ga0373934_0003275_2127_2777 213
221 3300035086 Ga0373934_0016681 Ga0373934_0016681_1370_2017 213
222 3300035111 Ga0373923_0000031 Ga0373923_0000031_8108_8758 213
223 3300035117 Ga0373953_0000141 Ga0373953_0000141_9220_9870 213
224 3300035118 Ga0373954_0000134 Ga0373954_0000134_15654_16304 213
225 3300035119 Ga0373956_0000450 Ga0373956_0000450_661_1311 213
226 3300035120 Ga0373957_0100715 Ga0373957_0100715_415_1065 213
227 3300035172 Ga0373955_0006249 Ga0373955_0006249_2602_3252 213
228 3300035172 Ga0373955_0012207 Ga0373955_0012207_1329_1976 213
229 3300035410 Ga0373924_0011555 Ga0373924_0011555_813_1460 213
230 3300035410 Ga0373924_0045451 Ga0373924_0045451_487_1137 213
231 3300035695 Ga0373927_0010088 Ga0373927_0010088_2921_3568 213
232 3300035724 Ga0373933_0000355 Ga0373933_0000355_13054_13704 213
233 3300036401 Ga0373937_0006901 Ga0373937_0006901_5098_5748 213
234 3300036401 Ga0373937_0027559 Ga0373937_0027559_1633_2280 213
235 3300039438 Ga0436360_0074838 Ga0436360_0074838_616_1260 213
236 3300044842 Ga0466957_0192625 Ga0466957_0192625_177_827 213
237 3300046454 Ga0495592_0000336 Ga0495592_0000336_21278_21928 213
238 3300046459 Ga0495629_0000373 Ga0495629_0000373_29190_29843 213
239 3300046459 Ga0495629_0000648 Ga0495629_0000648_18518_19168 213
240 3300046459 Ga0495629_0184915 Ga0495629_0184915_36_683 213
241 3300046459 Ga0495629_0380090 Ga0495629_0380090_226_873 213
242 3300046462 Ga0495651_0006679 Ga0495651_0006679_5393_6043 213
243 3300046462 Ga0495651_0027820 Ga0495651_0027820_2980_3633 213
244 3300046463 Ga0495653_0000280 Ga0495653_0000280_23246_23896 213
245 3300046472 Ga0495580_0182778 Ga0495580_0182778_746_1393 213
246 3300046477 Ga0495664_0111252 Ga0495664_0111252_106_753 213
247 3300046477 Ga0495664_0116256 Ga0495664_0116256_630_1283 213
248 3300046507 Ga0495606_0044898 Ga0495606_0044898_1013_1660 213
249 3300046511 Ga0495608_0000429 Ga0495608_0000429_15586_16236 213
250 3300046514 Ga0495618_0082661 Ga0495618_0082661_965_1618 213
251 3300046514 Ga0495618_0100595 Ga0495618_0100595_94_741 213
252 3300046516 Ga0495628_0071316 Ga0495628_0071316_1785_2432 213
253 3300046529 Ga0495652_0005440 Ga0495652_0005440_9247_9897 213
254 3300046529 Ga0495652_0074144 Ga0495652_0074144_2086_2733 213
255 3300046529 Ga0495652_0408575 Ga0495652_0408575_125_772 213
256 3300046533 Ga0495640_0009490 Ga0495640_0009490_691_1344 213
257 3300046533 Ga0495640_0094133 Ga0495640_0094133_312_962 213
258 3300046533 Ga0495640_0366947 Ga0495640_0366947_81_728 213
259 3300046536 Ga0495587_0000330 Ga0495587_0000330_17365_18015 213
260 3300046543 Ga0495645_0012065 Ga0495645_0012065_1660_2310 213
261 3300046543 Ga0495645_0092894 Ga0495645_0092894_650_1297 213
262 3300046559 Ga0495667_0000519 Ga0495667_0000519_17237_17887 213
263 3300046642 Ga0495634_0033248 Ga0495634_0033248_891_1544 213
264 3300046663 Ga0495635_0000473 Ga0495635_0000473_15566_16216 213
265 3300046663 Ga0495635_0022057 Ga0495635_0022057_774_1427 213
266 3300046675 Ga0495657_0001309 Ga0495657_0001309_15654_16304 213
267 3300046675 Ga0495657_0159463 Ga0495657_0159463_518_1171 213
268 3300046675 Ga0495657_0267818 Ga0495657_0267818_149_796 213
269 3300046678 Ga0495599_0000663 Ga0495599_0000663_6705_7355 213
270 3300046679 Ga0495623_0015002 Ga0495623_0015002_773_1423 213
271 3300046680 Ga0495646_0002908 Ga0495646_0002908_4893_5543 213
272 3300046680 Ga0495646_0110228 Ga0495646_0110228_610_1257 213
273 3300046689 Ga0495613_0027832 Ga0495613_0027832_2406_3056 213
274 3300046689 Ga0495613_0032521 Ga0495613_0032521_3086_3739 213
275 3300046809 Ga0495600_0000322 Ga0495600_0000322_7082_7732 213
276 3300046809 Ga0495600_0021115 Ga0495600_0021115_2620_3273 213
277 3300047317 Ga0495604_0001349 Ga0495604_0001349_16641_17291 213
278 3300047317 Ga0495604_0038817 Ga0495604_0038817_2231_2884 213
279 3300047319 Ga0495674_0022946 Ga0495674_0022946_3993_4640 213
280 3300047319 Ga0495674_0110806 Ga0495674_0110806_279_929 213
281 3300047321 Ga0495676_0175014 Ga0495676_0175014_461_1114 213
282 3300047322 Ga0495680_0001452 Ga0495680_0001452_15654_16304 213
283 3300047444 Ga0495675_0025145 Ga0495675_0025145_371_1021 213
284 3300047471 Ga0495684_0001954 Ga0495684_0001954_9198_9848 213
285 3300047471 Ga0495684_0045548 Ga0495684_0045548_182_832 213
286 3300047673 Ga0495593_0000385 Ga0495593_0000385_11532_12182 213
287 3300047673 Ga0495593_0031993 Ga0495593_0031993_1986_2633 213
288 3300048088 Ga0495602_0003529 Ga0495602_0003529_13164_13814 213
289 3300048088 Ga0495602_0096762 Ga0495602_0096762_1736_2389 213
290 3300048907 Ga0496104_0024828 Ga0496104_0024828_1706_2359 213
291 3300048908 Ga0496105_0001072 Ga0496105_0001072_15411_16064 213
292 3300048915 Ga0496112_0354580 Ga0496112_0354580_736_1386 213
293 3300048916 Ga0496113_0257008 Ga0496113_0257008_301_954 213
294 3300048916 Ga0496113_0518230 Ga0496113_0518230_217_867 213
295 3300048917 Ga0496114_0033665 Ga0496114_0033665_2697_3350 213
296 3300048921 Ga0496118_0076900 Ga0496118_0076900_958_1611 213
297 3300048923 Ga0496120_0002979 Ga0496120_0002979_7569_8222 213
298 3300048924 Ga0496121_0037280 Ga0496121_0037280_3037_3690 213
299 3300048924 Ga0496121_0054217 Ga0496121_0054217_1513_2163 213
300 3300048927 Ga0496124_0018782 Ga0496124_0018782_1920_2573 213
301 3300048927 Ga0496124_0023911 Ga0496124_0023911_4288_4938 213
302 3300048928 Ga0496125_0031553 Ga0496125_0031553_128_781 213
303 3300048928 Ga0496125_0033936 Ga0496125_0033936_264_914 213
304 3300048929 Ga0496126_0008292 Ga0496126_0008292_10005_10658 213
305 3300048929 Ga0496126_0145246 Ga0496126_0145246_124_777 213
306 3300049460 Ga0495682_0138707 Ga0495682_0138707_80_733 213
307 3300050490 nmdc:mga03n38_99881_c1 nmdc:mga03n38_99881_c1_565_1218 213
308 3300050492 nmdc:mga0yw44_141686_c1 nmdc:mga0yw44_141686_c1_744_1391 213
309 3300050493 nmdc:mga0k408_31449_c1 nmdc:mga0k408_31449_c1_1101_1742 213
310 3300050496 nmdc:mga07m45_384670_c1 nmdc:mga07m45_384670_c1_48_689 213
311 3300053077 Ga0495601_0004856 Ga0495601_0004856_3470_4120 213
312 3300053077 Ga0495601_0060621 Ga0495601_0060621_725_1372 213
313 3300053084 Ga0495595_0000230 Ga0495595_0000230_5986_6636 213
314 3300053085 Ga0495619_0000407 Ga0495619_0000407_15592_16242 213
315 3300053111 Ga0500572_001315 Ga0500572_001315_5219_5869 213
316 3300053119 Ga0500595_007590 Ga0500595_007590_1976_2629 213
317 3300053136 Ga0500559_0003990 Ga0500559_0003990_1216_1866 213
318 3300053136 Ga0500559_0099982 Ga0500559_0099982_509_1162 213
319 3300053162 Ga0500638_067926 Ga0500638_067926_812_1465 213
320 3300053735 Ga0500596_002396 Ga0500596_002396_2187_2837 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

110

201

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjx-assembly1.cif.gz_A crystal structure of a protein of unknown function with a cupin-like fold (reut_b4571) from ralstonia eutropha jmp134 at 2.60 a resolution 0.8492 111 202
2ilm-assembly1.cif.gz_A-2 factor inhibiting hif-1 alpha d201a mutant in complex with fe(ii), alpha-ketoglutarate and hif-1 alpha 35mer 0.848 126 192
5jwp-assembly1.cif.gz_A crystal structure of human fih d201e variant in complex with zn, alpha-ketoglutarate, and hif1 alpha peptide. 0.8445 126 192
5op6-assembly1.cif.gz_A factor inhibiting hif (fih) in complex with zinc and gsk128863 0.841 126 195
2q1z-assembly2.cif.gz_D crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.8379 2 196
ID Description Score Start End Superfamily
2z2sH02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9144 103 193 2.60.120.10
2z2sH02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8641 103 193 2.60.120.10
af_Q7K4H4_195_438_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8611 125 194 2.60.120.650
af_A0A0R0L0M3_22_151_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8502 124 192 2.60.120.10
5cadA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8499 125 201 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V2RUN3-F1-model_v4 Cupin domain-containing protein 0.9289 105 194
AF-A0A2D9NML3-F1-model_v4 Transcriptional regulator 0.9224 104 213
AF-A0A3B9BV46-F1-model_v4 Transcriptional regulator 0.9158 104 213
AF-A0A0E2ZX98-F1-model_v4 deleted 0.9076 104 200
AF-A0A858Q960-F1-model_v4 Cupin domain-containing protein 0.9043 104 202

Feature Viewer

pLDDT pTM Quality
81.94 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map