F405559

General Info

Members Datasets Scaffolds Average Seq Length
320 193 318 84

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10073124|Ga0207654_100731243
Length 99
Sequence LGVLDSRSNRNYIVSMKAQIVRIGNSQGIRIPKPFLQQSGIAQEVDIEVQGNQIVLRSLRRPREGWEESFRQMASKGDDRLLDEKLLKETSWDTEEWQW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
145 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
146 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
147 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
148 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
149 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
150 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
177 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 1.56
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_621227 2162886007 Bacteria 987
2 CNAas_1004248 3300000532 Bacteria 925
3 JGI25406J46586_10011657 3300003203 Unclassified 3848
4 JGI25406J46586_10171620 3300003203 Unclassified 632
5 Ga0065715_10936282 3300005293 Unclassified 563
6 Ga0065707_10009798 3300005295 Bacteria 3614
7 Ga0065707_10121151 3300005295 Bacteria 2097
8 Ga0070670_100272579 3300005331 Bacteria 1477
9 Ga0070670_100424574 3300005331 Bacteria 1175
10 Ga0068869_101261618 3300005334 Bacteria 651
11 Ga0070680_100024706 3300005336 Bacteria 4802
12 Ga0070680_100634102 3300005336 Unclassified 918
13 Ga0068868_100835576 3300005338 Unclassified 833
14 Ga0070689_100541475 3300005340 Bacteria 1002
15 Ga0070687_100487839 3300005343 Bacteria 827
16 Ga0070692_10654356 3300005345 Bacteria 702
17 Ga0070668_101201426 3300005347 Bacteria 687
18 Ga0070669_100337450 3300005353 Bacteria 1220
19 Ga0070669_100661869 3300005353 Bacteria 879
20 Ga0070669_100810946 3300005353 Unclassified 796
21 Ga0070669_101633402 3300005353 Unclassified 561
22 Ga0070675_100055082 3300005354 Bacteria 3273
23 Ga0070671_100175764 3300005355 Bacteria 1812
24 Ga0070671_100707451 3300005355 Bacteria 874
25 Ga0070674_100867702 3300005356 Bacteria 784
26 Ga0070674_101619007 3300005356 Unclassified 584
27 Ga0070673_101528158 3300005364 Bacteria 630
28 Ga0070673_101717361 3300005364 Bacteria 594
29 Ga0070688_100028052 3300005365 Bacteria 3357
30 Ga0070703_10000024 3300005406 Bacteria 74173
31 Ga0070701_10646514 3300005438 Unclassified 705
32 Ga0070705_100633986 3300005440 Bacteria 831
33 Ga0070700_100459735 3300005441 Bacteria 970
34 Ga0070700_101526915 3300005441 Unclassified 568
35 Ga0070694_100010984 3300005444 Bacteria 5602
36 Ga0070694_100338176 3300005444 Bacteria 1163
37 Ga0070694_100667749 3300005444 Bacteria 843
38 Ga0070694_101500156 3300005444 Unclassified 570
39 Ga0070694_101500157 3300005444 Unclassified 570
40 Ga0070708_100039183 3300005445 Bacteria 4145
41 Ga0070708_102232059 3300005445 Bacteria 505
42 Ga0070663_100167532 3300005455 Unclassified 1696
43 Ga0070678_102275334 3300005456 Bacteria 514
44 Ga0070681_10026915 3300005458 Bacteria 5782
45 Ga0068867_101264525 3300005459 Bacteria 680
46 Ga0070685_10397858 3300005466 Bacteria 953
47 Ga0070685_10418708 3300005466 Bacteria 932
48 Ga0070706_100000061 3300005467 Bacteria 130709
49 Ga0070706_100183128 3300005467 Bacteria 1956
50 Ga0070706_100357238 3300005467 Bacteria 1362
51 Ga0070706_100506306 3300005467 Bacteria 1123
52 Ga0070707_100000200 3300005468 Bacteria 60010
53 Ga0070707_100010276 3300005468 Bacteria 8715
54 Ga0070707_100193705 3300005468 Bacteria 1982
55 Ga0070698_100030520 3300005471 Bacteria 5587
56 Ga0070698_100410607 3300005471 Unclassified 1288
57 Ga0070698_100588187 3300005471 Unclassified 1053
58 Ga0070698_101773806 3300005471 Bacteria 570
59 Ga0070699_100017980 3300005518 Bacteria 6072
60 Ga0070699_100705888 3300005518 Unclassified 922
61 Ga0070699_100723078 3300005518 Bacteria 910
62 Ga0070699_100957362 3300005518 Unclassified 785
63 Ga0070679_100019992 3300005530 Bacteria 6524
64 Ga0070697_100107689 3300005536 Bacteria 2319
65 Ga0070697_100411964 3300005536 Unclassified 1174
66 Ga0070697_100975794 3300005536 Unclassified 753
67 Ga0070697_101009267 3300005536 Unclassified 740
68 Ga0070697_101870801 3300005536 Unclassified 537
69 Ga0068853_100016529 3300005539 Bacteria 6075
70 Ga0070695_100248218 3300005545 Unclassified 1294
71 Ga0070695_100433056 3300005545 Unclassified 1004
72 Ga0070695_101120997 3300005545 Bacteria 645
73 Ga0070696_100010894 3300005546 Bacteria 6094
74 Ga0070696_100089365 3300005546 Bacteria 2190
75 Ga0070693_100005774 3300005547 Bacteria 5981
76 Ga0070665_100000559 3300005548 Bacteria 51888
77 Ga0070704_100002591 3300005549 Bacteria 10195
78 Ga0070704_100149566 3300005549 Bacteria 1834
79 Ga0070704_100301300 3300005549 Bacteria 1335
80 Ga0068855_100940815 3300005563 Unclassified 911
81 Ga0068857_100054259 3300005577 Plasmid 3556
82 Ga0068854_100014353 3300005578 Bacteria 5220
83 Ga0068852_100031180 3300005616 Bacteria 4396
84 Ga0068852_100297815 3300005616 Unclassified 1560
85 Ga0068859_100028738 3300005617 Bacteria 5574
86 Ga0068859_100047450 3300005617 Bacteria 4315
87 Ga0068864_100141629 3300005618 Bacteria 2169
88 Ga0068864_101795097 3300005618 Bacteria 619
89 Ga0068861_100151268 3300005719 Bacteria 1905
90 Ga0068870_10259773 3300005840 Bacteria 1080
91 Ga0068863_100090676 3300005841 Bacteria 2898
92 Ga0068863_101777110 3300005841 Unclassified 626
93 Ga0068862_101334272 3300005844 Unclassified 719
94 Ga0068862_101671568 3300005844 Bacteria 645
95 Ga0081539_10001039 3300005985 Bacteria 51034
96 Ga0081539_10079781 3300005985 Unclassified 1723
97 Ga0070717_11499100 3300006028 Unclassified 612
98 Ga0070716_100237465 3300006173 Bacteria 1234
99 Ga0075428_100083310 3300006844 Bacteria 3489
100 Ga0075430_100192459 3300006846 Bacteria 1695
101 Ga0075431_100165459 3300006847 Bacteria 2273
102 Ga0075431_102110066 3300006847 Unclassified 518
103 Ga0075434_100029405 3300006871 Bacteria 5406
104 Ga0075434_102309375 3300006871 Unclassified 541
105 Ga0075429_100008602 3300006880 Bacteria 8878
106 Ga0075429_100027806 3300006880 Bacteria 4909
107 Ga0075436_100087155 3300006914 Bacteria 2168
108 Ga0097620_100028740 3300006931 Bacteria 5574
109 Ga0097620_100047455 3300006931 Bacteria 4315
110 Ga0075435_100921516 3300007076 Unclassified 762
111 Ga0099794_10634456 3300007265 Unclassified 567
112 Ga0105251_10318011 3300009011 Bacteria 707
113 Ga0105240_10023456 3300009093 Bacteria 8157
114 Ga0111539_10137433 3300009094 Bacteria 2862
115 Ga0111539_10317361 3300009094 Bacteria 1814
116 Ga0111539_11229901 3300009094 Unclassified 870
117 Ga0111539_11956825 3300009094 Bacteria 680
118 Ga0105245_10985461 3300009098 Unclassified 887
119 Ga0114129_10047540 3300009147 Bacteria 6028
120 Ga0114129_10070033 3300009147 Unclassified 4890
121 Ga0114129_10102447 3300009147 Bacteria 3959
122 Ga0114129_11236278 3300009147 Bacteria 929
123 Ga0114129_11274874 3300009147 Unclassified 912
124 Ga0114129_11281706 3300009147 Unclassified 909
125 Ga0114129_11288130 3300009147 Bacteria 906
126 Ga0114129_11997023 3300009147 Unclassified 701
127 Ga0114129_12616554 3300009147 Bacteria 602
128 Ga0114129_13081751 3300009147 Unclassified 545
129 Ga0105243_10922598 3300009148 Bacteria 870
130 Ga0105241_10014937 3300009174 Bacteria 5686
131 Ga0105241_10136064 3300009174 Bacteria 1995
132 Ga0105241_10824009 3300009174 Bacteria 856
133 Ga0105237_10020219 3300009545 Bacteria 6871
134 Ga0105249_10019152 3300009553 Bacteria 6103
135 Ga0105249_10075049 3300009553 Bacteria 3131
136 Ga0105249_10485841 3300009553 Unclassified 1278
137 Ga0105239_10109441 3300010375 Bacteria 3062
138 Ga0105246_11513272 3300011119 Unclassified 631
139 Ga0157373_10867749 3300013100 Unclassified 668
140 Ga0157370_10064950 3300013104 Plasmid 3453
141 Ga0157370_10544149 3300013104 Unclassified 1064
142 Ga0157369_10016917 3300013105 Bacteria 8195
143 Ga0157374_10098976 3300013296 Bacteria 2793
144 Ga0157378_10029673 3300013297 Bacteria 4830
145 Ga0157372_10264017 3300013307 Bacteria 1999
146 Ga0157375_12851032 3300013308 Unclassified 578
147 Ga0163163_10140190 3300014325 Bacteria 2460
148 Ga0157380_10074502 3300014326 Bacteria 2756
149 Ga0157380_13279276 3300014326 Bacteria 517
150 Ga0157377_10664110 3300014745 Bacteria 752
151 Ga0213875_10019357 3300021388 Bacteria 3275
152 Ga0207653_10000015 3300025885 Bacteria 150553
153 Ga0207688_10315886 3300025901 Bacteria 958
154 Ga0207643_10226788 3300025908 Bacteria 1145
155 Ga0207684_10000138 3300025910 Bacteria 132416
156 Ga0207684_10219629 3300025910 Bacteria 1640
157 Ga0207654_10021853 3300025911 Bacteria 3408
158 Ga0207654_10073124 3300025911 Bacteria 2042
159 Ga0207707_10031629 3300025912 Bacteria 4631
160 Ga0207695_10055212 3300025913 Bacteria 4141
161 Ga0207671_10079007 3300025914 Bacteria 2465
162 Ga0207660_10013850 3300025917 Bacteria 5293
163 Ga0207652_10012756 3300025921 Bacteria 6793
164 Ga0207646_10000032 3300025922 Bacteria 216397
165 Ga0207646_10010784 3300025922 Bacteria 8890
166 Ga0207646_10052393 3300025922 Bacteria 3651
167 Ga0207646_10895513 3300025922 Bacteria 787
168 Ga0207646_11759713 3300025922 Unclassified 531
169 Ga0207681_10366745 3300025923 Unclassified 1156
170 Ga0207681_10720874 3300025923 Bacteria 830
171 Ga0207650_10795757 3300025925 Bacteria 801
172 Ga0207659_11125799 3300025926 Bacteria 675
173 Ga0207709_11104141 3300025935 Unclassified 651
174 Ga0207709_11843860 3300025935 Unclassified 503
175 Ga0207669_11720376 3300025937 Unclassified 536
176 Ga0207665_10294922 3300025939 Bacteria 1210
177 Ga0207665_10343024 3300025939 Bacteria 1126
178 Ga0207667_10804144 3300025949 Unclassified 937
179 Ga0207667_12228696 3300025949 Unclassified 504
180 Ga0207651_11287774 3300025960 Bacteria 657
181 Ga0207712_10602863 3300025961 Bacteria 950
182 Ga0207712_11417835 3300025961 Bacteria 622
183 Ga0207640_10082609 3300025981 Archaea 2200
184 Ga0207677_11719630 3300026023 Unclassified 582
185 Ga0207703_11248026 3300026035 Bacteria 715
186 Ga0207639_10005995 3300026041 Bacteria 8245
187 Ga0207708_10207104 3300026075 Bacteria 1567
188 Ga0207708_10846214 3300026075 Bacteria 789
189 Ga0207641_10180654 3300026088 Bacteria 1932
190 Ga0207648_10735222 3300026089 Bacteria 916
191 Ga0207676_10270411 3300026095 Unclassified 1539
192 Ga0207676_11204670 3300026095 Bacteria 750
193 Ga0207674_10337363 3300026116 Unclassified 1457
194 Ga0207675_100188644 3300026118 Bacteria 1977
195 Ga0207698_10204691 3300026142 Bacteria 1770
196 Ga0207698_10720737 3300026142 Unclassified 994
197 Ga0207428_10001780 3300027907 Bacteria 22062
198 Ga0268266_10001034 3300028379 Bacteria 34999
199 Ga0268265_10099276 3300028380 Bacteria 2347
200 Ga0268265_10402122 3300028380 Bacteria 1266
201 Ga0268265_12075586 3300028380 Unclassified 575
202 Ga0265322_10160730 3300028654 Bacteria 642
203 Ga0265327_10011023 3300031251 Bacteria 6286
204 Ga0307408_100744353 3300031548 Bacteria 885
205 Ga0307408_101106790 3300031548 Unclassified 735
206 Ga0307408_101803710 3300031548 Bacteria 585
207 Ga0316578_10748409 3300031728 Bacteria 568
208 Ga0316578_10883284 3300031728 Unclassified 516
209 Ga0307405_11852225 3300031731 Unclassified 537
210 Ga0307413_11084256 3300031824 Bacteria 691
211 Ga0307410_11468024 3300031852 Bacteria 600
212 Ga0307410_12104868 3300031852 Unclassified 505
213 Ga0307406_11420135 3300031901 Unclassified 609
214 Ga0307407_10358516 3300031903 Bacteria 1035
215 Ga0307407_10921714 3300031903 Bacteria 671
216 Ga0307407_11580111 3300031903 Unclassified 520
217 Ga0307412_10393204 3300031911 Bacteria 1126
218 Ga0307416_101010017 3300032002 Unclassified 935
219 Ga0307414_12199721 3300032004 Bacteria 515
220 Ga0307411_10288046 3300032005 Bacteria 1311
221 Ga0307411_12233570 3300032005 Unclassified 513
222 Ga0307415_101661139 3300032126 Bacteria 615
223 Ga0307415_101850873 3300032126 Bacteria 585
224 Ga0307415_102174863 3300032126 Unclassified 543
225 Ga0373930_0040237 3300034816 Bacteria 993
226 Ga0316574_0503049 3300035398 Bacteria 755
227 Ga0316582_0012727 3300036647 Bacteria 4709
228 Ga0316582_0224256 3300036647 Bacteria 1286
229 Ga0316584_0269661 3300036712 Bacteria 1239
230 Ga0316584_0576309 3300036712 Bacteria 783
231 Ga0316584_0924384 3300036712 Unclassified 586
232 Ga0436364_0638241 3300037853 Bacteria 15574
233 Ga0395901_0759970 3300038443 Bacteria 962
234 Ga0400483_011465 3300039062 Bacteria 1455
235 Ga0400489_91779 3300039093 Bacteria 113013
236 Ga0439438_119320 3300041405 Bacteria 635
237 Ga0451789_0123622 3300041443 Bacteria 958
238 Ga0451797_0535369 3300041453 Unclassified 753
239 Ga0451795_1602461 3300041456 Unclassified 515
240 Ga0451798_0372666 3300041458 Unclassified 631
241 Ga0439432_084354 3300042006 Bacteria 960
242 Ga0451577_0000132 3300042876 Bacteria 167282
243 Ga0451577_0644377 3300042876 Bacteria 961
244 Ga0451577_1799568 3300042876 Unclassified 537
245 Ga0466969_0396007 3300044656 Bacteria 627
246 Ga0453683_0000100 3300044673 Bacteria 128455
247 Ga0453683_0001345 3300044673 Bacteria 21552
248 Ga0453683_0022560 3300044673 Bacteria 4016
249 Ga0453683_0148534 3300044673 Bacteria 1480
250 Ga0453683_0489303 3300044673 Bacteria 798
251 Ga0453684_0000319 3300044712 Bacteria 203440
252 Ga0453684_0000539 3300044712 Bacteria 143526
253 Ga0453684_0166428 3300044712 Bacteria 2602
254 Ga0451576_0056230 3300045051 Bacteria 4116
255 Ga0451576_0124344 3300045051 Bacteria 2687
256 Ga0451576_0198703 3300045051 Unclassified 2094
257 Ga0451576_1642633 3300045051 Unclassified 666
258 Ga0495581_0482528 3300047315 Bacteria 721
259 Ga0496109_0001250 3300048912 Bacteria 21085
260 Ga0501031_0433685 3300049568 Unclassified 849
261 Ga0501033_1008457 3300049570 Unclassified 556
262 Ga0501034_0888104 3300049571 Unclassified 780
263 Ga0501036_1330737 3300049572 Bacteria 583
264 Ga0501038_0473328 3300049574 Bacteria 961
265 Ga0501039_0354123 3300049575 Bacteria 1153
266 Ga0501039_1115754 3300049575 Unclassified 611
267 Ga0501039_1543436 3300049575 Unclassified 510
268 Ga0501041_0218515 3300049577 Bacteria 1196
269 Ga0501041_0949475 3300049577 Bacteria 553
270 Ga0501042_0060637 3300049578 Bacteria 2702
271 Ga0501042_0230943 3300049578 Bacteria 1335
272 Ga0501046_0295445 3300049580 Unclassified 1184
273 Ga0501048_0674208 3300049582 Bacteria 742
274 Ga0501048_0745908 3300049582 Bacteria 703
275 Ga0501071_0206381 3300049587 Bacteria 1477
276 Ga0501072_0040900 3300049588 Bacteria 3641
277 Ga0501075_0160906 3300049591 Bacteria 1713
278 Ga0501076_0303149 3300049592 Unclassified 1310
279 Ga0501076_1237087 3300049592 Unclassified 614
280 Ga0501077_0880601 3300049593 Unclassified 576
281 Ga0501217_055092 3300049661 Bacteria 1049
282 Ga0501235_086323 3300049669 Unclassified 754
283 Ga0501243_108591 3300049675 Bacteria 566
284 Ga0501247_036584 3300049677 Unclassified 689
285 Ga0501257_113576 3300049686 Bacteria 720
286 Ga0501079_0212504 3300049741 Bacteria 1511
287 Ga0501080_0206413 3300049742 Unclassified 1802
288 Ga0501080_0258537 3300049742 Unclassified 1587
289 Ga0501081_0495684 3300049743 Unclassified 910
290 Ga0501081_0827087 3300049743 Bacteria 697
291 Ga0501081_0987627 3300049743 Unclassified 636
292 Ga0501268_006284 3300049765 Unclassified 1737
293 Ga0501044_0065006 3300049823 Bacteria 3721
294 nmdc:mga05p37_131347_c1 3300050507 Bacteria 3073
295 nmdc:mga05p37_1535662_c1 3300050507 Bacteria 660
296 nmdc:mga05p37_248370_c1 3300050507 Bacteria 2135
297 nmdc:mga05p37_33720_c1 3300050507 Bacteria 6270
298 nmdc:mga05p37_626570_c1 3300050507 Bacteria 1209
299 nmdc:mga05p37_987643_c1 3300050507 Unclassified 896
300 nmdc:mga09592_31403_c1 3300050508 Bacteria 4426
301 nmdc:mga06r32_1479136_c1 3300050510 Unclassified 620
302 nmdc:mga06r32_24536_c1 3300050510 Bacteria 5599
303 nmdc:mga08y16_1836070_c1 3300050511 Bacteria 558
304 nmdc:mga0n895_278074_c1 3300050512 Unclassified 1698
305 nmdc:mga0rr50_27542_c1 3300050513 Bacteria 3981
306 nmdc:mga08x19_111457_c1 3300050514 Bacteria 1826
307 nmdc:mga08x19_268596_c1 3300050514 Bacteria 1180
308 nmdc:mga0a205_154329_c1 3300050515 Bacteria 2195
309 nmdc:mga0a205_646022_c1 3300050515 Bacteria 909
310 Ga0500555_050838 3300053103 Unclassified 1134
311 Ga0501082_0466620 3300060353 Unclassified 1103
312 Ga0501082_0583701 3300060353 Bacteria 978
313 Ga0501082_1114669 3300060353 Unclassified 690
314 Ga0501082_1269601 3300060353 Bacteria 643
315 Ga0501082_1333126 3300060353 Bacteria 627
316 Ga0530510_0018040 3300061734 Bacteria 5003
317 Ga0530510_0083324 3300061734 Unclassified 2329
318 Ga0530510_0177309 3300061734 Unclassified 1580

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049686 Ga0501257_113576 Ga0501257_113576_430_639 68
2 3300042876 Ga0451577_0644377 Ga0451577_0644377_309_563 78
3 3300044712 Ga0453684_0166428 Ga0453684_0166428_1829_2083 78
4 3300005467 Ga0070706_100506306 Ga0070706_1005063062 80
5 3300031548 Ga0307408_101803710 Ga0307408_1018037102 80
6 3300031901 Ga0307406_11420135 Ga0307406_114201351 80
7 3300049669 Ga0501235_086323 Ga0501235_086323_483_725 80
8 3300049675 Ga0501243_108591 Ga0501243_108591_269_514 80
9 3300005295 Ga0065707_10121151 Ga0065707_101211513 81
10 3300005331 Ga0070670_100272579 Ga0070670_1002725792 81
11 3300005331 Ga0070670_100424574 Ga0070670_1004245743 81
12 3300005334 Ga0068869_101261618 Ga0068869_1012616181 81
13 3300005336 Ga0070680_100024706 Ga0070680_1000247063 81
14 3300005340 Ga0070689_100541475 Ga0070689_1005414752 81
15 3300005343 Ga0070687_100487839 Ga0070687_1004878392 81
16 3300005345 Ga0070692_10654356 Ga0070692_106543562 81
17 3300005353 Ga0070669_100661869 Ga0070669_1006618692 81
18 3300005354 Ga0070675_100055082 Ga0070675_1000550824 81
19 3300005355 Ga0070671_100175764 Ga0070671_1001757643 81
20 3300005356 Ga0070674_100867702 Ga0070674_1008677022 81
21 3300005364 Ga0070673_101528158 Ga0070673_1015281582 81
22 3300005364 Ga0070673_101717361 Ga0070673_1017173612 81
23 3300005365 Ga0070688_100028052 Ga0070688_1000280522 81
24 3300005441 Ga0070700_101526915 Ga0070700_1015269151 81
25 3300005444 Ga0070694_100338176 Ga0070694_1003381762 81
26 3300005455 Ga0070663_100167532 Ga0070663_1001675323 81
27 3300005456 Ga0070678_102275334 Ga0070678_1022753341 81
28 3300005458 Ga0070681_10026915 Ga0070681_100269155 81
29 3300005459 Ga0068867_101264525 Ga0068867_1012645252 81
30 3300005466 Ga0070685_10418708 Ga0070685_104187082 81
31 3300005530 Ga0070679_100019992 Ga0070679_1000199926 81
32 3300005539 Ga0068853_100016529 Ga0068853_1000165298 81
33 3300005545 Ga0070695_101120997 Ga0070695_1011209972 81
34 3300005549 Ga0070704_100301300 Ga0070704_1003013002 81
35 3300005563 Ga0068855_100940815 Ga0068855_1009408153 81
36 3300005577 Ga0068857_100054259 Ga0068857_1000542592 81
37 3300005578 Ga0068854_100014353 Ga0068854_1000143534 81
38 3300005616 Ga0068852_100031180 Ga0068852_1000311803 81
39 3300005617 Ga0068859_100047450 Ga0068859_1000474503 81
40 3300005618 Ga0068864_100141629 Ga0068864_1001416293 81
41 3300005618 Ga0068864_101795097 Ga0068864_1017950972 81
42 3300005719 Ga0068861_100151268 Ga0068861_1001512682 81
43 3300005840 Ga0068870_10259773 Ga0068870_102597732 81
44 3300005841 Ga0068863_100090676 Ga0068863_1000906762 81
45 3300005844 Ga0068862_101671568 Ga0068862_1016715682 81
46 3300006931 Ga0097620_100047455 Ga0097620_1000474554 81
47 3300009011 Ga0105251_10318011 Ga0105251_103180112 81
48 3300009093 Ga0105240_10023456 Ga0105240_100234567 81
49 3300009094 Ga0111539_11229901 Ga0111539_112299012 81
50 3300009094 Ga0111539_11956825 Ga0111539_119568252 81
51 3300009147 Ga0114129_13081751 Ga0114129_130817511 81
52 3300009174 Ga0105241_10014937 Ga0105241_100149374 81
53 3300009545 Ga0105237_10020219 Ga0105237_100202196 81
54 3300009553 Ga0105249_10019152 Ga0105249_100191522 81
55 3300009553 Ga0105249_10075049 Ga0105249_100750494 81
56 3300009553 Ga0105249_10485841 Ga0105249_104858411 81
57 3300010375 Ga0105239_10109441 Ga0105239_101094412 81
58 3300013100 Ga0157373_10867749 Ga0157373_108677492 81
59 3300013104 Ga0157370_10064950 Ga0157370_100649502 81
60 3300013105 Ga0157369_10016917 Ga0157369_100169176 81
61 3300013307 Ga0157372_10264017 Ga0157372_102640172 81
62 3300014325 Ga0163163_10140190 Ga0163163_101401901 81
63 3300014326 Ga0157380_10074502 Ga0157380_100745025 81
64 3300014745 Ga0157377_10664110 Ga0157377_106641102 81
65 3300025901 Ga0207688_10315886 Ga0207688_103158862 81
66 3300025908 Ga0207643_10226788 Ga0207643_102267883 81
67 3300025911 Ga0207654_10021853 Ga0207654_100218532 81
68 3300025912 Ga0207707_10031629 Ga0207707_100316295 81
69 3300025913 Ga0207695_10055212 Ga0207695_100552125 81
70 3300025914 Ga0207671_10079007 Ga0207671_100790072 81
71 3300025917 Ga0207660_10013850 Ga0207660_100138505 81
72 3300025921 Ga0207652_10012756 Ga0207652_100127566 81
73 3300025923 Ga0207681_10720874 Ga0207681_107208742 81
74 3300025925 Ga0207650_10795757 Ga0207650_107957572 81
75 3300025926 Ga0207659_11125799 Ga0207659_111257992 81
76 3300025937 Ga0207669_11720376 Ga0207669_117203762 81
77 3300025949 Ga0207667_10804144 Ga0207667_108041441 81
78 3300025960 Ga0207651_11287774 Ga0207651_112877742 81
79 3300025961 Ga0207712_10602863 Ga0207712_106028632 81
80 3300025961 Ga0207712_11417835 Ga0207712_114178351 81
81 3300025981 Ga0207640_10082609 Ga0207640_100826092 81
82 3300026035 Ga0207703_11248026 Ga0207703_112480262 81
83 3300026041 Ga0207639_10005995 Ga0207639_100059957 81
84 3300026075 Ga0207708_10846214 Ga0207708_108462142 81
85 3300026088 Ga0207641_10180654 Ga0207641_101806542 81
86 3300026089 Ga0207648_10735222 Ga0207648_107352221 81
87 3300026095 Ga0207676_10270411 Ga0207676_102704114 81
88 3300026095 Ga0207676_11204670 Ga0207676_112046702 81
89 3300026116 Ga0207674_10337363 Ga0207674_103373632 81
90 3300026118 Ga0207675_100188644 Ga0207675_1001886442 81
91 3300026142 Ga0207698_10204691 Ga0207698_102046912 81
92 3300028380 Ga0268265_10099276 Ga0268265_100992762 81
93 3300028380 Ga0268265_10402122 Ga0268265_104021222 81
94 3300031548 Ga0307408_100744353 Ga0307408_1007443532 81
95 3300031731 Ga0307405_11852225 Ga0307405_118522252 81
96 3300031824 Ga0307413_11084256 Ga0307413_110842562 81
97 3300031852 Ga0307410_12104868 Ga0307410_121048682 81
98 3300031903 Ga0307407_11580111 Ga0307407_115801112 81
99 3300032005 Ga0307411_10288046 Ga0307411_102880462 81
100 3300032126 Ga0307415_102174863 Ga0307415_1021748631 81
101 3300041405 Ga0439438_119320 Ga0439438_119320_269_514 81
102 3300041456 Ga0451795_1602461 Ga0451795_1602461_249_494 81
103 3300042006 Ga0439432_084354 Ga0439432_084354_471_716 81
104 3300047315 Ga0495581_0482528 Ga0495581_0482528_64_330 81
105 3300049661 Ga0501217_055092 Ga0501217_055092_578_826 81
106 3300049677 Ga0501247_036584 Ga0501247_036584_61_306 81
107 3300050507 nmdc:mga05p37_1535662_c1 nmdc:mga05p37_1535662_c1_169_414 81
108 3300005444 Ga0070694_100010984 Ga0070694_1000109845 82
109 3300005468 Ga0070707_100193705 Ga0070707_1001937052 82
110 3300005471 Ga0070698_100030520 Ga0070698_1000305205 82
111 3300005536 Ga0070697_101009267 Ga0070697_1010092672 82
112 3300005545 Ga0070695_100248218 Ga0070695_1002482183 82
113 3300005546 Ga0070696_100089365 Ga0070696_1000893651 82
114 3300005549 Ga0070704_100002591 Ga0070704_1000025914 82
115 3300006847 Ga0075431_102110066 Ga0075431_1021100662 82
116 3300006871 Ga0075434_100029405 Ga0075434_1000294056 82
117 3300007265 Ga0099794_10634456 Ga0099794_106344561 82
118 3300025922 Ga0207646_10010784 Ga0207646_100107843 82
119 3300028654 Ga0265322_10160730 Ga0265322_101607302 82
120 3300031251 Ga0265327_10011023 Ga0265327_100110232 82
121 3300031548 Ga0307408_101106790 Ga0307408_1011067902 82
122 3300031852 Ga0307410_11468024 Ga0307410_114680242 82
123 3300031903 Ga0307407_10358516 Ga0307407_103585162 82
124 3300031903 Ga0307407_10921714 Ga0307407_109217142 82
125 3300031911 Ga0307412_10393204 Ga0307412_103932041 82
126 3300032002 Ga0307416_101010017 Ga0307416_1010100171 82
127 3300032005 Ga0307411_12233570 Ga0307411_122335701 82
128 3300032126 Ga0307415_101661139 Ga0307415_1016611392 82
129 3300035398 Ga0316574_0503049 Ga0316574_0503049_207_458 82
130 3300039062 Ga0400483_011465 Ga0400483_011465_1042_1302 82
131 3300044673 Ga0453683_0489303 Ga0453683_0489303_140_397 82
132 3300049570 Ga0501033_1008457 Ga0501033_1008457_13_267 82
133 3300049572 Ga0501036_1330737 Ga0501036_1330737_131_388 82
134 3300049574 Ga0501038_0473328 Ga0501038_0473328_306_563 82
135 3300049575 Ga0501039_1543436 Ga0501039_1543436_56_310 82
136 3300049580 Ga0501046_0295445 Ga0501046_0295445_421_675 82
137 3300049587 Ga0501071_0206381 Ga0501071_0206381_1193_1450 82
138 3300049588 Ga0501072_0040900 Ga0501072_0040900_3200_3457 82
139 3300049591 Ga0501075_0160906 Ga0501075_0160906_540_797 82
140 3300049592 Ga0501076_0303149 Ga0501076_0303149_345_599 82
141 3300049741 Ga0501079_0212504 Ga0501079_0212504_265_522 82
142 3300049742 Ga0501080_0258537 Ga0501080_0258537_171_428 82
143 3300049743 Ga0501081_0495684 Ga0501081_0495684_483_737 82
144 3300050512 nmdc:mga0n895_278074_c1 nmdc:mga0n895_278074_c1_828_1082 82
145 3300050513 nmdc:mga0rr50_27542_c1 nmdc:mga0rr50_27542_c1_667_921 82
146 3300050515 nmdc:mga0a205_154329_c1 nmdc:mga0a205_154329_c1_115_369 82
147 3300060353 Ga0501082_0583701 Ga0501082_0583701_495_752 82
148 3300060353 Ga0501082_1114669 Ga0501082_1114669_51_305 82
149 3300060353 Ga0501082_1269601 Ga0501082_1269601_293_547 82
150 3300061734 Ga0530510_0018040 Ga0530510_0018040_2306_2560 82
151 iso_pu_bacteria 2831426010 2831430225 82
152 iso_pu_bacteria 2848694841 2848696306 82
153 3300003203 JGI25406J46586_10171620 JGI25406J46586_101716201 83
154 3300005347 Ga0070668_101201426 Ga0070668_1012014262 83
155 3300005353 Ga0070669_100337450 Ga0070669_1003374502 83
156 3300005468 Ga0070707_100010276 Ga0070707_1000102761 83
157 3300005471 Ga0070698_100588187 Ga0070698_1005881871 83
158 3300005518 Ga0070699_100705888 Ga0070699_1007058882 83
159 3300005518 Ga0070699_100723078 Ga0070699_1007230781 83
160 3300005536 Ga0070697_101870801 Ga0070697_1018708012 83
161 3300005985 Ga0081539_10079781 Ga0081539_100797813 83
162 3300006028 Ga0070717_11499100 Ga0070717_114991002 83
163 3300006173 Ga0070716_100237465 Ga0070716_1002374653 83
164 3300006871 Ga0075434_102309375 Ga0075434_1023093752 83
165 3300007076 Ga0075435_100921516 Ga0075435_1009215162 83
166 3300009098 Ga0105245_10985461 Ga0105245_109854611 83
167 3300009147 Ga0114129_11274874 Ga0114129_112748742 83
168 3300009147 Ga0114129_11288130 Ga0114129_112881302 83
169 3300009147 Ga0114129_12616554 Ga0114129_126165541 83
170 3300013297 Ga0157378_10029673 Ga0157378_100296736 83
171 3300025922 Ga0207646_10052393 Ga0207646_100523932 83
172 3300025922 Ga0207646_10895513 Ga0207646_108955131 83
173 3300025922 Ga0207646_11759713 Ga0207646_117597132 83
174 3300025923 Ga0207681_10366745 Ga0207681_103667452 83
175 3300025939 Ga0207665_10294922 Ga0207665_102949221 83
176 3300025939 Ga0207665_10343024 Ga0207665_103430241 83
177 3300031728 Ga0316578_10883284 Ga0316578_108832841 83
178 3300032004 Ga0307414_12199721 Ga0307414_121997212 83
179 3300032126 Ga0307415_101850873 Ga0307415_1018508731 83
180 3300036712 Ga0316584_0269661 Ga0316584_0269661_240_500 83
181 3300041458 Ga0451798_0372666 Ga0451798_0372666_111_398 83
182 3300045051 Ga0451576_0198703 Ga0451576_0198703_1289_1549 83
183 3300049571 Ga0501034_0888104 Ga0501034_0888104_403_654 83
184 3300049577 Ga0501041_0949475 Ga0501041_0949475_273_536 83
185 3300049742 Ga0501080_0206413 Ga0501080_0206413_443_706 83
186 3300049743 Ga0501081_0827087 Ga0501081_0827087_57_320 83
187 3300049765 Ga0501268_006284 Ga0501268_006284_172_435 83
188 3300049823 Ga0501044_0065006 Ga0501044_0065006_1446_1712 83
189 3300050507 nmdc:mga05p37_248370_c1 nmdc:mga05p37_248370_c1_1071_1334 83
190 3300050507 nmdc:mga05p37_626570_c1 nmdc:mga05p37_626570_c1_793_1056 83
191 3300050510 nmdc:mga06r32_1479136_c1 nmdc:mga06r32_1479136_c1_322_573 83
192 3300060353 Ga0501082_0466620 Ga0501082_0466620_317_580 83
193 3300061734 Ga0530510_0177309 Ga0530510_0177309_853_1116 83
194 2162886007 SwRhRL2b_contig_621227 SwRhRL2b_0389.00004050 84
195 3300000532 CNAas_1004248 CNAas_10042482 84
196 3300003203 JGI25406J46586_10011657 JGI25406J46586_100116574 84
197 3300005293 Ga0065715_10936282 Ga0065715_109362822 84
198 3300005295 Ga0065707_10009798 Ga0065707_100097985 84
199 3300005336 Ga0070680_100634102 Ga0070680_1006341022 84
200 3300005338 Ga0068868_100835576 Ga0068868_1008355762 84
201 3300005353 Ga0070669_100810946 Ga0070669_1008109462 84
202 3300005353 Ga0070669_101633402 Ga0070669_1016334022 84
203 3300005355 Ga0070671_100707451 Ga0070671_1007074511 84
204 3300005356 Ga0070674_101619007 Ga0070674_1016190072 84
205 3300005406 Ga0070703_10000024 Ga0070703_1000002429 84
206 3300005438 Ga0070701_10646514 Ga0070701_106465141 84
207 3300005440 Ga0070705_100633986 Ga0070705_1006339861 84
208 3300005441 Ga0070700_100459735 Ga0070700_1004597352 84
209 3300005444 Ga0070694_100667749 Ga0070694_1006677492 84
210 3300005444 Ga0070694_101500156 Ga0070694_1015001561 84
211 3300005444 Ga0070694_101500157 Ga0070694_1015001571 84
212 3300005445 Ga0070708_100039183 Ga0070708_1000391831 84
213 3300005445 Ga0070708_102232059 Ga0070708_1022320592 84
214 3300005466 Ga0070685_10397858 Ga0070685_103978582 84
215 3300005467 Ga0070706_100000061 Ga0070706_10000006151 84
216 3300005467 Ga0070706_100183128 Ga0070706_1001831283 84
217 3300005467 Ga0070706_100357238 Ga0070706_1003572381 84
218 3300005468 Ga0070707_100000200 Ga0070707_10000020036 84
219 3300005471 Ga0070698_100410607 Ga0070698_1004106072 84
220 3300005471 Ga0070698_101773806 Ga0070698_1017738062 84
221 3300005518 Ga0070699_100017980 Ga0070699_1000179802 84
222 3300005518 Ga0070699_100957362 Ga0070699_1009573621 84
223 3300005536 Ga0070697_100107689 Ga0070697_1001076892 84
224 3300005536 Ga0070697_100411964 Ga0070697_1004119641 84
225 3300005536 Ga0070697_100975794 Ga0070697_1009757941 84
226 3300005545 Ga0070695_100433056 Ga0070695_1004330562 84
227 3300005546 Ga0070696_100010894 Ga0070696_1000108945 84
228 3300005547 Ga0070693_100005774 Ga0070693_1000057742 84
229 3300005548 Ga0070665_100000559 Ga0070665_1000005593 84
230 3300005549 Ga0070704_100149566 Ga0070704_1001495662 84
231 3300005616 Ga0068852_100297815 Ga0068852_1002978152 84
232 3300005617 Ga0068859_100028738 Ga0068859_1000287388 84
233 3300005841 Ga0068863_101777110 Ga0068863_1017771101 84
234 3300005844 Ga0068862_101334272 Ga0068862_1013342722 84
235 3300005985 Ga0081539_10001039 Ga0081539_1000103922 84
236 3300006844 Ga0075428_100083310 Ga0075428_1000833103 84
237 3300006846 Ga0075430_100192459 Ga0075430_1001924592 84
238 3300006847 Ga0075431_100165459 Ga0075431_1001654592 84
239 3300006880 Ga0075429_100008602 Ga0075429_1000086023 84
240 3300006880 Ga0075429_100027806 Ga0075429_1000278063 84
241 3300006914 Ga0075436_100087155 Ga0075436_1000871552 84
242 3300006931 Ga0097620_100028740 Ga0097620_1000287408 84
243 3300009094 Ga0111539_10137433 Ga0111539_101374334 84
244 3300009094 Ga0111539_10317361 Ga0111539_103173612 84
245 3300009147 Ga0114129_10047540 Ga0114129_100475405 84
246 3300009147 Ga0114129_10070033 Ga0114129_100700332 84
247 3300009147 Ga0114129_10102447 Ga0114129_101024473 84
248 3300009147 Ga0114129_11236278 Ga0114129_112362782 84
249 3300009147 Ga0114129_11281706 Ga0114129_112817063 84
250 3300009147 Ga0114129_11997023 Ga0114129_119970231 84
251 3300009148 Ga0105243_10922598 Ga0105243_109225982 84
252 3300009174 Ga0105241_10136064 Ga0105241_101360643 84
253 3300009174 Ga0105241_10824009 Ga0105241_108240091 84
254 3300011119 Ga0105246_11513272 Ga0105246_115132721 84
255 3300013104 Ga0157370_10544149 Ga0157370_105441492 84
256 3300013296 Ga0157374_10098976 Ga0157374_100989763 84
257 3300013308 Ga0157375_12851032 Ga0157375_128510322 84
258 3300014326 Ga0157380_13279276 Ga0157380_132792761 84
259 3300021388 Ga0213875_10019357 Ga0213875_100193573 84
260 3300025885 Ga0207653_10000015 Ga0207653_1000001535 84
261 3300025910 Ga0207684_10000138 Ga0207684_1000013850 84
262 3300025910 Ga0207684_10219629 Ga0207684_102196292 84
263 3300025911 Ga0207654_10073124 Ga0207654_100731243 84
264 3300025922 Ga0207646_10000032 Ga0207646_10000032188 84
265 3300025935 Ga0207709_11104141 Ga0207709_111041412 84
266 3300025935 Ga0207709_11843860 Ga0207709_118438602 84
267 3300025949 Ga0207667_12228696 Ga0207667_122286961 84
268 3300026023 Ga0207677_11719630 Ga0207677_117196302 84
269 3300026075 Ga0207708_10207104 Ga0207708_102071043 84
270 3300026142 Ga0207698_10720737 Ga0207698_107207372 84
271 3300027907 Ga0207428_10001780 Ga0207428_100017803 84
272 3300028379 Ga0268266_10001034 Ga0268266_1000103420 84
273 3300028380 Ga0268265_12075586 Ga0268265_120755861 84
274 3300031728 Ga0316578_10748409 Ga0316578_107484091 84
275 3300034816 Ga0373930_0040237 Ga0373930_0040237_451_708 84
276 3300036647 Ga0316582_0012727 Ga0316582_0012727_1154_1420 84
277 3300036647 Ga0316582_0224256 Ga0316582_0224256_533_787 84
278 3300036712 Ga0316584_0576309 Ga0316584_0576309_301_555 84
279 3300036712 Ga0316584_0924384 Ga0316584_0924384_110_364 84
280 3300037853 Ga0436364_0638241 Ga0436364_0638241_4007_4273 84
281 3300038443 Ga0395901_0759970 Ga0395901_0759970_320_586 84
282 3300039093 Ga0400489_91779 Ga0400489_91779_94349_94615 84
283 3300041443 Ga0451789_0123622 Ga0451789_0123622_253_510 84
284 3300041453 Ga0451797_0535369 Ga0451797_0535369_108_365 84
285 3300042876 Ga0451577_0000132 Ga0451577_0000132_149076_149330 84
286 3300042876 Ga0451577_1799568 Ga0451577_1799568_31_285 84
287 3300044656 Ga0466969_0396007 Ga0466969_0396007_188_445 84
288 3300044673 Ga0453683_0000100 Ga0453683_0000100_394_648 84
289 3300044673 Ga0453683_0001345 Ga0453683_0001345_4561_4815 84
290 3300044673 Ga0453683_0022560 Ga0453683_0022560_2499_2753 84
291 3300044673 Ga0453683_0148534 Ga0453683_0148534_379_633 84
292 3300044712 Ga0453684_0000319 Ga0453684_0000319_136960_137214 84
293 3300044712 Ga0453684_0000539 Ga0453684_0000539_28366_28620 84
294 3300045051 Ga0451576_0056230 Ga0451576_0056230_59_313 84
295 3300045051 Ga0451576_0124344 Ga0451576_0124344_1762_2016 84
296 3300045051 Ga0451576_1642633 Ga0451576_1642633_161_415 84
297 3300048912 Ga0496109_0001250 Ga0496109_0001250_13307_13561 84
298 3300049568 Ga0501031_0433685 Ga0501031_0433685_432_710 84
299 3300049575 Ga0501039_0354123 Ga0501039_0354123_432_710 84
300 3300049575 Ga0501039_1115754 Ga0501039_1115754_68_322 84
301 3300049577 Ga0501041_0218515 Ga0501041_0218515_40_294 84
302 3300049578 Ga0501042_0060637 Ga0501042_0060637_2092_2370 84
303 3300049578 Ga0501042_0230943 Ga0501042_0230943_982_1236 84
304 3300049582 Ga0501048_0674208 Ga0501048_0674208_306_560 84
305 3300049582 Ga0501048_0745908 Ga0501048_0745908_55_309 84
306 3300049592 Ga0501076_1237087 Ga0501076_1237087_217_471 84
307 3300049593 Ga0501077_0880601 Ga0501077_0880601_77_334 84
308 3300049743 Ga0501081_0987627 Ga0501081_0987627_118_372 84
309 3300050507 nmdc:mga05p37_131347_c1 nmdc:mga05p37_131347_c1_1437_1691 84
310 3300050507 nmdc:mga05p37_33720_c1 nmdc:mga05p37_33720_c1_798_1052 84
311 3300050507 nmdc:mga05p37_987643_c1 nmdc:mga05p37_987643_c1_632_886 84
312 3300050508 nmdc:mga09592_31403_c1 nmdc:mga09592_31403_c1_3542_3796 84
313 3300050510 nmdc:mga06r32_24536_c1 nmdc:mga06r32_24536_c1_3113_3367 84
314 3300050511 nmdc:mga08y16_1836070_c1 nmdc:mga08y16_1836070_c1_159_413 84
315 3300050514 nmdc:mga08x19_111457_c1 nmdc:mga08x19_111457_c1_20_274 84
316 3300050514 nmdc:mga08x19_268596_c1 nmdc:mga08x19_268596_c1_471_728 84
317 3300050515 nmdc:mga0a205_646022_c1 nmdc:mga0a205_646022_c1_431_685 84
318 3300053103 Ga0500555_050838 Ga0500555_050838_330_584 84
319 3300060353 Ga0501082_1333126 Ga0501082_1333126_315_581 84
320 3300061734 Ga0530510_0083324 Ga0530510_0083324_1503_1757 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

20

64

0.94

Feature Viewer

pLDDT pTM Quality
75.13 0.4 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map