F405547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 320 | 199 | 320 | 191 |
Family's Representative Sequence
| Representative Sequence | 3300020075|Ga0206349_1457507|Ga0206349_14575071 |
| Length | 231 |
| Sequence | MIDTKFQLLEQSRQRQHHERKGTGRMESLTSGTMAGAGSFRCQRCGYVLTLTSLDKLGDCPGCGGRSFARASLFSAAPRPFGGSTGPDTAPTTPPLARIDEEEHEERLTGALDGLERPGEYLLFEEDDEMRCVALTREWTRIGRSLAADVRFDDPTVSRRHALVVRQADGVRVLDDRSLNGVFVNGERVEWRALTDGDEIVVGRYRLRFVSLAEASDMPGSLPSTSPASAM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 95 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 156 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 159 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 163 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 176 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 184 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 187 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 188 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 189 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95 |
| Metatranscriptomes | 5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 14.37 |
| Rhizosphere | 80.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1002127 | 3300002074 | Bacteria | 2218 |
| 2 | JGI24034J26672_10000251 | 3300002239 | Bacteria | 7093 |
| 3 | JGI24742J22300_10002911 | 3300002244 | Bacteria | 2764 |
| 4 | Ga0070683_100000645 | 3300005329 | Bacteria | 25129 |
| 5 | Ga0068869_100013296 | 3300005334 | Bacteria | 5471 |
| 6 | Ga0070682_100007928 | 3300005337 | Bacteria | 5974 |
| 7 | Ga0070682_100637545 | 3300005337 | Bacteria | 846 |
| 8 | Ga0068868_100022502 | 3300005338 | Bacteria | 4758 |
| 9 | Ga0068868_100342599 | 3300005338 | Bacteria | 1278 |
| 10 | Ga0068868_100347383 | 3300005338 | Bacteria | 1270 |
| 11 | Ga0070660_100001954 | 3300005339 | Bacteria | 14205 |
| 12 | Ga0070689_100032679 | 3300005340 | Bacteria | 3959 |
| 13 | Ga0070689_100468488 | 3300005340 | Bacteria | 1074 |
| 14 | Ga0070687_100570522 | 3300005343 | Bacteria | 773 |
| 15 | Ga0070661_100144755 | 3300005344 | Bacteria | 1793 |
| 16 | Ga0070692_10042830 | 3300005345 | Bacteria | 2326 |
| 17 | Ga0070668_100502385 | 3300005347 | Bacteria | 1050 |
| 18 | Ga0070668_100650826 | 3300005347 | Bacteria | 926 |
| 19 | Ga0070669_100178713 | 3300005353 | Bacteria | 1659 |
| 20 | Ga0070669_100347813 | 3300005353 | Bacteria | 1203 |
| 21 | Ga0070671_100079596 | 3300005355 | Bacteria | 2739 |
| 22 | Ga0070674_100015075 | 3300005356 | Bacteria | 4818 |
| 23 | Ga0070673_100031260 | 3300005364 | Bacteria | 3993 |
| 24 | Ga0070688_100273207 | 3300005365 | Bacteria | 1211 |
| 25 | Ga0070688_100783309 | 3300005365 | Unclassified | 744 |
| 26 | Ga0070659_100061599 | 3300005366 | Bacteria | 2965 |
| 27 | Ga0070659_100309620 | 3300005366 | Bacteria | 1319 |
| 28 | Ga0070667_100456557 | 3300005367 | Bacteria | 1168 |
| 29 | Ga0070709_10359459 | 3300005434 | Bacteria | 1078 |
| 30 | Ga0070714_100966734 | 3300005435 | Bacteria | 828 |
| 31 | Ga0070710_10181272 | 3300005437 | Bacteria | 1319 |
| 32 | Ga0070705_100296966 | 3300005440 | Bacteria | 1156 |
| 33 | Ga0070705_100456976 | 3300005440 | Bacteria | 959 |
| 34 | Ga0070700_100008738 | 3300005441 | Bacteria | 5528 |
| 35 | Ga0070700_100059370 | 3300005441 | Bacteria | 2407 |
| 36 | Ga0070694_100093786 | 3300005444 | Bacteria | 2111 |
| 37 | Ga0070708_100423212 | 3300005445 | Bacteria | 1256 |
| 38 | Ga0070678_100016305 | 3300005456 | Bacteria | 4751 |
| 39 | Ga0070662_100036848 | 3300005457 | Bacteria | 3464 |
| 40 | Ga0070662_100770200 | 3300005457 | Bacteria | 817 |
| 41 | Ga0070685_10008908 | 3300005466 | Bacteria | 5175 |
| 42 | Ga0070685_10019794 | 3300005466 | Bacteria | 3636 |
| 43 | Ga0070699_100330478 | 3300005518 | Bacteria | 1371 |
| 44 | Ga0070684_100003617 | 3300005535 | Bacteria | 11636 |
| 45 | Ga0070672_100530533 | 3300005543 | Bacteria | 1020 |
| 46 | Ga0070686_100234233 | 3300005544 | Bacteria | 1333 |
| 47 | Ga0070695_100132932 | 3300005545 | Bacteria | 1717 |
| 48 | Ga0070665_100109040 | 3300005548 | Bacteria | 2771 |
| 49 | Ga0070704_100035306 | 3300005549 | Bacteria | 3398 |
| 50 | Ga0070704_100190405 | 3300005549 | Bacteria | 1649 |
| 51 | Ga0070704_100624341 | 3300005549 | Bacteria | 949 |
| 52 | Ga0068855_100651697 | 3300005563 | Bacteria | 1131 |
| 53 | Ga0070664_100003373 | 3300005564 | Bacteria | 12904 |
| 54 | Ga0070664_100104333 | 3300005564 | Bacteria | 2468 |
| 55 | Ga0068854_100041065 | 3300005578 | Bacteria | 3267 |
| 56 | Ga0068856_100005907 | 3300005614 | Bacteria | 12057 |
| 57 | Ga0070702_100012747 | 3300005615 | Bacteria | 4226 |
| 58 | Ga0070702_100222463 | 3300005615 | Bacteria | 1263 |
| 59 | Ga0068852_100199330 | 3300005616 | Bacteria | 1893 |
| 60 | Ga0068859_100384755 | 3300005617 | Bacteria | 1498 |
| 61 | Ga0068864_100438158 | 3300005618 | Bacteria | 1248 |
| 62 | Ga0068864_100945624 | 3300005618 | Bacteria | 852 |
| 63 | Ga0068861_100298200 | 3300005719 | Bacteria | 1395 |
| 64 | Ga0068861_101003770 | 3300005719 | Bacteria | 797 |
| 65 | Ga0068851_10284688 | 3300005834 | Bacteria | 946 |
| 66 | Ga0068851_10457119 | 3300005834 | Bacteria | 760 |
| 67 | Ga0068870_10031267 | 3300005840 | Bacteria | 2696 |
| 68 | Ga0068863_100709363 | 3300005841 | Bacteria | 1000 |
| 69 | Ga0068858_100189081 | 3300005842 | Bacteria | 1945 |
| 70 | Ga0068860_100629693 | 3300005843 | Bacteria | 1080 |
| 71 | Ga0075365_10528561 | 3300006038 | Bacteria | 834 |
| 72 | Ga0075363_100322492 | 3300006048 | Bacteria | 899 |
| 73 | Ga0075432_10045578 | 3300006058 | Bacteria | 1539 |
| 74 | Ga0070716_100182942 | 3300006173 | Bacteria | 1378 |
| 75 | Ga0070712_100022048 | 3300006175 | Bacteria | 4191 |
| 76 | Ga0070712_100183845 | 3300006175 | Bacteria | 1631 |
| 77 | Ga0070712_100259040 | 3300006175 | Bacteria | 1393 |
| 78 | Ga0070712_100294285 | 3300006175 | Bacteria | 1312 |
| 79 | Ga0075430_100670679 | 3300006846 | Bacteria | 855 |
| 80 | Ga0075431_100033246 | 3300006847 | Bacteria | 5315 |
| 81 | Ga0075434_100023596 | 3300006871 | Bacteria | 5998 |
| 82 | Ga0075434_100162684 | 3300006871 | Bacteria | 2251 |
| 83 | Ga0068865_100052661 | 3300006881 | Bacteria | 2822 |
| 84 | Ga0068865_100353917 | 3300006881 | Bacteria | 1190 |
| 85 | Ga0075436_100234023 | 3300006914 | Bacteria | 1305 |
| 86 | Ga0097620_100384743 | 3300006931 | Bacteria | 1498 |
| 87 | Ga0075435_100041548 | 3300007076 | Bacteria | 3676 |
| 88 | Ga0111539_10009419 | 3300009094 | Bacteria | 12324 |
| 89 | Ga0111539_10248830 | 3300009094 | Bacteria | 2070 |
| 90 | Ga0111539_10311184 | 3300009094 | Bacteria | 1833 |
| 91 | Ga0111539_10703964 | 3300009094 | Bacteria | 1176 |
| 92 | Ga0105245_10004181 | 3300009098 | Bacteria | 12821 |
| 93 | Ga0105245_10594879 | 3300009098 | Bacteria | 1132 |
| 94 | Ga0105245_10677557 | 3300009098 | Bacteria | 1063 |
| 95 | Ga0105247_10114396 | 3300009101 | Bacteria | 1740 |
| 96 | Ga0114129_11985524 | 3300009147 | Bacteria | 704 |
| 97 | Ga0105243_10017175 | 3300009148 | Bacteria | 5474 |
| 98 | Ga0105241_10065281 | 3300009174 | Bacteria | 2812 |
| 99 | Ga0105241_10157552 | 3300009174 | Bacteria | 1863 |
| 100 | Ga0105242_10110455 | 3300009176 | Bacteria | 2342 |
| 101 | Ga0105248_10087752 | 3300009177 | Bacteria | 3501 |
| 102 | Ga0105248_10242819 | 3300009177 | Bacteria | 2027 |
| 103 | Ga0105237_10267536 | 3300009545 | Bacteria | 1712 |
| 104 | Ga0105238_10061275 | 3300009551 | Bacteria | 3766 |
| 105 | Ga0105249_10058789 | 3300009553 | Bacteria | 3524 |
| 106 | Ga0105249_10290010 | 3300009553 | Bacteria | 1637 |
| 107 | Ga0105249_10347929 | 3300009553 | Bacteria | 1501 |
| 108 | Ga0105249_10616208 | 3300009553 | Bacteria | 1141 |
| 109 | Ga0105239_10051102 | 3300010375 | Bacteria | 4532 |
| 110 | Ga0105239_10513975 | 3300010375 | Bacteria | 1362 |
| 111 | Ga0105246_10007691 | 3300011119 | Bacteria | 6614 |
| 112 | Ga0105246_10028909 | 3300011119 | Bacteria | 3645 |
| 113 | Ga0157374_10007098 | 3300013296 | Bacteria | 9536 |
| 114 | Ga0157378_11640122 | 3300013297 | Bacteria | 689 |
| 115 | Ga0163162_10186192 | 3300013306 | Bacteria | 2203 |
| 116 | Ga0157372_10012336 | 3300013307 | Bacteria | 9107 |
| 117 | Ga0157372_10060443 | 3300013307 | Bacteria | 4240 |
| 118 | Ga0157375_10017301 | 3300013308 | Bacteria | 6503 |
| 119 | Ga0157375_10854420 | 3300013308 | Bacteria | 1056 |
| 120 | Ga0157375_10892338 | 3300013308 | Bacteria | 1033 |
| 121 | Ga0163163_10043652 | 3300014325 | Bacteria | 4396 |
| 122 | Ga0163163_10199708 | 3300014325 | Bacteria | 2048 |
| 123 | Ga0163163_10515557 | 3300014325 | Bacteria | 1258 |
| 124 | Ga0157380_10057796 | 3300014326 | Bacteria | 3090 |
| 125 | Ga0157380_10123073 | 3300014326 | Bacteria | 2200 |
| 126 | Ga0157377_10000822 | 3300014745 | Bacteria | 12885 |
| 127 | Ga0157377_10203658 | 3300014745 | Bacteria | 1258 |
| 128 | Ga0157379_10094710 | 3300014968 | Bacteria | 2679 |
| 129 | Ga0163161_10206753 | 3300017792 | Bacteria | 1515 |
| 130 | Ga0197907_10337718 | 3300020069 | Bacteria | 746 |
| 131 | Ga0197907_11391826 | 3300020069 | Bacteria | 1048 |
| 132 | Ga0197907_11436359 | 3300020069 | Bacteria | 992 |
| 133 | Ga0206356_11760707 | 3300020070 | Bacteria | 925 |
| 134 | Ga0206349_1457507 | 3300020075 | Bacteria | 1072 |
| 135 | Ga0206352_10535192 | 3300020078 | Bacteria | 838 |
| 136 | Ga0206352_10753119 | 3300020078 | Bacteria | 657 |
| 137 | Ga0206352_10787252 | 3300020078 | Bacteria | 643 |
| 138 | Ga0206350_10232437 | 3300020080 | Bacteria | 689 |
| 139 | Ga0206350_10930760 | 3300020080 | Bacteria | 1054 |
| 140 | Ga0206354_10556497 | 3300020081 | Bacteria | 640 |
| 141 | Ga0206353_11100348 | 3300020082 | Bacteria | 1993 |
| 142 | Ga0213873_10098007 | 3300021358 | Bacteria | 840 |
| 143 | Ga0213874_10005357 | 3300021377 | Bacteria | 2984 |
| 144 | Ga0213876_10033441 | 3300021384 | Bacteria | 2712 |
| 145 | Ga0213876_10061687 | 3300021384 | Bacteria | 1979 |
| 146 | Ga0213876_10104344 | 3300021384 | Bacteria | 1503 |
| 147 | Ga0213875_10000162 | 3300021388 | Bacteria | 70242 |
| 148 | Ga0213875_10144851 | 3300021388 | Bacteria | 1112 |
| 149 | Ga0213871_10142119 | 3300021441 | Bacteria | 726 |
| 150 | Ga0224712_10249022 | 3300022467 | Bacteria | 820 |
| 151 | Ga0224712_10268381 | 3300022467 | Bacteria | 792 |
| 152 | Ga0224712_10296767 | 3300022467 | Bacteria | 755 |
| 153 | Ga0224712_10305625 | 3300022467 | Bacteria | 745 |
| 154 | Ga0207656_10257279 | 3300025321 | Bacteria | 857 |
| 155 | Ga0207692_10027484 | 3300025898 | Bacteria | 2681 |
| 156 | Ga0207692_10131359 | 3300025898 | Bacteria | 1415 |
| 157 | Ga0207710_10036289 | 3300025900 | Bacteria | 2172 |
| 158 | Ga0207688_10000691 | 3300025901 | Bacteria | 16661 |
| 159 | Ga0207643_10505051 | 3300025908 | Bacteria | 773 |
| 160 | Ga0207654_10106983 | 3300025911 | Bacteria | 1733 |
| 161 | Ga0207671_10442286 | 3300025914 | Bacteria | 1035 |
| 162 | Ga0207693_10087721 | 3300025915 | Bacteria | 2438 |
| 163 | Ga0207693_10115665 | 3300025915 | Bacteria | 2106 |
| 164 | Ga0207663_10445797 | 3300025916 | Bacteria | 998 |
| 165 | Ga0207662_10022248 | 3300025918 | Bacteria | 3632 |
| 166 | Ga0207649_10183095 | 3300025920 | Bacteria | 1467 |
| 167 | Ga0207649_10411639 | 3300025920 | Bacteria | 1014 |
| 168 | Ga0207681_10200836 | 3300025923 | Bacteria | 1531 |
| 169 | Ga0207694_10358685 | 3300025924 | Bacteria | 1208 |
| 170 | Ga0207659_10039209 | 3300025926 | Bacteria | 3302 |
| 171 | Ga0207687_10115784 | 3300025927 | Bacteria | 1997 |
| 172 | Ga0207644_10031153 | 3300025931 | Bacteria | 3714 |
| 173 | Ga0207690_10103594 | 3300025932 | Bacteria | 2037 |
| 174 | Ga0207709_10174895 | 3300025935 | Bacteria | 1510 |
| 175 | Ga0207670_10055159 | 3300025936 | Bacteria | 2684 |
| 176 | Ga0207670_10415608 | 3300025936 | Bacteria | 1078 |
| 177 | Ga0207704_10201782 | 3300025938 | Bacteria | 1456 |
| 178 | Ga0207691_10116589 | 3300025940 | Bacteria | 2370 |
| 179 | Ga0207711_10044758 | 3300025941 | Bacteria | 3780 |
| 180 | Ga0207711_10345092 | 3300025941 | Bacteria | 1378 |
| 181 | Ga0207689_10040643 | 3300025942 | Bacteria | 3849 |
| 182 | Ga0207661_10056730 | 3300025944 | Bacteria | 3145 |
| 183 | Ga0207679_10066260 | 3300025945 | Bacteria | 2705 |
| 184 | Ga0207679_10222259 | 3300025945 | Bacteria | 1589 |
| 185 | Ga0207667_10220780 | 3300025949 | Bacteria | 1942 |
| 186 | Ga0207651_10587339 | 3300025960 | Bacteria | 972 |
| 187 | Ga0207712_10139704 | 3300025961 | Bacteria | 1857 |
| 188 | Ga0207712_10408255 | 3300025961 | Bacteria | 1143 |
| 189 | Ga0207668_10134242 | 3300025972 | Bacteria | 1894 |
| 190 | Ga0207640_10022533 | 3300025981 | Bacteria | 3772 |
| 191 | Ga0207658_10276101 | 3300025986 | Bacteria | 1439 |
| 192 | Ga0207677_10072034 | 3300026023 | Bacteria | 2441 |
| 193 | Ga0207677_10138798 | 3300026023 | Bacteria | 1858 |
| 194 | Ga0207703_10220562 | 3300026035 | Bacteria | 1695 |
| 195 | Ga0207639_10223377 | 3300026041 | Bacteria | 1628 |
| 196 | Ga0207678_10132141 | 3300026067 | Bacteria | 2130 |
| 197 | Ga0207678_10888784 | 3300026067 | Bacteria | 788 |
| 198 | Ga0207708_10001612 | 3300026075 | Bacteria | 16825 |
| 199 | Ga0207708_10263191 | 3300026075 | Bacteria | 1392 |
| 200 | Ga0207708_10675620 | 3300026075 | Bacteria | 881 |
| 201 | Ga0207702_10059280 | 3300026078 | Bacteria | 3260 |
| 202 | Ga0207641_10058565 | 3300026088 | Bacteria | 3279 |
| 203 | Ga0207641_10784948 | 3300026088 | Bacteria | 942 |
| 204 | Ga0207676_10018388 | 3300026095 | Bacteria | 5080 |
| 205 | Ga0207676_10228435 | 3300026095 | Bacteria | 1662 |
| 206 | Ga0207675_100090959 | 3300026118 | Bacteria | 2869 |
| 207 | Ga0207675_100358725 | 3300026118 | Bacteria | 1430 |
| 208 | Ga0207683_10082155 | 3300026121 | Bacteria | 2862 |
| 209 | Ga0207683_10591088 | 3300026121 | Bacteria | 1027 |
| 210 | Ga0207698_10616729 | 3300026142 | Bacteria | 1071 |
| 211 | Ga0268265_10771924 | 3300028380 | Bacteria | 934 |
| 212 | Ga0268264_10083696 | 3300028381 | Bacteria | 2733 |
| 213 | Ga0265338_10041822 | 3300028800 | Bacteria | 4280 |
| 214 | Ga0265327_10069655 | 3300031251 | Bacteria | 1765 |
| 215 | Ga0307416_100263380 | 3300032002 | Bacteria | 1687 |
| 216 | Ga0395898_0317295 | 3300037466 | Bacteria | 1487 |
| 217 | Ga0436364_0371929 | 3300037853 | Bacteria | 748 |
| 218 | Ga0436364_0677417 | 3300037853 | Unclassified | 642 |
| 219 | Ga0436364_1082254 | 3300037853 | Bacteria | 49536 |
| 220 | Ga0395901_0459229 | 3300038443 | Bacteria | 1302 |
| 221 | Ga0436365_0806053 | 3300039437 | Bacteria | 1886 |
| 222 | Ga0436365_1826901 | 3300039437 | Bacteria | 15104 |
| 223 | Ga0436360_0073412 | 3300039438 | Bacteria | 2057 |
| 224 | Ga0436361_0959489 | 3300039447 | Bacteria | 1007 |
| 225 | Ga0436363_0964342 | 3300039450 | Bacteria | 2441 |
| 226 | Ga0436363_0983494 | 3300039450 | Bacteria | 1489 |
| 227 | Ga0466969_0126571 | 3300044656 | Bacteria | 1187 |
| 228 | Ga0466965_0148143 | 3300044683 | Bacteria | 1226 |
| 229 | Ga0466966_0033696 | 3300044684 | Bacteria | 3315 |
| 230 | Ga0466966_0107222 | 3300044684 | Bacteria | 1724 |
| 231 | Ga0466966_0272634 | 3300044684 | Bacteria | 1018 |
| 232 | Ga0466963_0821505 | 3300044694 | Archaea | 655 |
| 233 | Ga0466971_0031151 | 3300044719 | Bacteria | 2387 |
| 234 | Ga0466968_0051970 | 3300044735 | Bacteria | 1752 |
| 235 | Ga0466970_0069725 | 3300044765 | Bacteria | 1890 |
| 236 | Ga0466970_0349244 | 3300044765 | Bacteria | 839 |
| 237 | Ga0466957_0317850 | 3300044842 | Unclassified | 1050 |
| 238 | Ga0466960_0000037 | 3300044901 | Bacteria | 43394 |
| 239 | Ga0466960_0030345 | 3300044901 | Bacteria | 2487 |
| 240 | Ga0466960_0030346 | 3300044901 | Bacteria | 2487 |
| 241 | Ga0466960_0505918 | 3300044901 | Bacteria | 708 |
| 242 | Ga0466960_0589159 | 3300044901 | Bacteria | 659 |
| 243 | Ga0466959_0125607 | 3300045049 | Bacteria | 1821 |
| 244 | Ga0466959_0480376 | 3300045049 | Bacteria | 841 |
| 245 | Ga0466958_0024817 | 3300045836 | Bacteria | 3529 |
| 246 | Ga0466958_0061564 | 3300045836 | Bacteria | 2287 |
| 247 | Ga0466958_0352646 | 3300045836 | Bacteria | 947 |
| 248 | Ga0466958_0616482 | 3300045836 | Unclassified | 706 |
| 249 | Ga0466967_0014117 | 3300045976 | Bacteria | 6206 |
| 250 | Ga0466967_0015935 | 3300045976 | Bacteria | 5909 |
| 251 | Ga0466967_0701588 | 3300045976 | Bacteria | 1002 |
| 252 | Ga0466967_0753115 | 3300045976 | Bacteria | 966 |
| 253 | Ga0466967_0814541 | 3300045976 | Bacteria | 927 |
| 254 | Ga0495641_0024028 | 3300046461 | Bacteria | 3015 |
| 255 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 256 | Ga0495596_0072761 | 3300046500 | Bacteria | 1335 |
| 257 | Ga0495609_0267039 | 3300046538 | Bacteria | 702 |
| 258 | Ga0495672_0009472 | 3300047320 | Bacteria | 7054 |
| 259 | Ga0495680_0534650 | 3300047322 | Bacteria | 792 |
| 260 | Ga0495675_0185493 | 3300047444 | Bacteria | 1272 |
| 261 | Ga0496100_0000534 | 3300048903 | Bacteria | 18056 |
| 262 | Ga0496100_0032066 | 3300048903 | Bacteria | 3272 |
| 263 | Ga0496100_0035577 | 3300048903 | Bacteria | 3134 |
| 264 | Ga0496101_0004677 | 3300048904 | Bacteria | 8667 |
| 265 | Ga0496101_0017662 | 3300048904 | Bacteria | 4839 |
| 266 | Ga0496101_0026738 | 3300048904 | Bacteria | 4012 |
| 267 | Ga0496102_0195195 | 3300048905 | Bacteria | 1908 |
| 268 | Ga0496102_0936487 | 3300048905 | Bacteria | 787 |
| 269 | Ga0496103_0018758 | 3300048906 | Bacteria | 4152 |
| 270 | Ga0496104_0000034 | 3300048907 | Bacteria | 186572 |
| 271 | Ga0496104_0023168 | 3300048907 | Bacteria | 5708 |
| 272 | Ga0496104_0217869 | 3300048907 | Bacteria | 1821 |
| 273 | Ga0496105_0018448 | 3300048908 | Bacteria | 5608 |
| 274 | Ga0496105_0268158 | 3300048908 | Bacteria | 1379 |
| 275 | Ga0496105_0373723 | 3300048908 | Bacteria | 1135 |
| 276 | Ga0496106_0175547 | 3300048909 | Bacteria | 1700 |
| 277 | Ga0496106_0231661 | 3300048909 | Bacteria | 1475 |
| 278 | Ga0496107_0208948 | 3300048910 | Bacteria | 1451 |
| 279 | Ga0496108_0013122 | 3300048911 | Bacteria | 6752 |
| 280 | Ga0496108_0016481 | 3300048911 | Bacteria | 6030 |
| 281 | Ga0496108_0196993 | 3300048911 | Bacteria | 1747 |
| 282 | Ga0496108_0377787 | 3300048911 | Bacteria | 1237 |
| 283 | Ga0496109_0052228 | 3300048912 | Bacteria | 3725 |
| 284 | Ga0496109_0094550 | 3300048912 | Bacteria | 2766 |
| 285 | Ga0496109_0326457 | 3300048912 | Bacteria | 1448 |
| 286 | Ga0496110_0004422 | 3300048913 | Bacteria | 10888 |
| 287 | Ga0496110_0320844 | 3300048913 | Bacteria | 1411 |
| 288 | Ga0496110_0386437 | 3300048913 | Bacteria | 1275 |
| 289 | Ga0496110_0559110 | 3300048913 | Bacteria | 1039 |
| 290 | Ga0496111_0000130 | 3300048914 | Bacteria | 33124 |
| 291 | Ga0496111_0001514 | 3300048914 | Bacteria | 13331 |
| 292 | Ga0496111_0016010 | 3300048914 | Bacteria | 5161 |
| 293 | Ga0496111_0043364 | 3300048914 | Bacteria | 3233 |
| 294 | Ga0496112_0018506 | 3300048915 | Bacteria | 6559 |
| 295 | Ga0496112_0074364 | 3300048915 | Bacteria | 3359 |
| 296 | Ga0496112_0151829 | 3300048915 | Bacteria | 2283 |
| 297 | Ga0496112_0167287 | 3300048915 | Bacteria | 2164 |
| 298 | Ga0496112_0214057 | 3300048915 | Bacteria | 1884 |
| 299 | Ga0496112_0320156 | 3300048915 | Bacteria | 1495 |
| 300 | Ga0496113_0001768 | 3300048916 | Bacteria | 12267 |
| 301 | Ga0496113_0022346 | 3300048916 | Bacteria | 4472 |
| 302 | Ga0496113_0029600 | 3300048916 | Bacteria | 3957 |
| 303 | Ga0496114_0027848 | 3300048917 | Bacteria | 4633 |
| 304 | Ga0496114_0104046 | 3300048917 | Bacteria | 2427 |
| 305 | Ga0496114_0599466 | 3300048917 | Bacteria | 971 |
| 306 | Ga0496115_0704606 | 3300048918 | Bacteria | 793 |
| 307 | Ga0501067_0345825 | 3300049583 | Bacteria | 829 |
| 308 | Ga0501069_0170197 | 3300049585 | Bacteria | 1257 |
| 309 | nmdc:mga00v17_797195_c1 | 3300050491 | Bacteria | 602 |
| 310 | nmdc:mga05p37_1040163_c1 | 3300050507 | Bacteria | 865 |
| 311 | nmdc:mga06r32_534293_c1 | 3300050510 | Bacteria | 1148 |
| 312 | nmdc:mga08y16_123510_c1 | 3300050511 | Bacteria | 2694 |
| 313 | nmdc:mga08y16_1408424_c1 | 3300050511 | Bacteria | 660 |
| 314 | nmdc:mga08y16_7369_c1 | 3300050511 | Bacteria | 11536 |
| 315 | nmdc:mga0n895_540389_c1 | 3300050512 | Bacteria | 1172 |
| 316 | nmdc:mga0rr50_416913_c1 | 3300050513 | Bacteria | 1135 |
| 317 | nmdc:mga08x19_53588_c1 | 3300050514 | Bacteria | 2595 |
| 318 | nmdc:mga0a205_114793_c1 | 3300050515 | Bacteria | 2591 |
| 319 | nmdc:mga0a205_471992_c1 | 3300050515 | Bacteria | 1113 |
| 320 | Ga0466962_0028377 | 3300061719 | Bacteria | 2681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050491 | nmdc:mga00v17_797195_c1 | nmdc:mga00v17_797195_c1_11_514 | 146 |
| 2 | 3300039447 | Ga0436361_0959489 | Ga0436361_0959489_86_586 | 147 |
| 3 | 3300009094 | Ga0111539_10311184 | Ga0111539_103111843 | 149 |
| 4 | 3300009101 | Ga0105247_10114396 | Ga0105247_101143961 | 149 |
| 5 | 3300009174 | Ga0105241_10065281 | Ga0105241_100652812 | 149 |
| 6 | 3300009177 | Ga0105248_10242819 | Ga0105248_102428192 | 149 |
| 7 | 3300009545 | Ga0105237_10267536 | Ga0105237_102675362 | 149 |
| 8 | 3300009551 | Ga0105238_10061275 | Ga0105238_100612755 | 149 |
| 9 | 3300014325 | Ga0163163_10199708 | Ga0163163_101997082 | 149 |
| 10 | 3300014326 | Ga0157380_10123073 | Ga0157380_101230732 | 149 |
| 11 | 3300014968 | Ga0157379_10094710 | Ga0157379_100947102 | 149 |
| 12 | 3300048903 | Ga0496100_0032066 | Ga0496100_0032066_2608_3108 | 149 |
| 13 | 3300048904 | Ga0496101_0026738 | Ga0496101_0026738_1735_2235 | 149 |
| 14 | 3300048905 | Ga0496102_0936487 | Ga0496102_0936487_81_581 | 149 |
| 15 | 3300048908 | Ga0496105_0268158 | Ga0496105_0268158_605_1105 | 149 |
| 16 | 3300048911 | Ga0496108_0016481 | Ga0496108_0016481_1679_2179 | 149 |
| 17 | 3300048912 | Ga0496109_0094550 | Ga0496109_0094550_708_1208 | 149 |
| 18 | 3300048913 | Ga0496110_0386437 | Ga0496110_0386437_630_1130 | 149 |
| 19 | 3300048914 | Ga0496111_0001514 | Ga0496111_0001514_12329_12829 | 149 |
| 20 | 3300048915 | Ga0496112_0151829 | Ga0496112_0151829_470_970 | 149 |
| 21 | 3300048916 | Ga0496113_0001768 | Ga0496113_0001768_2083_2583 | 149 |
| 22 | 3300048917 | Ga0496114_0104046 | Ga0496114_0104046_1878_2378 | 149 |
| 23 | 3300048918 | Ga0496115_0704606 | Ga0496115_0704606_97_597 | 149 |
| 24 | 3300050511 | nmdc:mga08y16_123510_c1 | nmdc:mga08y16_123510_c1_408_908 | 149 |
| 25 | 3300013308 | Ga0157375_10854420 | Ga0157375_108544202 | 151 |
| 26 | 3300044901 | Ga0466960_0030345 | Ga0466960_0030345_1832_2350 | 152 |
| 27 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_67695_68207 | 152 |
| 28 | 3300048915 | Ga0496112_0074364 | Ga0496112_0074364_1346_1873 | 152 |
| 29 | 3300048916 | Ga0496113_0029600 | Ga0496113_0029600_1761_2288 | 152 |
| 30 | 3300050507 | nmdc:mga05p37_1040163_c1 | nmdc:mga05p37_1040163_c1_40_564 | 153 |
| 31 | 3300039437 | Ga0436365_1826901 | Ga0436365_1826901_10531_11094 | 168 |
| 32 | 3300039438 | Ga0436360_0073412 | Ga0436360_0073412_941_1516 | 168 |
| 33 | 3300039450 | Ga0436363_0983494 | Ga0436363_0983494_424_987 | 168 |
| 34 | 3300044656 | Ga0466969_0126571 | Ga0466969_0126571_221_784 | 168 |
| 35 | 3300044683 | Ga0466965_0148143 | Ga0466965_0148143_80_652 | 168 |
| 36 | 3300044684 | Ga0466966_0033696 | Ga0466966_0033696_1491_2066 | 168 |
| 37 | 3300044719 | Ga0466971_0031151 | Ga0466971_0031151_655_1224 | 168 |
| 38 | 3300045836 | Ga0466958_0061564 | Ga0466958_0061564_1280_1849 | 168 |
| 39 | 3300045836 | Ga0466958_0616482 | Ga0466958_0616482_70_642 | 168 |
| 40 | 3300061719 | Ga0466962_0028377 | Ga0466962_0028377_1013_1582 | 168 |
| 41 | 3300006038 | Ga0075365_10528561 | Ga0075365_105285611 | 169 |
| 42 | 3300020069 | Ga0197907_11391826 | Ga0197907_113918262 | 171 |
| 43 | 3300044684 | Ga0466966_0107222 | Ga0466966_0107222_581_1156 | 171 |
| 44 | 3300005434 | Ga0070709_10359459 | Ga0070709_103594591 | 172 |
| 45 | 3300005435 | Ga0070714_100966734 | Ga0070714_1009667341 | 172 |
| 46 | 3300006175 | Ga0070712_100294285 | Ga0070712_1002942851 | 172 |
| 47 | 3300006846 | Ga0075430_100670679 | Ga0075430_1006706792 | 172 |
| 48 | 3300009147 | Ga0114129_11985524 | Ga0114129_119855241 | 172 |
| 49 | 3300011119 | Ga0105246_10028909 | Ga0105246_100289092 | 172 |
| 50 | 3300021377 | Ga0213874_10005357 | Ga0213874_100053575 | 172 |
| 51 | 3300021384 | Ga0213876_10033441 | Ga0213876_100334413 | 172 |
| 52 | 3300021384 | Ga0213876_10061687 | Ga0213876_100616873 | 172 |
| 53 | 3300021384 | Ga0213876_10104344 | Ga0213876_101043443 | 172 |
| 54 | 3300021388 | Ga0213875_10000162 | Ga0213875_1000016256 | 172 |
| 55 | 3300021388 | Ga0213875_10144851 | Ga0213875_101448512 | 172 |
| 56 | 3300021441 | Ga0213871_10142119 | Ga0213871_101421191 | 172 |
| 57 | 3300025916 | Ga0207663_10445797 | Ga0207663_104457971 | 172 |
| 58 | 3300032002 | Ga0307416_100263380 | Ga0307416_1002633802 | 172 |
| 59 | 3300037853 | Ga0436364_0677417 | Ga0436364_0677417_11_595 | 172 |
| 60 | 3300037853 | Ga0436364_1082254 | Ga0436364_1082254_2988_3563 | 172 |
| 61 | 3300039450 | Ga0436363_0964342 | Ga0436363_0964342_1475_2050 | 172 |
| 62 | 3300044684 | Ga0466966_0272634 | Ga0466966_0272634_392_967 | 172 |
| 63 | 3300044694 | Ga0466963_0821505 | Ga0466963_0821505_45_620 | 172 |
| 64 | 3300044735 | Ga0466968_0051970 | Ga0466968_0051970_14_595 | 172 |
| 65 | 3300044765 | Ga0466970_0349244 | Ga0466970_0349244_116_691 | 172 |
| 66 | 3300044842 | Ga0466957_0317850 | Ga0466957_0317850_330_905 | 172 |
| 67 | 3300045836 | Ga0466958_0024817 | Ga0466958_0024817_1289_1864 | 172 |
| 68 | 3300045836 | Ga0466958_0352646 | Ga0466958_0352646_129_704 | 172 |
| 69 | 3300045976 | Ga0466967_0814541 | Ga0466967_0814541_198_773 | 172 |
| 70 | 3300047322 | Ga0495680_0534650 | Ga0495680_0534650_81_668 | 172 |
| 71 | 3300005339 | Ga0070660_100001954 | Ga0070660_1000019545 | 173 |
| 72 | 3300005347 | Ga0070668_100502385 | Ga0070668_1005023852 | 173 |
| 73 | 3300005347 | Ga0070668_100650826 | Ga0070668_1006508261 | 173 |
| 74 | 3300005457 | Ga0070662_100770200 | Ga0070662_1007702002 | 173 |
| 75 | 3300005518 | Ga0070699_100330478 | Ga0070699_1003304782 | 173 |
| 76 | 3300005549 | Ga0070704_100624341 | Ga0070704_1006243412 | 173 |
| 77 | 3300005615 | Ga0070702_100222463 | Ga0070702_1002224631 | 173 |
| 78 | 3300005719 | Ga0068861_100298200 | Ga0068861_1002982002 | 173 |
| 79 | 3300006881 | Ga0068865_100353917 | Ga0068865_1003539171 | 173 |
| 80 | 3300009094 | Ga0111539_10703964 | Ga0111539_107039642 | 173 |
| 81 | 3300009098 | Ga0105245_10594879 | Ga0105245_105948792 | 173 |
| 82 | 3300009553 | Ga0105249_10347929 | Ga0105249_103479292 | 173 |
| 83 | 3300010375 | Ga0105239_10513975 | Ga0105239_105139753 | 173 |
| 84 | 3300013307 | Ga0157372_10060443 | Ga0157372_100604435 | 173 |
| 85 | 3300014325 | Ga0163163_10515557 | Ga0163163_105155572 | 173 |
| 86 | 3300020069 | Ga0197907_11436359 | Ga0197907_114363592 | 173 |
| 87 | 3300021358 | Ga0213873_10098007 | Ga0213873_100980071 | 173 |
| 88 | 3300022467 | Ga0224712_10249022 | Ga0224712_102490221 | 173 |
| 89 | 3300022467 | Ga0224712_10296767 | Ga0224712_102967671 | 173 |
| 90 | 3300022467 | Ga0224712_10305625 | Ga0224712_103056251 | 173 |
| 91 | 3300025927 | Ga0207687_10115784 | Ga0207687_101157842 | 173 |
| 92 | 3300026023 | Ga0207677_10138798 | Ga0207677_101387982 | 173 |
| 93 | 3300026095 | Ga0207676_10228435 | Ga0207676_102284352 | 173 |
| 94 | 3300026118 | Ga0207675_100358725 | Ga0207675_1003587252 | 173 |
| 95 | 3300037853 | Ga0436364_0371929 | Ga0436364_0371929_14_601 | 173 |
| 96 | 3300039437 | Ga0436365_0806053 | Ga0436365_0806053_642_1229 | 173 |
| 97 | 3300044765 | Ga0466970_0069725 | Ga0466970_0069725_1151_1735 | 173 |
| 98 | 3300044901 | Ga0466960_0505918 | Ga0466960_0505918_44_616 | 173 |
| 99 | 3300044901 | Ga0466960_0589159 | Ga0466960_0589159_26_598 | 173 |
| 100 | 3300045049 | Ga0466959_0125607 | Ga0466959_0125607_951_1535 | 173 |
| 101 | 3300046461 | Ga0495641_0024028 | Ga0495641_0024028_105_692 | 173 |
| 102 | 3300046500 | Ga0495596_0072761 | Ga0495596_0072761_16_597 | 173 |
| 103 | 3300046538 | Ga0495609_0267039 | Ga0495609_0267039_38_610 | 173 |
| 104 | 3300048903 | Ga0496100_0035577 | Ga0496100_0035577_1440_2012 | 173 |
| 105 | 3300048905 | Ga0496102_0195195 | Ga0496102_0195195_662_1234 | 173 |
| 106 | 3300048907 | Ga0496104_0217869 | Ga0496104_0217869_391_963 | 173 |
| 107 | 3300048908 | Ga0496105_0373723 | Ga0496105_0373723_321_893 | 173 |
| 108 | 3300048909 | Ga0496106_0231661 | Ga0496106_0231661_672_1244 | 173 |
| 109 | 3300048910 | Ga0496107_0208948 | Ga0496107_0208948_589_1161 | 173 |
| 110 | 3300048911 | Ga0496108_0196993 | Ga0496108_0196993_495_1067 | 173 |
| 111 | 3300048911 | Ga0496108_0377787 | Ga0496108_0377787_72_647 | 173 |
| 112 | 3300048912 | Ga0496109_0052228 | Ga0496109_0052228_731_1306 | 173 |
| 113 | 3300048912 | Ga0496109_0326457 | Ga0496109_0326457_382_954 | 173 |
| 114 | 3300048913 | Ga0496110_0559110 | Ga0496110_0559110_99_671 | 173 |
| 115 | 3300048915 | Ga0496112_0018506 | Ga0496112_0018506_1223_1795 | 173 |
| 116 | 3300048915 | Ga0496112_0320156 | Ga0496112_0320156_458_1033 | 173 |
| 117 | 3300048917 | Ga0496114_0599466 | Ga0496114_0599466_100_672 | 173 |
| 118 | 3300049583 | Ga0501067_0345825 | Ga0501067_0345825_198_785 | 173 |
| 119 | 3300049585 | Ga0501069_0170197 | Ga0501069_0170197_229_816 | 173 |
| 120 | 3300050511 | nmdc:mga08y16_1408424_c1 | nmdc:mga08y16_1408424_c1_26_598 | 173 |
| 121 | 3300050513 | nmdc:mga0rr50_416913_c1 | nmdc:mga0rr50_416913_c1_77_649 | 173 |
| 122 | 3300005337 | Ga0070682_100637545 | Ga0070682_1006375451 | 174 |
| 123 | 3300005338 | Ga0068868_100342599 | Ga0068868_1003425992 | 174 |
| 124 | 3300005338 | Ga0068868_100347383 | Ga0068868_1003473831 | 174 |
| 125 | 3300005340 | Ga0070689_100468488 | Ga0070689_1004684882 | 174 |
| 126 | 3300005343 | Ga0070687_100570522 | Ga0070687_1005705221 | 174 |
| 127 | 3300005345 | Ga0070692_10042830 | Ga0070692_100428301 | 174 |
| 128 | 3300005353 | Ga0070669_100178713 | Ga0070669_1001787132 | 174 |
| 129 | 3300005353 | Ga0070669_100347813 | Ga0070669_1003478132 | 174 |
| 130 | 3300005355 | Ga0070671_100079596 | Ga0070671_1000795965 | 174 |
| 131 | 3300005356 | Ga0070674_100015075 | Ga0070674_1000150755 | 174 |
| 132 | 3300005365 | Ga0070688_100273207 | Ga0070688_1002732071 | 174 |
| 133 | 3300005366 | Ga0070659_100309620 | Ga0070659_1003096202 | 174 |
| 134 | 3300005367 | Ga0070667_100456557 | Ga0070667_1004565572 | 174 |
| 135 | 3300005440 | Ga0070705_100296966 | Ga0070705_1002969662 | 174 |
| 136 | 3300005441 | Ga0070700_100059370 | Ga0070700_1000593702 | 174 |
| 137 | 3300005444 | Ga0070694_100093786 | Ga0070694_1000937862 | 174 |
| 138 | 3300005466 | Ga0070685_10008908 | Ga0070685_100089081 | 174 |
| 139 | 3300005543 | Ga0070672_100530533 | Ga0070672_1005305332 | 174 |
| 140 | 3300005544 | Ga0070686_100234233 | Ga0070686_1002342333 | 174 |
| 141 | 3300005545 | Ga0070695_100132932 | Ga0070695_1001329322 | 174 |
| 142 | 3300005549 | Ga0070704_100190405 | Ga0070704_1001904052 | 174 |
| 143 | 3300005564 | Ga0070664_100104333 | Ga0070664_1001043333 | 174 |
| 144 | 3300005615 | Ga0070702_100012747 | Ga0070702_1000127471 | 174 |
| 145 | 3300005616 | Ga0068852_100199330 | Ga0068852_1001993301 | 174 |
| 146 | 3300005617 | Ga0068859_100384755 | Ga0068859_1003847553 | 174 |
| 147 | 3300005618 | Ga0068864_100438158 | Ga0068864_1004381582 | 174 |
| 148 | 3300005618 | Ga0068864_100945624 | Ga0068864_1009456241 | 174 |
| 149 | 3300005719 | Ga0068861_101003770 | Ga0068861_1010037702 | 174 |
| 150 | 3300005834 | Ga0068851_10457119 | Ga0068851_104571191 | 174 |
| 151 | 3300005840 | Ga0068870_10031267 | Ga0068870_100312674 | 174 |
| 152 | 3300005841 | Ga0068863_100709363 | Ga0068863_1007093631 | 174 |
| 153 | 3300005842 | Ga0068858_100189081 | Ga0068858_1001890813 | 174 |
| 154 | 3300005843 | Ga0068860_100629693 | Ga0068860_1006296931 | 174 |
| 155 | 3300006048 | Ga0075363_100322492 | Ga0075363_1003224922 | 174 |
| 156 | 3300006173 | Ga0070716_100182942 | Ga0070716_1001829422 | 174 |
| 157 | 3300006175 | Ga0070712_100022048 | Ga0070712_1000220482 | 174 |
| 158 | 3300006871 | Ga0075434_100162684 | Ga0075434_1001626841 | 174 |
| 159 | 3300006931 | Ga0097620_100384743 | Ga0097620_1003847433 | 174 |
| 160 | 3300009098 | Ga0105245_10677557 | Ga0105245_106775572 | 174 |
| 161 | 3300009553 | Ga0105249_10290010 | Ga0105249_102900101 | 174 |
| 162 | 3300009553 | Ga0105249_10616208 | Ga0105249_106162082 | 174 |
| 163 | 3300013308 | Ga0157375_10892338 | Ga0157375_108923382 | 174 |
| 164 | 3300014745 | Ga0157377_10203658 | Ga0157377_102036581 | 174 |
| 165 | 3300017792 | Ga0163161_10206753 | Ga0163161_102067532 | 174 |
| 166 | 3300020069 | Ga0197907_10337718 | Ga0197907_103377181 | 174 |
| 167 | 3300020078 | Ga0206352_10753119 | Ga0206352_107531191 | 174 |
| 168 | 3300020080 | Ga0206350_10930760 | Ga0206350_109307602 | 174 |
| 169 | 3300022467 | Ga0224712_10268381 | Ga0224712_102683811 | 174 |
| 170 | 3300025898 | Ga0207692_10027484 | Ga0207692_100274844 | 174 |
| 171 | 3300025900 | Ga0207710_10036289 | Ga0207710_100362893 | 174 |
| 172 | 3300025908 | Ga0207643_10505051 | Ga0207643_105050511 | 174 |
| 173 | 3300025914 | Ga0207671_10442286 | Ga0207671_104422862 | 174 |
| 174 | 3300025915 | Ga0207693_10087721 | Ga0207693_100877213 | 174 |
| 175 | 3300025918 | Ga0207662_10022248 | Ga0207662_100222483 | 174 |
| 176 | 3300025920 | Ga0207649_10411639 | Ga0207649_104116391 | 174 |
| 177 | 3300025923 | Ga0207681_10200836 | Ga0207681_102008362 | 174 |
| 178 | 3300025924 | Ga0207694_10358685 | Ga0207694_103586851 | 174 |
| 179 | 3300025932 | Ga0207690_10103594 | Ga0207690_101035943 | 174 |
| 180 | 3300025935 | Ga0207709_10174895 | Ga0207709_101748953 | 174 |
| 181 | 3300025936 | Ga0207670_10055159 | Ga0207670_100551591 | 174 |
| 182 | 3300025938 | Ga0207704_10201782 | Ga0207704_102017821 | 174 |
| 183 | 3300025940 | Ga0207691_10116589 | Ga0207691_101165892 | 174 |
| 184 | 3300025941 | Ga0207711_10345092 | Ga0207711_103450921 | 174 |
| 185 | 3300025945 | Ga0207679_10222259 | Ga0207679_102222592 | 174 |
| 186 | 3300025961 | Ga0207712_10139704 | Ga0207712_101397043 | 174 |
| 187 | 3300025961 | Ga0207712_10408255 | Ga0207712_104082552 | 174 |
| 188 | 3300025972 | Ga0207668_10134242 | Ga0207668_101342423 | 174 |
| 189 | 3300025986 | Ga0207658_10276101 | Ga0207658_102761011 | 174 |
| 190 | 3300026035 | Ga0207703_10220562 | Ga0207703_102205622 | 174 |
| 191 | 3300026041 | Ga0207639_10223377 | Ga0207639_102233772 | 174 |
| 192 | 3300026067 | Ga0207678_10888784 | Ga0207678_108887841 | 174 |
| 193 | 3300026075 | Ga0207708_10263191 | Ga0207708_102631912 | 174 |
| 194 | 3300026075 | Ga0207708_10675620 | Ga0207708_106756201 | 174 |
| 195 | 3300026088 | Ga0207641_10784948 | Ga0207641_107849481 | 174 |
| 196 | 3300026118 | Ga0207675_100090959 | Ga0207675_1000909594 | 174 |
| 197 | 3300026121 | Ga0207683_10591088 | Ga0207683_105910881 | 174 |
| 198 | 3300026142 | Ga0207698_10616729 | Ga0207698_106167291 | 174 |
| 199 | 3300028380 | Ga0268265_10771924 | Ga0268265_107719241 | 174 |
| 200 | 3300028381 | Ga0268264_10083696 | Ga0268264_100836961 | 174 |
| 201 | 3300028800 | Ga0265338_10041822 | Ga0265338_100418224 | 174 |
| 202 | 3300044901 | Ga0466960_0000037 | Ga0466960_0000037_40302_40880 | 174 |
| 203 | 3300045049 | Ga0466959_0480376 | Ga0466959_0480376_17_595 | 174 |
| 204 | 3300045976 | Ga0466967_0014117 | Ga0466967_0014117_2279_2854 | 174 |
| 205 | 3300045976 | Ga0466967_0015935 | Ga0466967_0015935_637_1212 | 174 |
| 206 | 3300045976 | Ga0466967_0701588 | Ga0466967_0701588_13_588 | 174 |
| 207 | 3300047320 | Ga0495672_0009472 | Ga0495672_0009472_6292_6873 | 174 |
| 208 | 3300048903 | Ga0496100_0000534 | Ga0496100_0000534_4242_4835 | 174 |
| 209 | 3300048904 | Ga0496101_0004677 | Ga0496101_0004677_79_672 | 174 |
| 210 | 3300048907 | Ga0496104_0000034 | Ga0496104_0000034_60069_60647 | 174 |
| 211 | 3300048909 | Ga0496106_0175547 | Ga0496106_0175547_920_1495 | 174 |
| 212 | 3300048913 | Ga0496110_0004422 | Ga0496110_0004422_1980_2558 | 174 |
| 213 | 3300048913 | Ga0496110_0320844 | Ga0496110_0320844_532_1125 | 174 |
| 214 | 3300048914 | Ga0496111_0000130 | Ga0496111_0000130_23224_23802 | 174 |
| 215 | 3300048914 | Ga0496111_0043364 | Ga0496111_0043364_463_1056 | 174 |
| 216 | 3300048915 | Ga0496112_0214057 | Ga0496112_0214057_470_1045 | 174 |
| 217 | 3300005329 | Ga0070683_100000645 | Ga0070683_1000006457 | 175 |
| 218 | 3300005334 | Ga0068869_100013296 | Ga0068869_1000132967 | 175 |
| 219 | 3300005337 | Ga0070682_100007928 | Ga0070682_1000079285 | 175 |
| 220 | 3300005338 | Ga0068868_100022502 | Ga0068868_1000225021 | 175 |
| 221 | 3300005340 | Ga0070689_100032679 | Ga0070689_1000326795 | 175 |
| 222 | 3300005344 | Ga0070661_100144755 | Ga0070661_1001447553 | 175 |
| 223 | 3300005364 | Ga0070673_100031260 | Ga0070673_1000312602 | 175 |
| 224 | 3300005365 | Ga0070688_100783309 | Ga0070688_1007833091 | 175 |
| 225 | 3300005366 | Ga0070659_100061599 | Ga0070659_1000615993 | 175 |
| 226 | 3300005437 | Ga0070710_10181272 | Ga0070710_101812721 | 175 |
| 227 | 3300005440 | Ga0070705_100456976 | Ga0070705_1004569762 | 175 |
| 228 | 3300005441 | Ga0070700_100008738 | Ga0070700_1000087384 | 175 |
| 229 | 3300005456 | Ga0070678_100016305 | Ga0070678_1000163053 | 175 |
| 230 | 3300005457 | Ga0070662_100036848 | Ga0070662_1000368482 | 175 |
| 231 | 3300005466 | Ga0070685_10019794 | Ga0070685_100197945 | 175 |
| 232 | 3300005535 | Ga0070684_100003617 | Ga0070684_1000036175 | 175 |
| 233 | 3300005548 | Ga0070665_100109040 | Ga0070665_1001090402 | 175 |
| 234 | 3300005549 | Ga0070704_100035306 | Ga0070704_1000353062 | 175 |
| 235 | 3300005563 | Ga0068855_100651697 | Ga0068855_1006516972 | 175 |
| 236 | 3300005564 | Ga0070664_100003373 | Ga0070664_10000337311 | 175 |
| 237 | 3300005578 | Ga0068854_100041065 | Ga0068854_1000410652 | 175 |
| 238 | 3300005614 | Ga0068856_100005907 | Ga0068856_1000059078 | 175 |
| 239 | 3300005834 | Ga0068851_10284688 | Ga0068851_102846881 | 175 |
| 240 | 3300006058 | Ga0075432_10045578 | Ga0075432_100455782 | 175 |
| 241 | 3300006175 | Ga0070712_100183845 | Ga0070712_1001838453 | 175 |
| 242 | 3300006847 | Ga0075431_100033246 | Ga0075431_1000332467 | 175 |
| 243 | 3300006871 | Ga0075434_100023596 | Ga0075434_1000235965 | 175 |
| 244 | 3300006881 | Ga0068865_100052661 | Ga0068865_1000526614 | 175 |
| 245 | 3300006914 | Ga0075436_100234023 | Ga0075436_1002340232 | 175 |
| 246 | 3300007076 | Ga0075435_100041548 | Ga0075435_1000415485 | 175 |
| 247 | 3300009094 | Ga0111539_10009419 | Ga0111539_1000941911 | 175 |
| 248 | 3300009094 | Ga0111539_10248830 | Ga0111539_102488303 | 175 |
| 249 | 3300009098 | Ga0105245_10004181 | Ga0105245_100041817 | 175 |
| 250 | 3300009148 | Ga0105243_10017175 | Ga0105243_100171753 | 175 |
| 251 | 3300009176 | Ga0105242_10110455 | Ga0105242_101104553 | 175 |
| 252 | 3300009177 | Ga0105248_10087752 | Ga0105248_100877523 | 175 |
| 253 | 3300009553 | Ga0105249_10058789 | Ga0105249_100587893 | 175 |
| 254 | 3300010375 | Ga0105239_10051102 | Ga0105239_100511023 | 175 |
| 255 | 3300011119 | Ga0105246_10007691 | Ga0105246_100076915 | 175 |
| 256 | 3300013296 | Ga0157374_10007098 | Ga0157374_100070988 | 175 |
| 257 | 3300013297 | Ga0157378_11640122 | Ga0157378_116401221 | 175 |
| 258 | 3300013306 | Ga0163162_10186192 | Ga0163162_101861924 | 175 |
| 259 | 3300013307 | Ga0157372_10012336 | Ga0157372_100123365 | 175 |
| 260 | 3300013308 | Ga0157375_10017301 | Ga0157375_100173015 | 175 |
| 261 | 3300014325 | Ga0163163_10043652 | Ga0163163_100436522 | 175 |
| 262 | 3300014326 | Ga0157380_10057796 | Ga0157380_100577964 | 175 |
| 263 | 3300014745 | Ga0157377_10000822 | Ga0157377_100008226 | 175 |
| 264 | 3300020070 | Ga0206356_11760707 | Ga0206356_117607072 | 175 |
| 265 | 3300020078 | Ga0206352_10787252 | Ga0206352_107872521 | 175 |
| 266 | 3300020080 | Ga0206350_10232437 | Ga0206350_102324371 | 175 |
| 267 | 3300020081 | Ga0206354_10556497 | Ga0206354_105564971 | 175 |
| 268 | 3300025321 | Ga0207656_10257279 | Ga0207656_102572791 | 175 |
| 269 | 3300025898 | Ga0207692_10131359 | Ga0207692_101313592 | 175 |
| 270 | 3300025901 | Ga0207688_10000691 | Ga0207688_100006918 | 175 |
| 271 | 3300025915 | Ga0207693_10115665 | Ga0207693_101156651 | 175 |
| 272 | 3300025920 | Ga0207649_10183095 | Ga0207649_101830951 | 175 |
| 273 | 3300025926 | Ga0207659_10039209 | Ga0207659_100392094 | 175 |
| 274 | 3300025931 | Ga0207644_10031153 | Ga0207644_100311534 | 175 |
| 275 | 3300025936 | Ga0207670_10415608 | Ga0207670_104156082 | 175 |
| 276 | 3300025941 | Ga0207711_10044758 | Ga0207711_100447584 | 175 |
| 277 | 3300025942 | Ga0207689_10040643 | Ga0207689_100406432 | 175 |
| 278 | 3300025944 | Ga0207661_10056730 | Ga0207661_100567302 | 175 |
| 279 | 3300025945 | Ga0207679_10066260 | Ga0207679_100662603 | 175 |
| 280 | 3300025949 | Ga0207667_10220780 | Ga0207667_102207801 | 175 |
| 281 | 3300025960 | Ga0207651_10587339 | Ga0207651_105873392 | 175 |
| 282 | 3300025981 | Ga0207640_10022533 | Ga0207640_100225334 | 175 |
| 283 | 3300026023 | Ga0207677_10072034 | Ga0207677_100720343 | 175 |
| 284 | 3300026075 | Ga0207708_10001612 | Ga0207708_100016124 | 175 |
| 285 | 3300026078 | Ga0207702_10059280 | Ga0207702_100592803 | 175 |
| 286 | 3300026088 | Ga0207641_10058565 | Ga0207641_100585651 | 175 |
| 287 | 3300026095 | Ga0207676_10018388 | Ga0207676_100183885 | 175 |
| 288 | 3300026121 | Ga0207683_10082155 | Ga0207683_100821555 | 175 |
| 289 | 3300037466 | Ga0395898_0317295 | Ga0395898_0317295_366_959 | 175 |
| 290 | 3300038443 | Ga0395901_0459229 | Ga0395901_0459229_167_760 | 175 |
| 291 | 3300047444 | Ga0495675_0185493 | Ga0495675_0185493_283_867 | 175 |
| 292 | 3300048904 | Ga0496101_0017662 | Ga0496101_0017662_2232_2822 | 175 |
| 293 | 3300048906 | Ga0496103_0018758 | Ga0496103_0018758_2608_3198 | 175 |
| 294 | 3300048907 | Ga0496104_0023168 | Ga0496104_0023168_2066_2656 | 175 |
| 295 | 3300048908 | Ga0496105_0018448 | Ga0496105_0018448_3001_3591 | 175 |
| 296 | 3300048911 | Ga0496108_0013122 | Ga0496108_0013122_5074_5664 | 175 |
| 297 | 3300048914 | Ga0496111_0016010 | Ga0496111_0016010_1227_1817 | 175 |
| 298 | 3300048915 | Ga0496112_0167287 | Ga0496112_0167287_1089_1679 | 175 |
| 299 | 3300048916 | Ga0496113_0022346 | Ga0496113_0022346_3181_3771 | 175 |
| 300 | 3300048917 | Ga0496114_0027848 | Ga0496114_0027848_2876_3466 | 175 |
| 301 | 3300050510 | nmdc:mga06r32_534293_c1 | nmdc:mga06r32_534293_c1_262_852 | 175 |
| 302 | 3300050511 | nmdc:mga08y16_7369_c1 | nmdc:mga08y16_7369_c1_10095_10685 | 175 |
| 303 | 3300050512 | nmdc:mga0n895_540389_c1 | nmdc:mga0n895_540389_c1_89_679 | 175 |
| 304 | 3300050514 | nmdc:mga08x19_53588_c1 | nmdc:mga08x19_53588_c1_1190_1780 | 175 |
| 305 | 3300050515 | nmdc:mga0a205_114793_c1 | nmdc:mga0a205_114793_c1_1645_2235 | 175 |
| 306 | 3300050515 | nmdc:mga0a205_471992_c1 | nmdc:mga0a205_471992_c1_464_1054 | 175 |
| 307 | 3300026067 | Ga0207678_10132141 | Ga0207678_101321412 | 177 |
| 308 | 3300005445 | Ga0070708_100423212 | Ga0070708_1004232121 | 178 |
| 309 | 3300009174 | Ga0105241_10157552 | Ga0105241_101575522 | 178 |
| 310 | 3300020078 | Ga0206352_10535192 | Ga0206352_105351921 | 178 |
| 311 | 3300025911 | Ga0207654_10106983 | Ga0207654_101069832 | 178 |
| 312 | 3300031251 | Ga0265327_10069655 | Ga0265327_100696552 | 178 |
| 313 | 3300020082 | Ga0206353_11100348 | Ga0206353_111003483 | 190 |
| 314 | 3300044901 | Ga0466960_0030346 | Ga0466960_0030346_1524_2159 | 190 |
| 315 | 3300045976 | Ga0466967_0753115 | Ga0466967_0753115_46_681 | 190 |
| 316 | 3300006175 | Ga0070712_100259040 | Ga0070712_1002590402 | 193 |
| 317 | 3300020075 | Ga0206349_1457507 | Ga0206349_14575071 | 193 |
| 318 | 3300002074 | JGI24748J21848_1002127 | JGI24748J21848_10021272 | 206 |
| 319 | 3300002239 | JGI24034J26672_10000251 | JGI24034J26672_100002514 | 206 |
| 320 | 3300002244 | JGI24742J22300_10002911 | JGI24742J22300_100029113 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6i2r-assembly1.cif.gz_D | crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara | 0.9462 | 114 | 204 |
| 3gqs-assembly2.cif.gz_B | crystal structure of the fha domain of ct664 protein from chlamydia trachomatis | 0.9452 | 111 | 206 |
| 3poa-assembly1.cif.gz_A | structural and functional analysis of phosphothreonine-dependent fha domain interactions | 0.9377 | 111 | 206 |
| 8p5r-assembly1.cif.gz_H | crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara | 0.9361 | 110 | 204 |
| 3oun-assembly1.cif.gz_A | crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910 | 0.9323 | 111 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O65934_209_307_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9489 | 131 | 202 | 2.60.200.20 |
| 6i2sB01 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9433 | 113 | 204 | 2.60.200.20 |
| af_Q54ST8_470_584_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9416 | 111 | 204 | 2.60.200.20 |
| 3poaA00 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9377 | 111 | 206 | 2.60.200.20 |
| af_Q54PF7_21_118_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.9298 | 128 | 197 | 2.60.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7LKD5-F1-model_v4 | FHA domain-containing protein | 0.9774 | 132 | 197 |
GO:0004252
GO:0006508 GO:0016020 |
| AF-A0A3M1VCJ6-F1-model_v4 | FHA domain-containing protein | 0.9757 | 110 | 205 |
|
| AF-A0A3N5R2H6-F1-model_v4 | FHA domain-containing protein | 0.97 | 111 | 206 |
GO:0016791
|
| AF-A0A7X0LJ64-F1-model_v4 | Putative component of type VI protein secretion system | 0.9699 | 111 | 204 |
|
| AF-A0A7Y4VRF8-F1-model_v4 | SpoIIE family protein phosphatase | 0.9642 | 112 | 205 |
GO:0016791
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar