F405559
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 320 | 193 | 318 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300025911|Ga0207654_10073124|Ga0207654_100731243 |
| Length | 99 |
| Sequence | LGVLDSRSNRNYIVSMKAQIVRIGNSQGIRIPKPFLQQSGIAQEVDIEVQGNQIVLRSLRRPREGWEESFRQMASKGDDRLLDEKLLKETSWDTEEWQW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2831426010 | Nostoc sp. 106C | Isolate | Unclassified |
| 3 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 138 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 139 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 144 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 145 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 146 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 147 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 148 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 149 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 150 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 151 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 152 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 153 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 174 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 176 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 177 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 178 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 192 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.31 |
| Nodule | 0 |
| Rhizoplane | 1.56 |
| Rhizosphere | 96.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_621227 | 2162886007 | Bacteria | 987 |
| 2 | CNAas_1004248 | 3300000532 | Bacteria | 925 |
| 3 | JGI25406J46586_10011657 | 3300003203 | Unclassified | 3848 |
| 4 | JGI25406J46586_10171620 | 3300003203 | Unclassified | 632 |
| 5 | Ga0065715_10936282 | 3300005293 | Unclassified | 563 |
| 6 | Ga0065707_10009798 | 3300005295 | Bacteria | 3614 |
| 7 | Ga0065707_10121151 | 3300005295 | Bacteria | 2097 |
| 8 | Ga0070670_100272579 | 3300005331 | Bacteria | 1477 |
| 9 | Ga0070670_100424574 | 3300005331 | Bacteria | 1175 |
| 10 | Ga0068869_101261618 | 3300005334 | Bacteria | 651 |
| 11 | Ga0070680_100024706 | 3300005336 | Bacteria | 4802 |
| 12 | Ga0070680_100634102 | 3300005336 | Unclassified | 918 |
| 13 | Ga0068868_100835576 | 3300005338 | Unclassified | 833 |
| 14 | Ga0070689_100541475 | 3300005340 | Bacteria | 1002 |
| 15 | Ga0070687_100487839 | 3300005343 | Bacteria | 827 |
| 16 | Ga0070692_10654356 | 3300005345 | Bacteria | 702 |
| 17 | Ga0070668_101201426 | 3300005347 | Bacteria | 687 |
| 18 | Ga0070669_100337450 | 3300005353 | Bacteria | 1220 |
| 19 | Ga0070669_100661869 | 3300005353 | Bacteria | 879 |
| 20 | Ga0070669_100810946 | 3300005353 | Unclassified | 796 |
| 21 | Ga0070669_101633402 | 3300005353 | Unclassified | 561 |
| 22 | Ga0070675_100055082 | 3300005354 | Bacteria | 3273 |
| 23 | Ga0070671_100175764 | 3300005355 | Bacteria | 1812 |
| 24 | Ga0070671_100707451 | 3300005355 | Bacteria | 874 |
| 25 | Ga0070674_100867702 | 3300005356 | Bacteria | 784 |
| 26 | Ga0070674_101619007 | 3300005356 | Unclassified | 584 |
| 27 | Ga0070673_101528158 | 3300005364 | Bacteria | 630 |
| 28 | Ga0070673_101717361 | 3300005364 | Bacteria | 594 |
| 29 | Ga0070688_100028052 | 3300005365 | Bacteria | 3357 |
| 30 | Ga0070703_10000024 | 3300005406 | Bacteria | 74173 |
| 31 | Ga0070701_10646514 | 3300005438 | Unclassified | 705 |
| 32 | Ga0070705_100633986 | 3300005440 | Bacteria | 831 |
| 33 | Ga0070700_100459735 | 3300005441 | Bacteria | 970 |
| 34 | Ga0070700_101526915 | 3300005441 | Unclassified | 568 |
| 35 | Ga0070694_100010984 | 3300005444 | Bacteria | 5602 |
| 36 | Ga0070694_100338176 | 3300005444 | Bacteria | 1163 |
| 37 | Ga0070694_100667749 | 3300005444 | Bacteria | 843 |
| 38 | Ga0070694_101500156 | 3300005444 | Unclassified | 570 |
| 39 | Ga0070694_101500157 | 3300005444 | Unclassified | 570 |
| 40 | Ga0070708_100039183 | 3300005445 | Bacteria | 4145 |
| 41 | Ga0070708_102232059 | 3300005445 | Bacteria | 505 |
| 42 | Ga0070663_100167532 | 3300005455 | Unclassified | 1696 |
| 43 | Ga0070678_102275334 | 3300005456 | Bacteria | 514 |
| 44 | Ga0070681_10026915 | 3300005458 | Bacteria | 5782 |
| 45 | Ga0068867_101264525 | 3300005459 | Bacteria | 680 |
| 46 | Ga0070685_10397858 | 3300005466 | Bacteria | 953 |
| 47 | Ga0070685_10418708 | 3300005466 | Bacteria | 932 |
| 48 | Ga0070706_100000061 | 3300005467 | Bacteria | 130709 |
| 49 | Ga0070706_100183128 | 3300005467 | Bacteria | 1956 |
| 50 | Ga0070706_100357238 | 3300005467 | Bacteria | 1362 |
| 51 | Ga0070706_100506306 | 3300005467 | Bacteria | 1123 |
| 52 | Ga0070707_100000200 | 3300005468 | Bacteria | 60010 |
| 53 | Ga0070707_100010276 | 3300005468 | Bacteria | 8715 |
| 54 | Ga0070707_100193705 | 3300005468 | Bacteria | 1982 |
| 55 | Ga0070698_100030520 | 3300005471 | Bacteria | 5587 |
| 56 | Ga0070698_100410607 | 3300005471 | Unclassified | 1288 |
| 57 | Ga0070698_100588187 | 3300005471 | Unclassified | 1053 |
| 58 | Ga0070698_101773806 | 3300005471 | Bacteria | 570 |
| 59 | Ga0070699_100017980 | 3300005518 | Bacteria | 6072 |
| 60 | Ga0070699_100705888 | 3300005518 | Unclassified | 922 |
| 61 | Ga0070699_100723078 | 3300005518 | Bacteria | 910 |
| 62 | Ga0070699_100957362 | 3300005518 | Unclassified | 785 |
| 63 | Ga0070679_100019992 | 3300005530 | Bacteria | 6524 |
| 64 | Ga0070697_100107689 | 3300005536 | Bacteria | 2319 |
| 65 | Ga0070697_100411964 | 3300005536 | Unclassified | 1174 |
| 66 | Ga0070697_100975794 | 3300005536 | Unclassified | 753 |
| 67 | Ga0070697_101009267 | 3300005536 | Unclassified | 740 |
| 68 | Ga0070697_101870801 | 3300005536 | Unclassified | 537 |
| 69 | Ga0068853_100016529 | 3300005539 | Bacteria | 6075 |
| 70 | Ga0070695_100248218 | 3300005545 | Unclassified | 1294 |
| 71 | Ga0070695_100433056 | 3300005545 | Unclassified | 1004 |
| 72 | Ga0070695_101120997 | 3300005545 | Bacteria | 645 |
| 73 | Ga0070696_100010894 | 3300005546 | Bacteria | 6094 |
| 74 | Ga0070696_100089365 | 3300005546 | Bacteria | 2190 |
| 75 | Ga0070693_100005774 | 3300005547 | Bacteria | 5981 |
| 76 | Ga0070665_100000559 | 3300005548 | Bacteria | 51888 |
| 77 | Ga0070704_100002591 | 3300005549 | Bacteria | 10195 |
| 78 | Ga0070704_100149566 | 3300005549 | Bacteria | 1834 |
| 79 | Ga0070704_100301300 | 3300005549 | Bacteria | 1335 |
| 80 | Ga0068855_100940815 | 3300005563 | Unclassified | 911 |
| 81 | Ga0068857_100054259 | 3300005577 | Plasmid | 3556 |
| 82 | Ga0068854_100014353 | 3300005578 | Bacteria | 5220 |
| 83 | Ga0068852_100031180 | 3300005616 | Bacteria | 4396 |
| 84 | Ga0068852_100297815 | 3300005616 | Unclassified | 1560 |
| 85 | Ga0068859_100028738 | 3300005617 | Bacteria | 5574 |
| 86 | Ga0068859_100047450 | 3300005617 | Bacteria | 4315 |
| 87 | Ga0068864_100141629 | 3300005618 | Bacteria | 2169 |
| 88 | Ga0068864_101795097 | 3300005618 | Bacteria | 619 |
| 89 | Ga0068861_100151268 | 3300005719 | Bacteria | 1905 |
| 90 | Ga0068870_10259773 | 3300005840 | Bacteria | 1080 |
| 91 | Ga0068863_100090676 | 3300005841 | Bacteria | 2898 |
| 92 | Ga0068863_101777110 | 3300005841 | Unclassified | 626 |
| 93 | Ga0068862_101334272 | 3300005844 | Unclassified | 719 |
| 94 | Ga0068862_101671568 | 3300005844 | Bacteria | 645 |
| 95 | Ga0081539_10001039 | 3300005985 | Bacteria | 51034 |
| 96 | Ga0081539_10079781 | 3300005985 | Unclassified | 1723 |
| 97 | Ga0070717_11499100 | 3300006028 | Unclassified | 612 |
| 98 | Ga0070716_100237465 | 3300006173 | Bacteria | 1234 |
| 99 | Ga0075428_100083310 | 3300006844 | Bacteria | 3489 |
| 100 | Ga0075430_100192459 | 3300006846 | Bacteria | 1695 |
| 101 | Ga0075431_100165459 | 3300006847 | Bacteria | 2273 |
| 102 | Ga0075431_102110066 | 3300006847 | Unclassified | 518 |
| 103 | Ga0075434_100029405 | 3300006871 | Bacteria | 5406 |
| 104 | Ga0075434_102309375 | 3300006871 | Unclassified | 541 |
| 105 | Ga0075429_100008602 | 3300006880 | Bacteria | 8878 |
| 106 | Ga0075429_100027806 | 3300006880 | Bacteria | 4909 |
| 107 | Ga0075436_100087155 | 3300006914 | Bacteria | 2168 |
| 108 | Ga0097620_100028740 | 3300006931 | Bacteria | 5574 |
| 109 | Ga0097620_100047455 | 3300006931 | Bacteria | 4315 |
| 110 | Ga0075435_100921516 | 3300007076 | Unclassified | 762 |
| 111 | Ga0099794_10634456 | 3300007265 | Unclassified | 567 |
| 112 | Ga0105251_10318011 | 3300009011 | Bacteria | 707 |
| 113 | Ga0105240_10023456 | 3300009093 | Bacteria | 8157 |
| 114 | Ga0111539_10137433 | 3300009094 | Bacteria | 2862 |
| 115 | Ga0111539_10317361 | 3300009094 | Bacteria | 1814 |
| 116 | Ga0111539_11229901 | 3300009094 | Unclassified | 870 |
| 117 | Ga0111539_11956825 | 3300009094 | Bacteria | 680 |
| 118 | Ga0105245_10985461 | 3300009098 | Unclassified | 887 |
| 119 | Ga0114129_10047540 | 3300009147 | Bacteria | 6028 |
| 120 | Ga0114129_10070033 | 3300009147 | Unclassified | 4890 |
| 121 | Ga0114129_10102447 | 3300009147 | Bacteria | 3959 |
| 122 | Ga0114129_11236278 | 3300009147 | Bacteria | 929 |
| 123 | Ga0114129_11274874 | 3300009147 | Unclassified | 912 |
| 124 | Ga0114129_11281706 | 3300009147 | Unclassified | 909 |
| 125 | Ga0114129_11288130 | 3300009147 | Bacteria | 906 |
| 126 | Ga0114129_11997023 | 3300009147 | Unclassified | 701 |
| 127 | Ga0114129_12616554 | 3300009147 | Bacteria | 602 |
| 128 | Ga0114129_13081751 | 3300009147 | Unclassified | 545 |
| 129 | Ga0105243_10922598 | 3300009148 | Bacteria | 870 |
| 130 | Ga0105241_10014937 | 3300009174 | Bacteria | 5686 |
| 131 | Ga0105241_10136064 | 3300009174 | Bacteria | 1995 |
| 132 | Ga0105241_10824009 | 3300009174 | Bacteria | 856 |
| 133 | Ga0105237_10020219 | 3300009545 | Bacteria | 6871 |
| 134 | Ga0105249_10019152 | 3300009553 | Bacteria | 6103 |
| 135 | Ga0105249_10075049 | 3300009553 | Bacteria | 3131 |
| 136 | Ga0105249_10485841 | 3300009553 | Unclassified | 1278 |
| 137 | Ga0105239_10109441 | 3300010375 | Bacteria | 3062 |
| 138 | Ga0105246_11513272 | 3300011119 | Unclassified | 631 |
| 139 | Ga0157373_10867749 | 3300013100 | Unclassified | 668 |
| 140 | Ga0157370_10064950 | 3300013104 | Plasmid | 3453 |
| 141 | Ga0157370_10544149 | 3300013104 | Unclassified | 1064 |
| 142 | Ga0157369_10016917 | 3300013105 | Bacteria | 8195 |
| 143 | Ga0157374_10098976 | 3300013296 | Bacteria | 2793 |
| 144 | Ga0157378_10029673 | 3300013297 | Bacteria | 4830 |
| 145 | Ga0157372_10264017 | 3300013307 | Bacteria | 1999 |
| 146 | Ga0157375_12851032 | 3300013308 | Unclassified | 578 |
| 147 | Ga0163163_10140190 | 3300014325 | Bacteria | 2460 |
| 148 | Ga0157380_10074502 | 3300014326 | Bacteria | 2756 |
| 149 | Ga0157380_13279276 | 3300014326 | Bacteria | 517 |
| 150 | Ga0157377_10664110 | 3300014745 | Bacteria | 752 |
| 151 | Ga0213875_10019357 | 3300021388 | Bacteria | 3275 |
| 152 | Ga0207653_10000015 | 3300025885 | Bacteria | 150553 |
| 153 | Ga0207688_10315886 | 3300025901 | Bacteria | 958 |
| 154 | Ga0207643_10226788 | 3300025908 | Bacteria | 1145 |
| 155 | Ga0207684_10000138 | 3300025910 | Bacteria | 132416 |
| 156 | Ga0207684_10219629 | 3300025910 | Bacteria | 1640 |
| 157 | Ga0207654_10021853 | 3300025911 | Bacteria | 3408 |
| 158 | Ga0207654_10073124 | 3300025911 | Bacteria | 2042 |
| 159 | Ga0207707_10031629 | 3300025912 | Bacteria | 4631 |
| 160 | Ga0207695_10055212 | 3300025913 | Bacteria | 4141 |
| 161 | Ga0207671_10079007 | 3300025914 | Bacteria | 2465 |
| 162 | Ga0207660_10013850 | 3300025917 | Bacteria | 5293 |
| 163 | Ga0207652_10012756 | 3300025921 | Bacteria | 6793 |
| 164 | Ga0207646_10000032 | 3300025922 | Bacteria | 216397 |
| 165 | Ga0207646_10010784 | 3300025922 | Bacteria | 8890 |
| 166 | Ga0207646_10052393 | 3300025922 | Bacteria | 3651 |
| 167 | Ga0207646_10895513 | 3300025922 | Bacteria | 787 |
| 168 | Ga0207646_11759713 | 3300025922 | Unclassified | 531 |
| 169 | Ga0207681_10366745 | 3300025923 | Unclassified | 1156 |
| 170 | Ga0207681_10720874 | 3300025923 | Bacteria | 830 |
| 171 | Ga0207650_10795757 | 3300025925 | Bacteria | 801 |
| 172 | Ga0207659_11125799 | 3300025926 | Bacteria | 675 |
| 173 | Ga0207709_11104141 | 3300025935 | Unclassified | 651 |
| 174 | Ga0207709_11843860 | 3300025935 | Unclassified | 503 |
| 175 | Ga0207669_11720376 | 3300025937 | Unclassified | 536 |
| 176 | Ga0207665_10294922 | 3300025939 | Bacteria | 1210 |
| 177 | Ga0207665_10343024 | 3300025939 | Bacteria | 1126 |
| 178 | Ga0207667_10804144 | 3300025949 | Unclassified | 937 |
| 179 | Ga0207667_12228696 | 3300025949 | Unclassified | 504 |
| 180 | Ga0207651_11287774 | 3300025960 | Bacteria | 657 |
| 181 | Ga0207712_10602863 | 3300025961 | Bacteria | 950 |
| 182 | Ga0207712_11417835 | 3300025961 | Bacteria | 622 |
| 183 | Ga0207640_10082609 | 3300025981 | Archaea | 2200 |
| 184 | Ga0207677_11719630 | 3300026023 | Unclassified | 582 |
| 185 | Ga0207703_11248026 | 3300026035 | Bacteria | 715 |
| 186 | Ga0207639_10005995 | 3300026041 | Bacteria | 8245 |
| 187 | Ga0207708_10207104 | 3300026075 | Bacteria | 1567 |
| 188 | Ga0207708_10846214 | 3300026075 | Bacteria | 789 |
| 189 | Ga0207641_10180654 | 3300026088 | Bacteria | 1932 |
| 190 | Ga0207648_10735222 | 3300026089 | Bacteria | 916 |
| 191 | Ga0207676_10270411 | 3300026095 | Unclassified | 1539 |
| 192 | Ga0207676_11204670 | 3300026095 | Bacteria | 750 |
| 193 | Ga0207674_10337363 | 3300026116 | Unclassified | 1457 |
| 194 | Ga0207675_100188644 | 3300026118 | Bacteria | 1977 |
| 195 | Ga0207698_10204691 | 3300026142 | Bacteria | 1770 |
| 196 | Ga0207698_10720737 | 3300026142 | Unclassified | 994 |
| 197 | Ga0207428_10001780 | 3300027907 | Bacteria | 22062 |
| 198 | Ga0268266_10001034 | 3300028379 | Bacteria | 34999 |
| 199 | Ga0268265_10099276 | 3300028380 | Bacteria | 2347 |
| 200 | Ga0268265_10402122 | 3300028380 | Bacteria | 1266 |
| 201 | Ga0268265_12075586 | 3300028380 | Unclassified | 575 |
| 202 | Ga0265322_10160730 | 3300028654 | Bacteria | 642 |
| 203 | Ga0265327_10011023 | 3300031251 | Bacteria | 6286 |
| 204 | Ga0307408_100744353 | 3300031548 | Bacteria | 885 |
| 205 | Ga0307408_101106790 | 3300031548 | Unclassified | 735 |
| 206 | Ga0307408_101803710 | 3300031548 | Bacteria | 585 |
| 207 | Ga0316578_10748409 | 3300031728 | Bacteria | 568 |
| 208 | Ga0316578_10883284 | 3300031728 | Unclassified | 516 |
| 209 | Ga0307405_11852225 | 3300031731 | Unclassified | 537 |
| 210 | Ga0307413_11084256 | 3300031824 | Bacteria | 691 |
| 211 | Ga0307410_11468024 | 3300031852 | Bacteria | 600 |
| 212 | Ga0307410_12104868 | 3300031852 | Unclassified | 505 |
| 213 | Ga0307406_11420135 | 3300031901 | Unclassified | 609 |
| 214 | Ga0307407_10358516 | 3300031903 | Bacteria | 1035 |
| 215 | Ga0307407_10921714 | 3300031903 | Bacteria | 671 |
| 216 | Ga0307407_11580111 | 3300031903 | Unclassified | 520 |
| 217 | Ga0307412_10393204 | 3300031911 | Bacteria | 1126 |
| 218 | Ga0307416_101010017 | 3300032002 | Unclassified | 935 |
| 219 | Ga0307414_12199721 | 3300032004 | Bacteria | 515 |
| 220 | Ga0307411_10288046 | 3300032005 | Bacteria | 1311 |
| 221 | Ga0307411_12233570 | 3300032005 | Unclassified | 513 |
| 222 | Ga0307415_101661139 | 3300032126 | Bacteria | 615 |
| 223 | Ga0307415_101850873 | 3300032126 | Bacteria | 585 |
| 224 | Ga0307415_102174863 | 3300032126 | Unclassified | 543 |
| 225 | Ga0373930_0040237 | 3300034816 | Bacteria | 993 |
| 226 | Ga0316574_0503049 | 3300035398 | Bacteria | 755 |
| 227 | Ga0316582_0012727 | 3300036647 | Bacteria | 4709 |
| 228 | Ga0316582_0224256 | 3300036647 | Bacteria | 1286 |
| 229 | Ga0316584_0269661 | 3300036712 | Bacteria | 1239 |
| 230 | Ga0316584_0576309 | 3300036712 | Bacteria | 783 |
| 231 | Ga0316584_0924384 | 3300036712 | Unclassified | 586 |
| 232 | Ga0436364_0638241 | 3300037853 | Bacteria | 15574 |
| 233 | Ga0395901_0759970 | 3300038443 | Bacteria | 962 |
| 234 | Ga0400483_011465 | 3300039062 | Bacteria | 1455 |
| 235 | Ga0400489_91779 | 3300039093 | Bacteria | 113013 |
| 236 | Ga0439438_119320 | 3300041405 | Bacteria | 635 |
| 237 | Ga0451789_0123622 | 3300041443 | Bacteria | 958 |
| 238 | Ga0451797_0535369 | 3300041453 | Unclassified | 753 |
| 239 | Ga0451795_1602461 | 3300041456 | Unclassified | 515 |
| 240 | Ga0451798_0372666 | 3300041458 | Unclassified | 631 |
| 241 | Ga0439432_084354 | 3300042006 | Bacteria | 960 |
| 242 | Ga0451577_0000132 | 3300042876 | Bacteria | 167282 |
| 243 | Ga0451577_0644377 | 3300042876 | Bacteria | 961 |
| 244 | Ga0451577_1799568 | 3300042876 | Unclassified | 537 |
| 245 | Ga0466969_0396007 | 3300044656 | Bacteria | 627 |
| 246 | Ga0453683_0000100 | 3300044673 | Bacteria | 128455 |
| 247 | Ga0453683_0001345 | 3300044673 | Bacteria | 21552 |
| 248 | Ga0453683_0022560 | 3300044673 | Bacteria | 4016 |
| 249 | Ga0453683_0148534 | 3300044673 | Bacteria | 1480 |
| 250 | Ga0453683_0489303 | 3300044673 | Bacteria | 798 |
| 251 | Ga0453684_0000319 | 3300044712 | Bacteria | 203440 |
| 252 | Ga0453684_0000539 | 3300044712 | Bacteria | 143526 |
| 253 | Ga0453684_0166428 | 3300044712 | Bacteria | 2602 |
| 254 | Ga0451576_0056230 | 3300045051 | Bacteria | 4116 |
| 255 | Ga0451576_0124344 | 3300045051 | Bacteria | 2687 |
| 256 | Ga0451576_0198703 | 3300045051 | Unclassified | 2094 |
| 257 | Ga0451576_1642633 | 3300045051 | Unclassified | 666 |
| 258 | Ga0495581_0482528 | 3300047315 | Bacteria | 721 |
| 259 | Ga0496109_0001250 | 3300048912 | Bacteria | 21085 |
| 260 | Ga0501031_0433685 | 3300049568 | Unclassified | 849 |
| 261 | Ga0501033_1008457 | 3300049570 | Unclassified | 556 |
| 262 | Ga0501034_0888104 | 3300049571 | Unclassified | 780 |
| 263 | Ga0501036_1330737 | 3300049572 | Bacteria | 583 |
| 264 | Ga0501038_0473328 | 3300049574 | Bacteria | 961 |
| 265 | Ga0501039_0354123 | 3300049575 | Bacteria | 1153 |
| 266 | Ga0501039_1115754 | 3300049575 | Unclassified | 611 |
| 267 | Ga0501039_1543436 | 3300049575 | Unclassified | 510 |
| 268 | Ga0501041_0218515 | 3300049577 | Bacteria | 1196 |
| 269 | Ga0501041_0949475 | 3300049577 | Bacteria | 553 |
| 270 | Ga0501042_0060637 | 3300049578 | Bacteria | 2702 |
| 271 | Ga0501042_0230943 | 3300049578 | Bacteria | 1335 |
| 272 | Ga0501046_0295445 | 3300049580 | Unclassified | 1184 |
| 273 | Ga0501048_0674208 | 3300049582 | Bacteria | 742 |
| 274 | Ga0501048_0745908 | 3300049582 | Bacteria | 703 |
| 275 | Ga0501071_0206381 | 3300049587 | Bacteria | 1477 |
| 276 | Ga0501072_0040900 | 3300049588 | Bacteria | 3641 |
| 277 | Ga0501075_0160906 | 3300049591 | Bacteria | 1713 |
| 278 | Ga0501076_0303149 | 3300049592 | Unclassified | 1310 |
| 279 | Ga0501076_1237087 | 3300049592 | Unclassified | 614 |
| 280 | Ga0501077_0880601 | 3300049593 | Unclassified | 576 |
| 281 | Ga0501217_055092 | 3300049661 | Bacteria | 1049 |
| 282 | Ga0501235_086323 | 3300049669 | Unclassified | 754 |
| 283 | Ga0501243_108591 | 3300049675 | Bacteria | 566 |
| 284 | Ga0501247_036584 | 3300049677 | Unclassified | 689 |
| 285 | Ga0501257_113576 | 3300049686 | Bacteria | 720 |
| 286 | Ga0501079_0212504 | 3300049741 | Bacteria | 1511 |
| 287 | Ga0501080_0206413 | 3300049742 | Unclassified | 1802 |
| 288 | Ga0501080_0258537 | 3300049742 | Unclassified | 1587 |
| 289 | Ga0501081_0495684 | 3300049743 | Unclassified | 910 |
| 290 | Ga0501081_0827087 | 3300049743 | Bacteria | 697 |
| 291 | Ga0501081_0987627 | 3300049743 | Unclassified | 636 |
| 292 | Ga0501268_006284 | 3300049765 | Unclassified | 1737 |
| 293 | Ga0501044_0065006 | 3300049823 | Bacteria | 3721 |
| 294 | nmdc:mga05p37_131347_c1 | 3300050507 | Bacteria | 3073 |
| 295 | nmdc:mga05p37_1535662_c1 | 3300050507 | Bacteria | 660 |
| 296 | nmdc:mga05p37_248370_c1 | 3300050507 | Bacteria | 2135 |
| 297 | nmdc:mga05p37_33720_c1 | 3300050507 | Bacteria | 6270 |
| 298 | nmdc:mga05p37_626570_c1 | 3300050507 | Bacteria | 1209 |
| 299 | nmdc:mga05p37_987643_c1 | 3300050507 | Unclassified | 896 |
| 300 | nmdc:mga09592_31403_c1 | 3300050508 | Bacteria | 4426 |
| 301 | nmdc:mga06r32_1479136_c1 | 3300050510 | Unclassified | 620 |
| 302 | nmdc:mga06r32_24536_c1 | 3300050510 | Bacteria | 5599 |
| 303 | nmdc:mga08y16_1836070_c1 | 3300050511 | Bacteria | 558 |
| 304 | nmdc:mga0n895_278074_c1 | 3300050512 | Unclassified | 1698 |
| 305 | nmdc:mga0rr50_27542_c1 | 3300050513 | Bacteria | 3981 |
| 306 | nmdc:mga08x19_111457_c1 | 3300050514 | Bacteria | 1826 |
| 307 | nmdc:mga08x19_268596_c1 | 3300050514 | Bacteria | 1180 |
| 308 | nmdc:mga0a205_154329_c1 | 3300050515 | Bacteria | 2195 |
| 309 | nmdc:mga0a205_646022_c1 | 3300050515 | Bacteria | 909 |
| 310 | Ga0500555_050838 | 3300053103 | Unclassified | 1134 |
| 311 | Ga0501082_0466620 | 3300060353 | Unclassified | 1103 |
| 312 | Ga0501082_0583701 | 3300060353 | Bacteria | 978 |
| 313 | Ga0501082_1114669 | 3300060353 | Unclassified | 690 |
| 314 | Ga0501082_1269601 | 3300060353 | Bacteria | 643 |
| 315 | Ga0501082_1333126 | 3300060353 | Bacteria | 627 |
| 316 | Ga0530510_0018040 | 3300061734 | Bacteria | 5003 |
| 317 | Ga0530510_0083324 | 3300061734 | Unclassified | 2329 |
| 318 | Ga0530510_0177309 | 3300061734 | Unclassified | 1580 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049686 | Ga0501257_113576 | Ga0501257_113576_430_639 | 68 |
| 2 | 3300042876 | Ga0451577_0644377 | Ga0451577_0644377_309_563 | 78 |
| 3 | 3300044712 | Ga0453684_0166428 | Ga0453684_0166428_1829_2083 | 78 |
| 4 | 3300005467 | Ga0070706_100506306 | Ga0070706_1005063062 | 80 |
| 5 | 3300031548 | Ga0307408_101803710 | Ga0307408_1018037102 | 80 |
| 6 | 3300031901 | Ga0307406_11420135 | Ga0307406_114201351 | 80 |
| 7 | 3300049669 | Ga0501235_086323 | Ga0501235_086323_483_725 | 80 |
| 8 | 3300049675 | Ga0501243_108591 | Ga0501243_108591_269_514 | 80 |
| 9 | 3300005295 | Ga0065707_10121151 | Ga0065707_101211513 | 81 |
| 10 | 3300005331 | Ga0070670_100272579 | Ga0070670_1002725792 | 81 |
| 11 | 3300005331 | Ga0070670_100424574 | Ga0070670_1004245743 | 81 |
| 12 | 3300005334 | Ga0068869_101261618 | Ga0068869_1012616181 | 81 |
| 13 | 3300005336 | Ga0070680_100024706 | Ga0070680_1000247063 | 81 |
| 14 | 3300005340 | Ga0070689_100541475 | Ga0070689_1005414752 | 81 |
| 15 | 3300005343 | Ga0070687_100487839 | Ga0070687_1004878392 | 81 |
| 16 | 3300005345 | Ga0070692_10654356 | Ga0070692_106543562 | 81 |
| 17 | 3300005353 | Ga0070669_100661869 | Ga0070669_1006618692 | 81 |
| 18 | 3300005354 | Ga0070675_100055082 | Ga0070675_1000550824 | 81 |
| 19 | 3300005355 | Ga0070671_100175764 | Ga0070671_1001757643 | 81 |
| 20 | 3300005356 | Ga0070674_100867702 | Ga0070674_1008677022 | 81 |
| 21 | 3300005364 | Ga0070673_101528158 | Ga0070673_1015281582 | 81 |
| 22 | 3300005364 | Ga0070673_101717361 | Ga0070673_1017173612 | 81 |
| 23 | 3300005365 | Ga0070688_100028052 | Ga0070688_1000280522 | 81 |
| 24 | 3300005441 | Ga0070700_101526915 | Ga0070700_1015269151 | 81 |
| 25 | 3300005444 | Ga0070694_100338176 | Ga0070694_1003381762 | 81 |
| 26 | 3300005455 | Ga0070663_100167532 | Ga0070663_1001675323 | 81 |
| 27 | 3300005456 | Ga0070678_102275334 | Ga0070678_1022753341 | 81 |
| 28 | 3300005458 | Ga0070681_10026915 | Ga0070681_100269155 | 81 |
| 29 | 3300005459 | Ga0068867_101264525 | Ga0068867_1012645252 | 81 |
| 30 | 3300005466 | Ga0070685_10418708 | Ga0070685_104187082 | 81 |
| 31 | 3300005530 | Ga0070679_100019992 | Ga0070679_1000199926 | 81 |
| 32 | 3300005539 | Ga0068853_100016529 | Ga0068853_1000165298 | 81 |
| 33 | 3300005545 | Ga0070695_101120997 | Ga0070695_1011209972 | 81 |
| 34 | 3300005549 | Ga0070704_100301300 | Ga0070704_1003013002 | 81 |
| 35 | 3300005563 | Ga0068855_100940815 | Ga0068855_1009408153 | 81 |
| 36 | 3300005577 | Ga0068857_100054259 | Ga0068857_1000542592 | 81 |
| 37 | 3300005578 | Ga0068854_100014353 | Ga0068854_1000143534 | 81 |
| 38 | 3300005616 | Ga0068852_100031180 | Ga0068852_1000311803 | 81 |
| 39 | 3300005617 | Ga0068859_100047450 | Ga0068859_1000474503 | 81 |
| 40 | 3300005618 | Ga0068864_100141629 | Ga0068864_1001416293 | 81 |
| 41 | 3300005618 | Ga0068864_101795097 | Ga0068864_1017950972 | 81 |
| 42 | 3300005719 | Ga0068861_100151268 | Ga0068861_1001512682 | 81 |
| 43 | 3300005840 | Ga0068870_10259773 | Ga0068870_102597732 | 81 |
| 44 | 3300005841 | Ga0068863_100090676 | Ga0068863_1000906762 | 81 |
| 45 | 3300005844 | Ga0068862_101671568 | Ga0068862_1016715682 | 81 |
| 46 | 3300006931 | Ga0097620_100047455 | Ga0097620_1000474554 | 81 |
| 47 | 3300009011 | Ga0105251_10318011 | Ga0105251_103180112 | 81 |
| 48 | 3300009093 | Ga0105240_10023456 | Ga0105240_100234567 | 81 |
| 49 | 3300009094 | Ga0111539_11229901 | Ga0111539_112299012 | 81 |
| 50 | 3300009094 | Ga0111539_11956825 | Ga0111539_119568252 | 81 |
| 51 | 3300009147 | Ga0114129_13081751 | Ga0114129_130817511 | 81 |
| 52 | 3300009174 | Ga0105241_10014937 | Ga0105241_100149374 | 81 |
| 53 | 3300009545 | Ga0105237_10020219 | Ga0105237_100202196 | 81 |
| 54 | 3300009553 | Ga0105249_10019152 | Ga0105249_100191522 | 81 |
| 55 | 3300009553 | Ga0105249_10075049 | Ga0105249_100750494 | 81 |
| 56 | 3300009553 | Ga0105249_10485841 | Ga0105249_104858411 | 81 |
| 57 | 3300010375 | Ga0105239_10109441 | Ga0105239_101094412 | 81 |
| 58 | 3300013100 | Ga0157373_10867749 | Ga0157373_108677492 | 81 |
| 59 | 3300013104 | Ga0157370_10064950 | Ga0157370_100649502 | 81 |
| 60 | 3300013105 | Ga0157369_10016917 | Ga0157369_100169176 | 81 |
| 61 | 3300013307 | Ga0157372_10264017 | Ga0157372_102640172 | 81 |
| 62 | 3300014325 | Ga0163163_10140190 | Ga0163163_101401901 | 81 |
| 63 | 3300014326 | Ga0157380_10074502 | Ga0157380_100745025 | 81 |
| 64 | 3300014745 | Ga0157377_10664110 | Ga0157377_106641102 | 81 |
| 65 | 3300025901 | Ga0207688_10315886 | Ga0207688_103158862 | 81 |
| 66 | 3300025908 | Ga0207643_10226788 | Ga0207643_102267883 | 81 |
| 67 | 3300025911 | Ga0207654_10021853 | Ga0207654_100218532 | 81 |
| 68 | 3300025912 | Ga0207707_10031629 | Ga0207707_100316295 | 81 |
| 69 | 3300025913 | Ga0207695_10055212 | Ga0207695_100552125 | 81 |
| 70 | 3300025914 | Ga0207671_10079007 | Ga0207671_100790072 | 81 |
| 71 | 3300025917 | Ga0207660_10013850 | Ga0207660_100138505 | 81 |
| 72 | 3300025921 | Ga0207652_10012756 | Ga0207652_100127566 | 81 |
| 73 | 3300025923 | Ga0207681_10720874 | Ga0207681_107208742 | 81 |
| 74 | 3300025925 | Ga0207650_10795757 | Ga0207650_107957572 | 81 |
| 75 | 3300025926 | Ga0207659_11125799 | Ga0207659_111257992 | 81 |
| 76 | 3300025937 | Ga0207669_11720376 | Ga0207669_117203762 | 81 |
| 77 | 3300025949 | Ga0207667_10804144 | Ga0207667_108041441 | 81 |
| 78 | 3300025960 | Ga0207651_11287774 | Ga0207651_112877742 | 81 |
| 79 | 3300025961 | Ga0207712_10602863 | Ga0207712_106028632 | 81 |
| 80 | 3300025961 | Ga0207712_11417835 | Ga0207712_114178351 | 81 |
| 81 | 3300025981 | Ga0207640_10082609 | Ga0207640_100826092 | 81 |
| 82 | 3300026035 | Ga0207703_11248026 | Ga0207703_112480262 | 81 |
| 83 | 3300026041 | Ga0207639_10005995 | Ga0207639_100059957 | 81 |
| 84 | 3300026075 | Ga0207708_10846214 | Ga0207708_108462142 | 81 |
| 85 | 3300026088 | Ga0207641_10180654 | Ga0207641_101806542 | 81 |
| 86 | 3300026089 | Ga0207648_10735222 | Ga0207648_107352221 | 81 |
| 87 | 3300026095 | Ga0207676_10270411 | Ga0207676_102704114 | 81 |
| 88 | 3300026095 | Ga0207676_11204670 | Ga0207676_112046702 | 81 |
| 89 | 3300026116 | Ga0207674_10337363 | Ga0207674_103373632 | 81 |
| 90 | 3300026118 | Ga0207675_100188644 | Ga0207675_1001886442 | 81 |
| 91 | 3300026142 | Ga0207698_10204691 | Ga0207698_102046912 | 81 |
| 92 | 3300028380 | Ga0268265_10099276 | Ga0268265_100992762 | 81 |
| 93 | 3300028380 | Ga0268265_10402122 | Ga0268265_104021222 | 81 |
| 94 | 3300031548 | Ga0307408_100744353 | Ga0307408_1007443532 | 81 |
| 95 | 3300031731 | Ga0307405_11852225 | Ga0307405_118522252 | 81 |
| 96 | 3300031824 | Ga0307413_11084256 | Ga0307413_110842562 | 81 |
| 97 | 3300031852 | Ga0307410_12104868 | Ga0307410_121048682 | 81 |
| 98 | 3300031903 | Ga0307407_11580111 | Ga0307407_115801112 | 81 |
| 99 | 3300032005 | Ga0307411_10288046 | Ga0307411_102880462 | 81 |
| 100 | 3300032126 | Ga0307415_102174863 | Ga0307415_1021748631 | 81 |
| 101 | 3300041405 | Ga0439438_119320 | Ga0439438_119320_269_514 | 81 |
| 102 | 3300041456 | Ga0451795_1602461 | Ga0451795_1602461_249_494 | 81 |
| 103 | 3300042006 | Ga0439432_084354 | Ga0439432_084354_471_716 | 81 |
| 104 | 3300047315 | Ga0495581_0482528 | Ga0495581_0482528_64_330 | 81 |
| 105 | 3300049661 | Ga0501217_055092 | Ga0501217_055092_578_826 | 81 |
| 106 | 3300049677 | Ga0501247_036584 | Ga0501247_036584_61_306 | 81 |
| 107 | 3300050507 | nmdc:mga05p37_1535662_c1 | nmdc:mga05p37_1535662_c1_169_414 | 81 |
| 108 | 3300005444 | Ga0070694_100010984 | Ga0070694_1000109845 | 82 |
| 109 | 3300005468 | Ga0070707_100193705 | Ga0070707_1001937052 | 82 |
| 110 | 3300005471 | Ga0070698_100030520 | Ga0070698_1000305205 | 82 |
| 111 | 3300005536 | Ga0070697_101009267 | Ga0070697_1010092672 | 82 |
| 112 | 3300005545 | Ga0070695_100248218 | Ga0070695_1002482183 | 82 |
| 113 | 3300005546 | Ga0070696_100089365 | Ga0070696_1000893651 | 82 |
| 114 | 3300005549 | Ga0070704_100002591 | Ga0070704_1000025914 | 82 |
| 115 | 3300006847 | Ga0075431_102110066 | Ga0075431_1021100662 | 82 |
| 116 | 3300006871 | Ga0075434_100029405 | Ga0075434_1000294056 | 82 |
| 117 | 3300007265 | Ga0099794_10634456 | Ga0099794_106344561 | 82 |
| 118 | 3300025922 | Ga0207646_10010784 | Ga0207646_100107843 | 82 |
| 119 | 3300028654 | Ga0265322_10160730 | Ga0265322_101607302 | 82 |
| 120 | 3300031251 | Ga0265327_10011023 | Ga0265327_100110232 | 82 |
| 121 | 3300031548 | Ga0307408_101106790 | Ga0307408_1011067902 | 82 |
| 122 | 3300031852 | Ga0307410_11468024 | Ga0307410_114680242 | 82 |
| 123 | 3300031903 | Ga0307407_10358516 | Ga0307407_103585162 | 82 |
| 124 | 3300031903 | Ga0307407_10921714 | Ga0307407_109217142 | 82 |
| 125 | 3300031911 | Ga0307412_10393204 | Ga0307412_103932041 | 82 |
| 126 | 3300032002 | Ga0307416_101010017 | Ga0307416_1010100171 | 82 |
| 127 | 3300032005 | Ga0307411_12233570 | Ga0307411_122335701 | 82 |
| 128 | 3300032126 | Ga0307415_101661139 | Ga0307415_1016611392 | 82 |
| 129 | 3300035398 | Ga0316574_0503049 | Ga0316574_0503049_207_458 | 82 |
| 130 | 3300039062 | Ga0400483_011465 | Ga0400483_011465_1042_1302 | 82 |
| 131 | 3300044673 | Ga0453683_0489303 | Ga0453683_0489303_140_397 | 82 |
| 132 | 3300049570 | Ga0501033_1008457 | Ga0501033_1008457_13_267 | 82 |
| 133 | 3300049572 | Ga0501036_1330737 | Ga0501036_1330737_131_388 | 82 |
| 134 | 3300049574 | Ga0501038_0473328 | Ga0501038_0473328_306_563 | 82 |
| 135 | 3300049575 | Ga0501039_1543436 | Ga0501039_1543436_56_310 | 82 |
| 136 | 3300049580 | Ga0501046_0295445 | Ga0501046_0295445_421_675 | 82 |
| 137 | 3300049587 | Ga0501071_0206381 | Ga0501071_0206381_1193_1450 | 82 |
| 138 | 3300049588 | Ga0501072_0040900 | Ga0501072_0040900_3200_3457 | 82 |
| 139 | 3300049591 | Ga0501075_0160906 | Ga0501075_0160906_540_797 | 82 |
| 140 | 3300049592 | Ga0501076_0303149 | Ga0501076_0303149_345_599 | 82 |
| 141 | 3300049741 | Ga0501079_0212504 | Ga0501079_0212504_265_522 | 82 |
| 142 | 3300049742 | Ga0501080_0258537 | Ga0501080_0258537_171_428 | 82 |
| 143 | 3300049743 | Ga0501081_0495684 | Ga0501081_0495684_483_737 | 82 |
| 144 | 3300050512 | nmdc:mga0n895_278074_c1 | nmdc:mga0n895_278074_c1_828_1082 | 82 |
| 145 | 3300050513 | nmdc:mga0rr50_27542_c1 | nmdc:mga0rr50_27542_c1_667_921 | 82 |
| 146 | 3300050515 | nmdc:mga0a205_154329_c1 | nmdc:mga0a205_154329_c1_115_369 | 82 |
| 147 | 3300060353 | Ga0501082_0583701 | Ga0501082_0583701_495_752 | 82 |
| 148 | 3300060353 | Ga0501082_1114669 | Ga0501082_1114669_51_305 | 82 |
| 149 | 3300060353 | Ga0501082_1269601 | Ga0501082_1269601_293_547 | 82 |
| 150 | 3300061734 | Ga0530510_0018040 | Ga0530510_0018040_2306_2560 | 82 |
| 151 | iso_pu_bacteria | 2831426010 | 2831430225 | 82 |
| 152 | iso_pu_bacteria | 2848694841 | 2848696306 | 82 |
| 153 | 3300003203 | JGI25406J46586_10171620 | JGI25406J46586_101716201 | 83 |
| 154 | 3300005347 | Ga0070668_101201426 | Ga0070668_1012014262 | 83 |
| 155 | 3300005353 | Ga0070669_100337450 | Ga0070669_1003374502 | 83 |
| 156 | 3300005468 | Ga0070707_100010276 | Ga0070707_1000102761 | 83 |
| 157 | 3300005471 | Ga0070698_100588187 | Ga0070698_1005881871 | 83 |
| 158 | 3300005518 | Ga0070699_100705888 | Ga0070699_1007058882 | 83 |
| 159 | 3300005518 | Ga0070699_100723078 | Ga0070699_1007230781 | 83 |
| 160 | 3300005536 | Ga0070697_101870801 | Ga0070697_1018708012 | 83 |
| 161 | 3300005985 | Ga0081539_10079781 | Ga0081539_100797813 | 83 |
| 162 | 3300006028 | Ga0070717_11499100 | Ga0070717_114991002 | 83 |
| 163 | 3300006173 | Ga0070716_100237465 | Ga0070716_1002374653 | 83 |
| 164 | 3300006871 | Ga0075434_102309375 | Ga0075434_1023093752 | 83 |
| 165 | 3300007076 | Ga0075435_100921516 | Ga0075435_1009215162 | 83 |
| 166 | 3300009098 | Ga0105245_10985461 | Ga0105245_109854611 | 83 |
| 167 | 3300009147 | Ga0114129_11274874 | Ga0114129_112748742 | 83 |
| 168 | 3300009147 | Ga0114129_11288130 | Ga0114129_112881302 | 83 |
| 169 | 3300009147 | Ga0114129_12616554 | Ga0114129_126165541 | 83 |
| 170 | 3300013297 | Ga0157378_10029673 | Ga0157378_100296736 | 83 |
| 171 | 3300025922 | Ga0207646_10052393 | Ga0207646_100523932 | 83 |
| 172 | 3300025922 | Ga0207646_10895513 | Ga0207646_108955131 | 83 |
| 173 | 3300025922 | Ga0207646_11759713 | Ga0207646_117597132 | 83 |
| 174 | 3300025923 | Ga0207681_10366745 | Ga0207681_103667452 | 83 |
| 175 | 3300025939 | Ga0207665_10294922 | Ga0207665_102949221 | 83 |
| 176 | 3300025939 | Ga0207665_10343024 | Ga0207665_103430241 | 83 |
| 177 | 3300031728 | Ga0316578_10883284 | Ga0316578_108832841 | 83 |
| 178 | 3300032004 | Ga0307414_12199721 | Ga0307414_121997212 | 83 |
| 179 | 3300032126 | Ga0307415_101850873 | Ga0307415_1018508731 | 83 |
| 180 | 3300036712 | Ga0316584_0269661 | Ga0316584_0269661_240_500 | 83 |
| 181 | 3300041458 | Ga0451798_0372666 | Ga0451798_0372666_111_398 | 83 |
| 182 | 3300045051 | Ga0451576_0198703 | Ga0451576_0198703_1289_1549 | 83 |
| 183 | 3300049571 | Ga0501034_0888104 | Ga0501034_0888104_403_654 | 83 |
| 184 | 3300049577 | Ga0501041_0949475 | Ga0501041_0949475_273_536 | 83 |
| 185 | 3300049742 | Ga0501080_0206413 | Ga0501080_0206413_443_706 | 83 |
| 186 | 3300049743 | Ga0501081_0827087 | Ga0501081_0827087_57_320 | 83 |
| 187 | 3300049765 | Ga0501268_006284 | Ga0501268_006284_172_435 | 83 |
| 188 | 3300049823 | Ga0501044_0065006 | Ga0501044_0065006_1446_1712 | 83 |
| 189 | 3300050507 | nmdc:mga05p37_248370_c1 | nmdc:mga05p37_248370_c1_1071_1334 | 83 |
| 190 | 3300050507 | nmdc:mga05p37_626570_c1 | nmdc:mga05p37_626570_c1_793_1056 | 83 |
| 191 | 3300050510 | nmdc:mga06r32_1479136_c1 | nmdc:mga06r32_1479136_c1_322_573 | 83 |
| 192 | 3300060353 | Ga0501082_0466620 | Ga0501082_0466620_317_580 | 83 |
| 193 | 3300061734 | Ga0530510_0177309 | Ga0530510_0177309_853_1116 | 83 |
| 194 | 2162886007 | SwRhRL2b_contig_621227 | SwRhRL2b_0389.00004050 | 84 |
| 195 | 3300000532 | CNAas_1004248 | CNAas_10042482 | 84 |
| 196 | 3300003203 | JGI25406J46586_10011657 | JGI25406J46586_100116574 | 84 |
| 197 | 3300005293 | Ga0065715_10936282 | Ga0065715_109362822 | 84 |
| 198 | 3300005295 | Ga0065707_10009798 | Ga0065707_100097985 | 84 |
| 199 | 3300005336 | Ga0070680_100634102 | Ga0070680_1006341022 | 84 |
| 200 | 3300005338 | Ga0068868_100835576 | Ga0068868_1008355762 | 84 |
| 201 | 3300005353 | Ga0070669_100810946 | Ga0070669_1008109462 | 84 |
| 202 | 3300005353 | Ga0070669_101633402 | Ga0070669_1016334022 | 84 |
| 203 | 3300005355 | Ga0070671_100707451 | Ga0070671_1007074511 | 84 |
| 204 | 3300005356 | Ga0070674_101619007 | Ga0070674_1016190072 | 84 |
| 205 | 3300005406 | Ga0070703_10000024 | Ga0070703_1000002429 | 84 |
| 206 | 3300005438 | Ga0070701_10646514 | Ga0070701_106465141 | 84 |
| 207 | 3300005440 | Ga0070705_100633986 | Ga0070705_1006339861 | 84 |
| 208 | 3300005441 | Ga0070700_100459735 | Ga0070700_1004597352 | 84 |
| 209 | 3300005444 | Ga0070694_100667749 | Ga0070694_1006677492 | 84 |
| 210 | 3300005444 | Ga0070694_101500156 | Ga0070694_1015001561 | 84 |
| 211 | 3300005444 | Ga0070694_101500157 | Ga0070694_1015001571 | 84 |
| 212 | 3300005445 | Ga0070708_100039183 | Ga0070708_1000391831 | 84 |
| 213 | 3300005445 | Ga0070708_102232059 | Ga0070708_1022320592 | 84 |
| 214 | 3300005466 | Ga0070685_10397858 | Ga0070685_103978582 | 84 |
| 215 | 3300005467 | Ga0070706_100000061 | Ga0070706_10000006151 | 84 |
| 216 | 3300005467 | Ga0070706_100183128 | Ga0070706_1001831283 | 84 |
| 217 | 3300005467 | Ga0070706_100357238 | Ga0070706_1003572381 | 84 |
| 218 | 3300005468 | Ga0070707_100000200 | Ga0070707_10000020036 | 84 |
| 219 | 3300005471 | Ga0070698_100410607 | Ga0070698_1004106072 | 84 |
| 220 | 3300005471 | Ga0070698_101773806 | Ga0070698_1017738062 | 84 |
| 221 | 3300005518 | Ga0070699_100017980 | Ga0070699_1000179802 | 84 |
| 222 | 3300005518 | Ga0070699_100957362 | Ga0070699_1009573621 | 84 |
| 223 | 3300005536 | Ga0070697_100107689 | Ga0070697_1001076892 | 84 |
| 224 | 3300005536 | Ga0070697_100411964 | Ga0070697_1004119641 | 84 |
| 225 | 3300005536 | Ga0070697_100975794 | Ga0070697_1009757941 | 84 |
| 226 | 3300005545 | Ga0070695_100433056 | Ga0070695_1004330562 | 84 |
| 227 | 3300005546 | Ga0070696_100010894 | Ga0070696_1000108945 | 84 |
| 228 | 3300005547 | Ga0070693_100005774 | Ga0070693_1000057742 | 84 |
| 229 | 3300005548 | Ga0070665_100000559 | Ga0070665_1000005593 | 84 |
| 230 | 3300005549 | Ga0070704_100149566 | Ga0070704_1001495662 | 84 |
| 231 | 3300005616 | Ga0068852_100297815 | Ga0068852_1002978152 | 84 |
| 232 | 3300005617 | Ga0068859_100028738 | Ga0068859_1000287388 | 84 |
| 233 | 3300005841 | Ga0068863_101777110 | Ga0068863_1017771101 | 84 |
| 234 | 3300005844 | Ga0068862_101334272 | Ga0068862_1013342722 | 84 |
| 235 | 3300005985 | Ga0081539_10001039 | Ga0081539_1000103922 | 84 |
| 236 | 3300006844 | Ga0075428_100083310 | Ga0075428_1000833103 | 84 |
| 237 | 3300006846 | Ga0075430_100192459 | Ga0075430_1001924592 | 84 |
| 238 | 3300006847 | Ga0075431_100165459 | Ga0075431_1001654592 | 84 |
| 239 | 3300006880 | Ga0075429_100008602 | Ga0075429_1000086023 | 84 |
| 240 | 3300006880 | Ga0075429_100027806 | Ga0075429_1000278063 | 84 |
| 241 | 3300006914 | Ga0075436_100087155 | Ga0075436_1000871552 | 84 |
| 242 | 3300006931 | Ga0097620_100028740 | Ga0097620_1000287408 | 84 |
| 243 | 3300009094 | Ga0111539_10137433 | Ga0111539_101374334 | 84 |
| 244 | 3300009094 | Ga0111539_10317361 | Ga0111539_103173612 | 84 |
| 245 | 3300009147 | Ga0114129_10047540 | Ga0114129_100475405 | 84 |
| 246 | 3300009147 | Ga0114129_10070033 | Ga0114129_100700332 | 84 |
| 247 | 3300009147 | Ga0114129_10102447 | Ga0114129_101024473 | 84 |
| 248 | 3300009147 | Ga0114129_11236278 | Ga0114129_112362782 | 84 |
| 249 | 3300009147 | Ga0114129_11281706 | Ga0114129_112817063 | 84 |
| 250 | 3300009147 | Ga0114129_11997023 | Ga0114129_119970231 | 84 |
| 251 | 3300009148 | Ga0105243_10922598 | Ga0105243_109225982 | 84 |
| 252 | 3300009174 | Ga0105241_10136064 | Ga0105241_101360643 | 84 |
| 253 | 3300009174 | Ga0105241_10824009 | Ga0105241_108240091 | 84 |
| 254 | 3300011119 | Ga0105246_11513272 | Ga0105246_115132721 | 84 |
| 255 | 3300013104 | Ga0157370_10544149 | Ga0157370_105441492 | 84 |
| 256 | 3300013296 | Ga0157374_10098976 | Ga0157374_100989763 | 84 |
| 257 | 3300013308 | Ga0157375_12851032 | Ga0157375_128510322 | 84 |
| 258 | 3300014326 | Ga0157380_13279276 | Ga0157380_132792761 | 84 |
| 259 | 3300021388 | Ga0213875_10019357 | Ga0213875_100193573 | 84 |
| 260 | 3300025885 | Ga0207653_10000015 | Ga0207653_1000001535 | 84 |
| 261 | 3300025910 | Ga0207684_10000138 | Ga0207684_1000013850 | 84 |
| 262 | 3300025910 | Ga0207684_10219629 | Ga0207684_102196292 | 84 |
| 263 | 3300025911 | Ga0207654_10073124 | Ga0207654_100731243 | 84 |
| 264 | 3300025922 | Ga0207646_10000032 | Ga0207646_10000032188 | 84 |
| 265 | 3300025935 | Ga0207709_11104141 | Ga0207709_111041412 | 84 |
| 266 | 3300025935 | Ga0207709_11843860 | Ga0207709_118438602 | 84 |
| 267 | 3300025949 | Ga0207667_12228696 | Ga0207667_122286961 | 84 |
| 268 | 3300026023 | Ga0207677_11719630 | Ga0207677_117196302 | 84 |
| 269 | 3300026075 | Ga0207708_10207104 | Ga0207708_102071043 | 84 |
| 270 | 3300026142 | Ga0207698_10720737 | Ga0207698_107207372 | 84 |
| 271 | 3300027907 | Ga0207428_10001780 | Ga0207428_100017803 | 84 |
| 272 | 3300028379 | Ga0268266_10001034 | Ga0268266_1000103420 | 84 |
| 273 | 3300028380 | Ga0268265_12075586 | Ga0268265_120755861 | 84 |
| 274 | 3300031728 | Ga0316578_10748409 | Ga0316578_107484091 | 84 |
| 275 | 3300034816 | Ga0373930_0040237 | Ga0373930_0040237_451_708 | 84 |
| 276 | 3300036647 | Ga0316582_0012727 | Ga0316582_0012727_1154_1420 | 84 |
| 277 | 3300036647 | Ga0316582_0224256 | Ga0316582_0224256_533_787 | 84 |
| 278 | 3300036712 | Ga0316584_0576309 | Ga0316584_0576309_301_555 | 84 |
| 279 | 3300036712 | Ga0316584_0924384 | Ga0316584_0924384_110_364 | 84 |
| 280 | 3300037853 | Ga0436364_0638241 | Ga0436364_0638241_4007_4273 | 84 |
| 281 | 3300038443 | Ga0395901_0759970 | Ga0395901_0759970_320_586 | 84 |
| 282 | 3300039093 | Ga0400489_91779 | Ga0400489_91779_94349_94615 | 84 |
| 283 | 3300041443 | Ga0451789_0123622 | Ga0451789_0123622_253_510 | 84 |
| 284 | 3300041453 | Ga0451797_0535369 | Ga0451797_0535369_108_365 | 84 |
| 285 | 3300042876 | Ga0451577_0000132 | Ga0451577_0000132_149076_149330 | 84 |
| 286 | 3300042876 | Ga0451577_1799568 | Ga0451577_1799568_31_285 | 84 |
| 287 | 3300044656 | Ga0466969_0396007 | Ga0466969_0396007_188_445 | 84 |
| 288 | 3300044673 | Ga0453683_0000100 | Ga0453683_0000100_394_648 | 84 |
| 289 | 3300044673 | Ga0453683_0001345 | Ga0453683_0001345_4561_4815 | 84 |
| 290 | 3300044673 | Ga0453683_0022560 | Ga0453683_0022560_2499_2753 | 84 |
| 291 | 3300044673 | Ga0453683_0148534 | Ga0453683_0148534_379_633 | 84 |
| 292 | 3300044712 | Ga0453684_0000319 | Ga0453684_0000319_136960_137214 | 84 |
| 293 | 3300044712 | Ga0453684_0000539 | Ga0453684_0000539_28366_28620 | 84 |
| 294 | 3300045051 | Ga0451576_0056230 | Ga0451576_0056230_59_313 | 84 |
| 295 | 3300045051 | Ga0451576_0124344 | Ga0451576_0124344_1762_2016 | 84 |
| 296 | 3300045051 | Ga0451576_1642633 | Ga0451576_1642633_161_415 | 84 |
| 297 | 3300048912 | Ga0496109_0001250 | Ga0496109_0001250_13307_13561 | 84 |
| 298 | 3300049568 | Ga0501031_0433685 | Ga0501031_0433685_432_710 | 84 |
| 299 | 3300049575 | Ga0501039_0354123 | Ga0501039_0354123_432_710 | 84 |
| 300 | 3300049575 | Ga0501039_1115754 | Ga0501039_1115754_68_322 | 84 |
| 301 | 3300049577 | Ga0501041_0218515 | Ga0501041_0218515_40_294 | 84 |
| 302 | 3300049578 | Ga0501042_0060637 | Ga0501042_0060637_2092_2370 | 84 |
| 303 | 3300049578 | Ga0501042_0230943 | Ga0501042_0230943_982_1236 | 84 |
| 304 | 3300049582 | Ga0501048_0674208 | Ga0501048_0674208_306_560 | 84 |
| 305 | 3300049582 | Ga0501048_0745908 | Ga0501048_0745908_55_309 | 84 |
| 306 | 3300049592 | Ga0501076_1237087 | Ga0501076_1237087_217_471 | 84 |
| 307 | 3300049593 | Ga0501077_0880601 | Ga0501077_0880601_77_334 | 84 |
| 308 | 3300049743 | Ga0501081_0987627 | Ga0501081_0987627_118_372 | 84 |
| 309 | 3300050507 | nmdc:mga05p37_131347_c1 | nmdc:mga05p37_131347_c1_1437_1691 | 84 |
| 310 | 3300050507 | nmdc:mga05p37_33720_c1 | nmdc:mga05p37_33720_c1_798_1052 | 84 |
| 311 | 3300050507 | nmdc:mga05p37_987643_c1 | nmdc:mga05p37_987643_c1_632_886 | 84 |
| 312 | 3300050508 | nmdc:mga09592_31403_c1 | nmdc:mga09592_31403_c1_3542_3796 | 84 |
| 313 | 3300050510 | nmdc:mga06r32_24536_c1 | nmdc:mga06r32_24536_c1_3113_3367 | 84 |
| 314 | 3300050511 | nmdc:mga08y16_1836070_c1 | nmdc:mga08y16_1836070_c1_159_413 | 84 |
| 315 | 3300050514 | nmdc:mga08x19_111457_c1 | nmdc:mga08x19_111457_c1_20_274 | 84 |
| 316 | 3300050514 | nmdc:mga08x19_268596_c1 | nmdc:mga08x19_268596_c1_471_728 | 84 |
| 317 | 3300050515 | nmdc:mga0a205_646022_c1 | nmdc:mga0a205_646022_c1_431_685 | 84 |
| 318 | 3300053103 | Ga0500555_050838 | Ga0500555_050838_330_584 | 84 |
| 319 | 3300060353 | Ga0501082_1333126 | Ga0501082_1333126_315_581 | 84 |
| 320 | 3300061734 | Ga0530510_0083324 | Ga0530510_0083324_1503_1757 | 84 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar