F405547

General Info

Members Datasets Scaffolds Average Seq Length
320 199 320 191

Family's Representative Sequence

Representative Sequence 3300020075|Ga0206349_1457507|Ga0206349_14575071
Length 231
Sequence MIDTKFQLLEQSRQRQHHERKGTGRMESLTSGTMAGAGSFRCQRCGYVLTLTSLDKLGDCPGCGGRSFARASLFSAAPRPFGGSTGPDTAPTTPPLARIDEEEHEERLTGALDGLERPGEYLLFEEDDEMRCVALTREWTRIGRSLAADVRFDDPTVSRRHALVVRQADGVRVLDDRSLNGVFVNGERVEWRALTDGDEIVVGRYRLRFVSLAEASDMPGSLPSTSPASAM

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 14.37
Rhizosphere 80.62
Stem 0
Stem Tuber 0
Unclassified 4.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1002127 3300002074 Bacteria 2218
2 JGI24034J26672_10000251 3300002239 Bacteria 7093
3 JGI24742J22300_10002911 3300002244 Bacteria 2764
4 Ga0070683_100000645 3300005329 Bacteria 25129
5 Ga0068869_100013296 3300005334 Bacteria 5471
6 Ga0070682_100007928 3300005337 Bacteria 5974
7 Ga0070682_100637545 3300005337 Bacteria 846
8 Ga0068868_100022502 3300005338 Bacteria 4758
9 Ga0068868_100342599 3300005338 Bacteria 1278
10 Ga0068868_100347383 3300005338 Bacteria 1270
11 Ga0070660_100001954 3300005339 Bacteria 14205
12 Ga0070689_100032679 3300005340 Bacteria 3959
13 Ga0070689_100468488 3300005340 Bacteria 1074
14 Ga0070687_100570522 3300005343 Bacteria 773
15 Ga0070661_100144755 3300005344 Bacteria 1793
16 Ga0070692_10042830 3300005345 Bacteria 2326
17 Ga0070668_100502385 3300005347 Bacteria 1050
18 Ga0070668_100650826 3300005347 Bacteria 926
19 Ga0070669_100178713 3300005353 Bacteria 1659
20 Ga0070669_100347813 3300005353 Bacteria 1203
21 Ga0070671_100079596 3300005355 Bacteria 2739
22 Ga0070674_100015075 3300005356 Bacteria 4818
23 Ga0070673_100031260 3300005364 Bacteria 3993
24 Ga0070688_100273207 3300005365 Bacteria 1211
25 Ga0070688_100783309 3300005365 Unclassified 744
26 Ga0070659_100061599 3300005366 Bacteria 2965
27 Ga0070659_100309620 3300005366 Bacteria 1319
28 Ga0070667_100456557 3300005367 Bacteria 1168
29 Ga0070709_10359459 3300005434 Bacteria 1078
30 Ga0070714_100966734 3300005435 Bacteria 828
31 Ga0070710_10181272 3300005437 Bacteria 1319
32 Ga0070705_100296966 3300005440 Bacteria 1156
33 Ga0070705_100456976 3300005440 Bacteria 959
34 Ga0070700_100008738 3300005441 Bacteria 5528
35 Ga0070700_100059370 3300005441 Bacteria 2407
36 Ga0070694_100093786 3300005444 Bacteria 2111
37 Ga0070708_100423212 3300005445 Bacteria 1256
38 Ga0070678_100016305 3300005456 Bacteria 4751
39 Ga0070662_100036848 3300005457 Bacteria 3464
40 Ga0070662_100770200 3300005457 Bacteria 817
41 Ga0070685_10008908 3300005466 Bacteria 5175
42 Ga0070685_10019794 3300005466 Bacteria 3636
43 Ga0070699_100330478 3300005518 Bacteria 1371
44 Ga0070684_100003617 3300005535 Bacteria 11636
45 Ga0070672_100530533 3300005543 Bacteria 1020
46 Ga0070686_100234233 3300005544 Bacteria 1333
47 Ga0070695_100132932 3300005545 Bacteria 1717
48 Ga0070665_100109040 3300005548 Bacteria 2771
49 Ga0070704_100035306 3300005549 Bacteria 3398
50 Ga0070704_100190405 3300005549 Bacteria 1649
51 Ga0070704_100624341 3300005549 Bacteria 949
52 Ga0068855_100651697 3300005563 Bacteria 1131
53 Ga0070664_100003373 3300005564 Bacteria 12904
54 Ga0070664_100104333 3300005564 Bacteria 2468
55 Ga0068854_100041065 3300005578 Bacteria 3267
56 Ga0068856_100005907 3300005614 Bacteria 12057
57 Ga0070702_100012747 3300005615 Bacteria 4226
58 Ga0070702_100222463 3300005615 Bacteria 1263
59 Ga0068852_100199330 3300005616 Bacteria 1893
60 Ga0068859_100384755 3300005617 Bacteria 1498
61 Ga0068864_100438158 3300005618 Bacteria 1248
62 Ga0068864_100945624 3300005618 Bacteria 852
63 Ga0068861_100298200 3300005719 Bacteria 1395
64 Ga0068861_101003770 3300005719 Bacteria 797
65 Ga0068851_10284688 3300005834 Bacteria 946
66 Ga0068851_10457119 3300005834 Bacteria 760
67 Ga0068870_10031267 3300005840 Bacteria 2696
68 Ga0068863_100709363 3300005841 Bacteria 1000
69 Ga0068858_100189081 3300005842 Bacteria 1945
70 Ga0068860_100629693 3300005843 Bacteria 1080
71 Ga0075365_10528561 3300006038 Bacteria 834
72 Ga0075363_100322492 3300006048 Bacteria 899
73 Ga0075432_10045578 3300006058 Bacteria 1539
74 Ga0070716_100182942 3300006173 Bacteria 1378
75 Ga0070712_100022048 3300006175 Bacteria 4191
76 Ga0070712_100183845 3300006175 Bacteria 1631
77 Ga0070712_100259040 3300006175 Bacteria 1393
78 Ga0070712_100294285 3300006175 Bacteria 1312
79 Ga0075430_100670679 3300006846 Bacteria 855
80 Ga0075431_100033246 3300006847 Bacteria 5315
81 Ga0075434_100023596 3300006871 Bacteria 5998
82 Ga0075434_100162684 3300006871 Bacteria 2251
83 Ga0068865_100052661 3300006881 Bacteria 2822
84 Ga0068865_100353917 3300006881 Bacteria 1190
85 Ga0075436_100234023 3300006914 Bacteria 1305
86 Ga0097620_100384743 3300006931 Bacteria 1498
87 Ga0075435_100041548 3300007076 Bacteria 3676
88 Ga0111539_10009419 3300009094 Bacteria 12324
89 Ga0111539_10248830 3300009094 Bacteria 2070
90 Ga0111539_10311184 3300009094 Bacteria 1833
91 Ga0111539_10703964 3300009094 Bacteria 1176
92 Ga0105245_10004181 3300009098 Bacteria 12821
93 Ga0105245_10594879 3300009098 Bacteria 1132
94 Ga0105245_10677557 3300009098 Bacteria 1063
95 Ga0105247_10114396 3300009101 Bacteria 1740
96 Ga0114129_11985524 3300009147 Bacteria 704
97 Ga0105243_10017175 3300009148 Bacteria 5474
98 Ga0105241_10065281 3300009174 Bacteria 2812
99 Ga0105241_10157552 3300009174 Bacteria 1863
100 Ga0105242_10110455 3300009176 Bacteria 2342
101 Ga0105248_10087752 3300009177 Bacteria 3501
102 Ga0105248_10242819 3300009177 Bacteria 2027
103 Ga0105237_10267536 3300009545 Bacteria 1712
104 Ga0105238_10061275 3300009551 Bacteria 3766
105 Ga0105249_10058789 3300009553 Bacteria 3524
106 Ga0105249_10290010 3300009553 Bacteria 1637
107 Ga0105249_10347929 3300009553 Bacteria 1501
108 Ga0105249_10616208 3300009553 Bacteria 1141
109 Ga0105239_10051102 3300010375 Bacteria 4532
110 Ga0105239_10513975 3300010375 Bacteria 1362
111 Ga0105246_10007691 3300011119 Bacteria 6614
112 Ga0105246_10028909 3300011119 Bacteria 3645
113 Ga0157374_10007098 3300013296 Bacteria 9536
114 Ga0157378_11640122 3300013297 Bacteria 689
115 Ga0163162_10186192 3300013306 Bacteria 2203
116 Ga0157372_10012336 3300013307 Bacteria 9107
117 Ga0157372_10060443 3300013307 Bacteria 4240
118 Ga0157375_10017301 3300013308 Bacteria 6503
119 Ga0157375_10854420 3300013308 Bacteria 1056
120 Ga0157375_10892338 3300013308 Bacteria 1033
121 Ga0163163_10043652 3300014325 Bacteria 4396
122 Ga0163163_10199708 3300014325 Bacteria 2048
123 Ga0163163_10515557 3300014325 Bacteria 1258
124 Ga0157380_10057796 3300014326 Bacteria 3090
125 Ga0157380_10123073 3300014326 Bacteria 2200
126 Ga0157377_10000822 3300014745 Bacteria 12885
127 Ga0157377_10203658 3300014745 Bacteria 1258
128 Ga0157379_10094710 3300014968 Bacteria 2679
129 Ga0163161_10206753 3300017792 Bacteria 1515
130 Ga0197907_10337718 3300020069 Bacteria 746
131 Ga0197907_11391826 3300020069 Bacteria 1048
132 Ga0197907_11436359 3300020069 Bacteria 992
133 Ga0206356_11760707 3300020070 Bacteria 925
134 Ga0206349_1457507 3300020075 Bacteria 1072
135 Ga0206352_10535192 3300020078 Bacteria 838
136 Ga0206352_10753119 3300020078 Bacteria 657
137 Ga0206352_10787252 3300020078 Bacteria 643
138 Ga0206350_10232437 3300020080 Bacteria 689
139 Ga0206350_10930760 3300020080 Bacteria 1054
140 Ga0206354_10556497 3300020081 Bacteria 640
141 Ga0206353_11100348 3300020082 Bacteria 1993
142 Ga0213873_10098007 3300021358 Bacteria 840
143 Ga0213874_10005357 3300021377 Bacteria 2984
144 Ga0213876_10033441 3300021384 Bacteria 2712
145 Ga0213876_10061687 3300021384 Bacteria 1979
146 Ga0213876_10104344 3300021384 Bacteria 1503
147 Ga0213875_10000162 3300021388 Bacteria 70242
148 Ga0213875_10144851 3300021388 Bacteria 1112
149 Ga0213871_10142119 3300021441 Bacteria 726
150 Ga0224712_10249022 3300022467 Bacteria 820
151 Ga0224712_10268381 3300022467 Bacteria 792
152 Ga0224712_10296767 3300022467 Bacteria 755
153 Ga0224712_10305625 3300022467 Bacteria 745
154 Ga0207656_10257279 3300025321 Bacteria 857
155 Ga0207692_10027484 3300025898 Bacteria 2681
156 Ga0207692_10131359 3300025898 Bacteria 1415
157 Ga0207710_10036289 3300025900 Bacteria 2172
158 Ga0207688_10000691 3300025901 Bacteria 16661
159 Ga0207643_10505051 3300025908 Bacteria 773
160 Ga0207654_10106983 3300025911 Bacteria 1733
161 Ga0207671_10442286 3300025914 Bacteria 1035
162 Ga0207693_10087721 3300025915 Bacteria 2438
163 Ga0207693_10115665 3300025915 Bacteria 2106
164 Ga0207663_10445797 3300025916 Bacteria 998
165 Ga0207662_10022248 3300025918 Bacteria 3632
166 Ga0207649_10183095 3300025920 Bacteria 1467
167 Ga0207649_10411639 3300025920 Bacteria 1014
168 Ga0207681_10200836 3300025923 Bacteria 1531
169 Ga0207694_10358685 3300025924 Bacteria 1208
170 Ga0207659_10039209 3300025926 Bacteria 3302
171 Ga0207687_10115784 3300025927 Bacteria 1997
172 Ga0207644_10031153 3300025931 Bacteria 3714
173 Ga0207690_10103594 3300025932 Bacteria 2037
174 Ga0207709_10174895 3300025935 Bacteria 1510
175 Ga0207670_10055159 3300025936 Bacteria 2684
176 Ga0207670_10415608 3300025936 Bacteria 1078
177 Ga0207704_10201782 3300025938 Bacteria 1456
178 Ga0207691_10116589 3300025940 Bacteria 2370
179 Ga0207711_10044758 3300025941 Bacteria 3780
180 Ga0207711_10345092 3300025941 Bacteria 1378
181 Ga0207689_10040643 3300025942 Bacteria 3849
182 Ga0207661_10056730 3300025944 Bacteria 3145
183 Ga0207679_10066260 3300025945 Bacteria 2705
184 Ga0207679_10222259 3300025945 Bacteria 1589
185 Ga0207667_10220780 3300025949 Bacteria 1942
186 Ga0207651_10587339 3300025960 Bacteria 972
187 Ga0207712_10139704 3300025961 Bacteria 1857
188 Ga0207712_10408255 3300025961 Bacteria 1143
189 Ga0207668_10134242 3300025972 Bacteria 1894
190 Ga0207640_10022533 3300025981 Bacteria 3772
191 Ga0207658_10276101 3300025986 Bacteria 1439
192 Ga0207677_10072034 3300026023 Bacteria 2441
193 Ga0207677_10138798 3300026023 Bacteria 1858
194 Ga0207703_10220562 3300026035 Bacteria 1695
195 Ga0207639_10223377 3300026041 Bacteria 1628
196 Ga0207678_10132141 3300026067 Bacteria 2130
197 Ga0207678_10888784 3300026067 Bacteria 788
198 Ga0207708_10001612 3300026075 Bacteria 16825
199 Ga0207708_10263191 3300026075 Bacteria 1392
200 Ga0207708_10675620 3300026075 Bacteria 881
201 Ga0207702_10059280 3300026078 Bacteria 3260
202 Ga0207641_10058565 3300026088 Bacteria 3279
203 Ga0207641_10784948 3300026088 Bacteria 942
204 Ga0207676_10018388 3300026095 Bacteria 5080
205 Ga0207676_10228435 3300026095 Bacteria 1662
206 Ga0207675_100090959 3300026118 Bacteria 2869
207 Ga0207675_100358725 3300026118 Bacteria 1430
208 Ga0207683_10082155 3300026121 Bacteria 2862
209 Ga0207683_10591088 3300026121 Bacteria 1027
210 Ga0207698_10616729 3300026142 Bacteria 1071
211 Ga0268265_10771924 3300028380 Bacteria 934
212 Ga0268264_10083696 3300028381 Bacteria 2733
213 Ga0265338_10041822 3300028800 Bacteria 4280
214 Ga0265327_10069655 3300031251 Bacteria 1765
215 Ga0307416_100263380 3300032002 Bacteria 1687
216 Ga0395898_0317295 3300037466 Bacteria 1487
217 Ga0436364_0371929 3300037853 Bacteria 748
218 Ga0436364_0677417 3300037853 Unclassified 642
219 Ga0436364_1082254 3300037853 Bacteria 49536
220 Ga0395901_0459229 3300038443 Bacteria 1302
221 Ga0436365_0806053 3300039437 Bacteria 1886
222 Ga0436365_1826901 3300039437 Bacteria 15104
223 Ga0436360_0073412 3300039438 Bacteria 2057
224 Ga0436361_0959489 3300039447 Bacteria 1007
225 Ga0436363_0964342 3300039450 Bacteria 2441
226 Ga0436363_0983494 3300039450 Bacteria 1489
227 Ga0466969_0126571 3300044656 Bacteria 1187
228 Ga0466965_0148143 3300044683 Bacteria 1226
229 Ga0466966_0033696 3300044684 Bacteria 3315
230 Ga0466966_0107222 3300044684 Bacteria 1724
231 Ga0466966_0272634 3300044684 Bacteria 1018
232 Ga0466963_0821505 3300044694 Archaea 655
233 Ga0466971_0031151 3300044719 Bacteria 2387
234 Ga0466968_0051970 3300044735 Bacteria 1752
235 Ga0466970_0069725 3300044765 Bacteria 1890
236 Ga0466970_0349244 3300044765 Bacteria 839
237 Ga0466957_0317850 3300044842 Unclassified 1050
238 Ga0466960_0000037 3300044901 Bacteria 43394
239 Ga0466960_0030345 3300044901 Bacteria 2487
240 Ga0466960_0030346 3300044901 Bacteria 2487
241 Ga0466960_0505918 3300044901 Bacteria 708
242 Ga0466960_0589159 3300044901 Bacteria 659
243 Ga0466959_0125607 3300045049 Bacteria 1821
244 Ga0466959_0480376 3300045049 Bacteria 841
245 Ga0466958_0024817 3300045836 Bacteria 3529
246 Ga0466958_0061564 3300045836 Bacteria 2287
247 Ga0466958_0352646 3300045836 Bacteria 947
248 Ga0466958_0616482 3300045836 Unclassified 706
249 Ga0466967_0014117 3300045976 Bacteria 6206
250 Ga0466967_0015935 3300045976 Bacteria 5909
251 Ga0466967_0701588 3300045976 Bacteria 1002
252 Ga0466967_0753115 3300045976 Bacteria 966
253 Ga0466967_0814541 3300045976 Bacteria 927
254 Ga0495641_0024028 3300046461 Bacteria 3015
255 Ga0495650_0000035 3300046471 Bacteria 403799
256 Ga0495596_0072761 3300046500 Bacteria 1335
257 Ga0495609_0267039 3300046538 Bacteria 702
258 Ga0495672_0009472 3300047320 Bacteria 7054
259 Ga0495680_0534650 3300047322 Bacteria 792
260 Ga0495675_0185493 3300047444 Bacteria 1272
261 Ga0496100_0000534 3300048903 Bacteria 18056
262 Ga0496100_0032066 3300048903 Bacteria 3272
263 Ga0496100_0035577 3300048903 Bacteria 3134
264 Ga0496101_0004677 3300048904 Bacteria 8667
265 Ga0496101_0017662 3300048904 Bacteria 4839
266 Ga0496101_0026738 3300048904 Bacteria 4012
267 Ga0496102_0195195 3300048905 Bacteria 1908
268 Ga0496102_0936487 3300048905 Bacteria 787
269 Ga0496103_0018758 3300048906 Bacteria 4152
270 Ga0496104_0000034 3300048907 Bacteria 186572
271 Ga0496104_0023168 3300048907 Bacteria 5708
272 Ga0496104_0217869 3300048907 Bacteria 1821
273 Ga0496105_0018448 3300048908 Bacteria 5608
274 Ga0496105_0268158 3300048908 Bacteria 1379
275 Ga0496105_0373723 3300048908 Bacteria 1135
276 Ga0496106_0175547 3300048909 Bacteria 1700
277 Ga0496106_0231661 3300048909 Bacteria 1475
278 Ga0496107_0208948 3300048910 Bacteria 1451
279 Ga0496108_0013122 3300048911 Bacteria 6752
280 Ga0496108_0016481 3300048911 Bacteria 6030
281 Ga0496108_0196993 3300048911 Bacteria 1747
282 Ga0496108_0377787 3300048911 Bacteria 1237
283 Ga0496109_0052228 3300048912 Bacteria 3725
284 Ga0496109_0094550 3300048912 Bacteria 2766
285 Ga0496109_0326457 3300048912 Bacteria 1448
286 Ga0496110_0004422 3300048913 Bacteria 10888
287 Ga0496110_0320844 3300048913 Bacteria 1411
288 Ga0496110_0386437 3300048913 Bacteria 1275
289 Ga0496110_0559110 3300048913 Bacteria 1039
290 Ga0496111_0000130 3300048914 Bacteria 33124
291 Ga0496111_0001514 3300048914 Bacteria 13331
292 Ga0496111_0016010 3300048914 Bacteria 5161
293 Ga0496111_0043364 3300048914 Bacteria 3233
294 Ga0496112_0018506 3300048915 Bacteria 6559
295 Ga0496112_0074364 3300048915 Bacteria 3359
296 Ga0496112_0151829 3300048915 Bacteria 2283
297 Ga0496112_0167287 3300048915 Bacteria 2164
298 Ga0496112_0214057 3300048915 Bacteria 1884
299 Ga0496112_0320156 3300048915 Bacteria 1495
300 Ga0496113_0001768 3300048916 Bacteria 12267
301 Ga0496113_0022346 3300048916 Bacteria 4472
302 Ga0496113_0029600 3300048916 Bacteria 3957
303 Ga0496114_0027848 3300048917 Bacteria 4633
304 Ga0496114_0104046 3300048917 Bacteria 2427
305 Ga0496114_0599466 3300048917 Bacteria 971
306 Ga0496115_0704606 3300048918 Bacteria 793
307 Ga0501067_0345825 3300049583 Bacteria 829
308 Ga0501069_0170197 3300049585 Bacteria 1257
309 nmdc:mga00v17_797195_c1 3300050491 Bacteria 602
310 nmdc:mga05p37_1040163_c1 3300050507 Bacteria 865
311 nmdc:mga06r32_534293_c1 3300050510 Bacteria 1148
312 nmdc:mga08y16_123510_c1 3300050511 Bacteria 2694
313 nmdc:mga08y16_1408424_c1 3300050511 Bacteria 660
314 nmdc:mga08y16_7369_c1 3300050511 Bacteria 11536
315 nmdc:mga0n895_540389_c1 3300050512 Bacteria 1172
316 nmdc:mga0rr50_416913_c1 3300050513 Bacteria 1135
317 nmdc:mga08x19_53588_c1 3300050514 Bacteria 2595
318 nmdc:mga0a205_114793_c1 3300050515 Bacteria 2591
319 nmdc:mga0a205_471992_c1 3300050515 Bacteria 1113
320 Ga0466962_0028377 3300061719 Bacteria 2681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_797195_c1 nmdc:mga00v17_797195_c1_11_514 146
2 3300039447 Ga0436361_0959489 Ga0436361_0959489_86_586 147
3 3300009094 Ga0111539_10311184 Ga0111539_103111843 149
4 3300009101 Ga0105247_10114396 Ga0105247_101143961 149
5 3300009174 Ga0105241_10065281 Ga0105241_100652812 149
6 3300009177 Ga0105248_10242819 Ga0105248_102428192 149
7 3300009545 Ga0105237_10267536 Ga0105237_102675362 149
8 3300009551 Ga0105238_10061275 Ga0105238_100612755 149
9 3300014325 Ga0163163_10199708 Ga0163163_101997082 149
10 3300014326 Ga0157380_10123073 Ga0157380_101230732 149
11 3300014968 Ga0157379_10094710 Ga0157379_100947102 149
12 3300048903 Ga0496100_0032066 Ga0496100_0032066_2608_3108 149
13 3300048904 Ga0496101_0026738 Ga0496101_0026738_1735_2235 149
14 3300048905 Ga0496102_0936487 Ga0496102_0936487_81_581 149
15 3300048908 Ga0496105_0268158 Ga0496105_0268158_605_1105 149
16 3300048911 Ga0496108_0016481 Ga0496108_0016481_1679_2179 149
17 3300048912 Ga0496109_0094550 Ga0496109_0094550_708_1208 149
18 3300048913 Ga0496110_0386437 Ga0496110_0386437_630_1130 149
19 3300048914 Ga0496111_0001514 Ga0496111_0001514_12329_12829 149
20 3300048915 Ga0496112_0151829 Ga0496112_0151829_470_970 149
21 3300048916 Ga0496113_0001768 Ga0496113_0001768_2083_2583 149
22 3300048917 Ga0496114_0104046 Ga0496114_0104046_1878_2378 149
23 3300048918 Ga0496115_0704606 Ga0496115_0704606_97_597 149
24 3300050511 nmdc:mga08y16_123510_c1 nmdc:mga08y16_123510_c1_408_908 149
25 3300013308 Ga0157375_10854420 Ga0157375_108544202 151
26 3300044901 Ga0466960_0030345 Ga0466960_0030345_1832_2350 152
27 3300046471 Ga0495650_0000035 Ga0495650_0000035_67695_68207 152
28 3300048915 Ga0496112_0074364 Ga0496112_0074364_1346_1873 152
29 3300048916 Ga0496113_0029600 Ga0496113_0029600_1761_2288 152
30 3300050507 nmdc:mga05p37_1040163_c1 nmdc:mga05p37_1040163_c1_40_564 153
31 3300039437 Ga0436365_1826901 Ga0436365_1826901_10531_11094 168
32 3300039438 Ga0436360_0073412 Ga0436360_0073412_941_1516 168
33 3300039450 Ga0436363_0983494 Ga0436363_0983494_424_987 168
34 3300044656 Ga0466969_0126571 Ga0466969_0126571_221_784 168
35 3300044683 Ga0466965_0148143 Ga0466965_0148143_80_652 168
36 3300044684 Ga0466966_0033696 Ga0466966_0033696_1491_2066 168
37 3300044719 Ga0466971_0031151 Ga0466971_0031151_655_1224 168
38 3300045836 Ga0466958_0061564 Ga0466958_0061564_1280_1849 168
39 3300045836 Ga0466958_0616482 Ga0466958_0616482_70_642 168
40 3300061719 Ga0466962_0028377 Ga0466962_0028377_1013_1582 168
41 3300006038 Ga0075365_10528561 Ga0075365_105285611 169
42 3300020069 Ga0197907_11391826 Ga0197907_113918262 171
43 3300044684 Ga0466966_0107222 Ga0466966_0107222_581_1156 171
44 3300005434 Ga0070709_10359459 Ga0070709_103594591 172
45 3300005435 Ga0070714_100966734 Ga0070714_1009667341 172
46 3300006175 Ga0070712_100294285 Ga0070712_1002942851 172
47 3300006846 Ga0075430_100670679 Ga0075430_1006706792 172
48 3300009147 Ga0114129_11985524 Ga0114129_119855241 172
49 3300011119 Ga0105246_10028909 Ga0105246_100289092 172
50 3300021377 Ga0213874_10005357 Ga0213874_100053575 172
51 3300021384 Ga0213876_10033441 Ga0213876_100334413 172
52 3300021384 Ga0213876_10061687 Ga0213876_100616873 172
53 3300021384 Ga0213876_10104344 Ga0213876_101043443 172
54 3300021388 Ga0213875_10000162 Ga0213875_1000016256 172
55 3300021388 Ga0213875_10144851 Ga0213875_101448512 172
56 3300021441 Ga0213871_10142119 Ga0213871_101421191 172
57 3300025916 Ga0207663_10445797 Ga0207663_104457971 172
58 3300032002 Ga0307416_100263380 Ga0307416_1002633802 172
59 3300037853 Ga0436364_0677417 Ga0436364_0677417_11_595 172
60 3300037853 Ga0436364_1082254 Ga0436364_1082254_2988_3563 172
61 3300039450 Ga0436363_0964342 Ga0436363_0964342_1475_2050 172
62 3300044684 Ga0466966_0272634 Ga0466966_0272634_392_967 172
63 3300044694 Ga0466963_0821505 Ga0466963_0821505_45_620 172
64 3300044735 Ga0466968_0051970 Ga0466968_0051970_14_595 172
65 3300044765 Ga0466970_0349244 Ga0466970_0349244_116_691 172
66 3300044842 Ga0466957_0317850 Ga0466957_0317850_330_905 172
67 3300045836 Ga0466958_0024817 Ga0466958_0024817_1289_1864 172
68 3300045836 Ga0466958_0352646 Ga0466958_0352646_129_704 172
69 3300045976 Ga0466967_0814541 Ga0466967_0814541_198_773 172
70 3300047322 Ga0495680_0534650 Ga0495680_0534650_81_668 172
71 3300005339 Ga0070660_100001954 Ga0070660_1000019545 173
72 3300005347 Ga0070668_100502385 Ga0070668_1005023852 173
73 3300005347 Ga0070668_100650826 Ga0070668_1006508261 173
74 3300005457 Ga0070662_100770200 Ga0070662_1007702002 173
75 3300005518 Ga0070699_100330478 Ga0070699_1003304782 173
76 3300005549 Ga0070704_100624341 Ga0070704_1006243412 173
77 3300005615 Ga0070702_100222463 Ga0070702_1002224631 173
78 3300005719 Ga0068861_100298200 Ga0068861_1002982002 173
79 3300006881 Ga0068865_100353917 Ga0068865_1003539171 173
80 3300009094 Ga0111539_10703964 Ga0111539_107039642 173
81 3300009098 Ga0105245_10594879 Ga0105245_105948792 173
82 3300009553 Ga0105249_10347929 Ga0105249_103479292 173
83 3300010375 Ga0105239_10513975 Ga0105239_105139753 173
84 3300013307 Ga0157372_10060443 Ga0157372_100604435 173
85 3300014325 Ga0163163_10515557 Ga0163163_105155572 173
86 3300020069 Ga0197907_11436359 Ga0197907_114363592 173
87 3300021358 Ga0213873_10098007 Ga0213873_100980071 173
88 3300022467 Ga0224712_10249022 Ga0224712_102490221 173
89 3300022467 Ga0224712_10296767 Ga0224712_102967671 173
90 3300022467 Ga0224712_10305625 Ga0224712_103056251 173
91 3300025927 Ga0207687_10115784 Ga0207687_101157842 173
92 3300026023 Ga0207677_10138798 Ga0207677_101387982 173
93 3300026095 Ga0207676_10228435 Ga0207676_102284352 173
94 3300026118 Ga0207675_100358725 Ga0207675_1003587252 173
95 3300037853 Ga0436364_0371929 Ga0436364_0371929_14_601 173
96 3300039437 Ga0436365_0806053 Ga0436365_0806053_642_1229 173
97 3300044765 Ga0466970_0069725 Ga0466970_0069725_1151_1735 173
98 3300044901 Ga0466960_0505918 Ga0466960_0505918_44_616 173
99 3300044901 Ga0466960_0589159 Ga0466960_0589159_26_598 173
100 3300045049 Ga0466959_0125607 Ga0466959_0125607_951_1535 173
101 3300046461 Ga0495641_0024028 Ga0495641_0024028_105_692 173
102 3300046500 Ga0495596_0072761 Ga0495596_0072761_16_597 173
103 3300046538 Ga0495609_0267039 Ga0495609_0267039_38_610 173
104 3300048903 Ga0496100_0035577 Ga0496100_0035577_1440_2012 173
105 3300048905 Ga0496102_0195195 Ga0496102_0195195_662_1234 173
106 3300048907 Ga0496104_0217869 Ga0496104_0217869_391_963 173
107 3300048908 Ga0496105_0373723 Ga0496105_0373723_321_893 173
108 3300048909 Ga0496106_0231661 Ga0496106_0231661_672_1244 173
109 3300048910 Ga0496107_0208948 Ga0496107_0208948_589_1161 173
110 3300048911 Ga0496108_0196993 Ga0496108_0196993_495_1067 173
111 3300048911 Ga0496108_0377787 Ga0496108_0377787_72_647 173
112 3300048912 Ga0496109_0052228 Ga0496109_0052228_731_1306 173
113 3300048912 Ga0496109_0326457 Ga0496109_0326457_382_954 173
114 3300048913 Ga0496110_0559110 Ga0496110_0559110_99_671 173
115 3300048915 Ga0496112_0018506 Ga0496112_0018506_1223_1795 173
116 3300048915 Ga0496112_0320156 Ga0496112_0320156_458_1033 173
117 3300048917 Ga0496114_0599466 Ga0496114_0599466_100_672 173
118 3300049583 Ga0501067_0345825 Ga0501067_0345825_198_785 173
119 3300049585 Ga0501069_0170197 Ga0501069_0170197_229_816 173
120 3300050511 nmdc:mga08y16_1408424_c1 nmdc:mga08y16_1408424_c1_26_598 173
121 3300050513 nmdc:mga0rr50_416913_c1 nmdc:mga0rr50_416913_c1_77_649 173
122 3300005337 Ga0070682_100637545 Ga0070682_1006375451 174
123 3300005338 Ga0068868_100342599 Ga0068868_1003425992 174
124 3300005338 Ga0068868_100347383 Ga0068868_1003473831 174
125 3300005340 Ga0070689_100468488 Ga0070689_1004684882 174
126 3300005343 Ga0070687_100570522 Ga0070687_1005705221 174
127 3300005345 Ga0070692_10042830 Ga0070692_100428301 174
128 3300005353 Ga0070669_100178713 Ga0070669_1001787132 174
129 3300005353 Ga0070669_100347813 Ga0070669_1003478132 174
130 3300005355 Ga0070671_100079596 Ga0070671_1000795965 174
131 3300005356 Ga0070674_100015075 Ga0070674_1000150755 174
132 3300005365 Ga0070688_100273207 Ga0070688_1002732071 174
133 3300005366 Ga0070659_100309620 Ga0070659_1003096202 174
134 3300005367 Ga0070667_100456557 Ga0070667_1004565572 174
135 3300005440 Ga0070705_100296966 Ga0070705_1002969662 174
136 3300005441 Ga0070700_100059370 Ga0070700_1000593702 174
137 3300005444 Ga0070694_100093786 Ga0070694_1000937862 174
138 3300005466 Ga0070685_10008908 Ga0070685_100089081 174
139 3300005543 Ga0070672_100530533 Ga0070672_1005305332 174
140 3300005544 Ga0070686_100234233 Ga0070686_1002342333 174
141 3300005545 Ga0070695_100132932 Ga0070695_1001329322 174
142 3300005549 Ga0070704_100190405 Ga0070704_1001904052 174
143 3300005564 Ga0070664_100104333 Ga0070664_1001043333 174
144 3300005615 Ga0070702_100012747 Ga0070702_1000127471 174
145 3300005616 Ga0068852_100199330 Ga0068852_1001993301 174
146 3300005617 Ga0068859_100384755 Ga0068859_1003847553 174
147 3300005618 Ga0068864_100438158 Ga0068864_1004381582 174
148 3300005618 Ga0068864_100945624 Ga0068864_1009456241 174
149 3300005719 Ga0068861_101003770 Ga0068861_1010037702 174
150 3300005834 Ga0068851_10457119 Ga0068851_104571191 174
151 3300005840 Ga0068870_10031267 Ga0068870_100312674 174
152 3300005841 Ga0068863_100709363 Ga0068863_1007093631 174
153 3300005842 Ga0068858_100189081 Ga0068858_1001890813 174
154 3300005843 Ga0068860_100629693 Ga0068860_1006296931 174
155 3300006048 Ga0075363_100322492 Ga0075363_1003224922 174
156 3300006173 Ga0070716_100182942 Ga0070716_1001829422 174
157 3300006175 Ga0070712_100022048 Ga0070712_1000220482 174
158 3300006871 Ga0075434_100162684 Ga0075434_1001626841 174
159 3300006931 Ga0097620_100384743 Ga0097620_1003847433 174
160 3300009098 Ga0105245_10677557 Ga0105245_106775572 174
161 3300009553 Ga0105249_10290010 Ga0105249_102900101 174
162 3300009553 Ga0105249_10616208 Ga0105249_106162082 174
163 3300013308 Ga0157375_10892338 Ga0157375_108923382 174
164 3300014745 Ga0157377_10203658 Ga0157377_102036581 174
165 3300017792 Ga0163161_10206753 Ga0163161_102067532 174
166 3300020069 Ga0197907_10337718 Ga0197907_103377181 174
167 3300020078 Ga0206352_10753119 Ga0206352_107531191 174
168 3300020080 Ga0206350_10930760 Ga0206350_109307602 174
169 3300022467 Ga0224712_10268381 Ga0224712_102683811 174
170 3300025898 Ga0207692_10027484 Ga0207692_100274844 174
171 3300025900 Ga0207710_10036289 Ga0207710_100362893 174
172 3300025908 Ga0207643_10505051 Ga0207643_105050511 174
173 3300025914 Ga0207671_10442286 Ga0207671_104422862 174
174 3300025915 Ga0207693_10087721 Ga0207693_100877213 174
175 3300025918 Ga0207662_10022248 Ga0207662_100222483 174
176 3300025920 Ga0207649_10411639 Ga0207649_104116391 174
177 3300025923 Ga0207681_10200836 Ga0207681_102008362 174
178 3300025924 Ga0207694_10358685 Ga0207694_103586851 174
179 3300025932 Ga0207690_10103594 Ga0207690_101035943 174
180 3300025935 Ga0207709_10174895 Ga0207709_101748953 174
181 3300025936 Ga0207670_10055159 Ga0207670_100551591 174
182 3300025938 Ga0207704_10201782 Ga0207704_102017821 174
183 3300025940 Ga0207691_10116589 Ga0207691_101165892 174
184 3300025941 Ga0207711_10345092 Ga0207711_103450921 174
185 3300025945 Ga0207679_10222259 Ga0207679_102222592 174
186 3300025961 Ga0207712_10139704 Ga0207712_101397043 174
187 3300025961 Ga0207712_10408255 Ga0207712_104082552 174
188 3300025972 Ga0207668_10134242 Ga0207668_101342423 174
189 3300025986 Ga0207658_10276101 Ga0207658_102761011 174
190 3300026035 Ga0207703_10220562 Ga0207703_102205622 174
191 3300026041 Ga0207639_10223377 Ga0207639_102233772 174
192 3300026067 Ga0207678_10888784 Ga0207678_108887841 174
193 3300026075 Ga0207708_10263191 Ga0207708_102631912 174
194 3300026075 Ga0207708_10675620 Ga0207708_106756201 174
195 3300026088 Ga0207641_10784948 Ga0207641_107849481 174
196 3300026118 Ga0207675_100090959 Ga0207675_1000909594 174
197 3300026121 Ga0207683_10591088 Ga0207683_105910881 174
198 3300026142 Ga0207698_10616729 Ga0207698_106167291 174
199 3300028380 Ga0268265_10771924 Ga0268265_107719241 174
200 3300028381 Ga0268264_10083696 Ga0268264_100836961 174
201 3300028800 Ga0265338_10041822 Ga0265338_100418224 174
202 3300044901 Ga0466960_0000037 Ga0466960_0000037_40302_40880 174
203 3300045049 Ga0466959_0480376 Ga0466959_0480376_17_595 174
204 3300045976 Ga0466967_0014117 Ga0466967_0014117_2279_2854 174
205 3300045976 Ga0466967_0015935 Ga0466967_0015935_637_1212 174
206 3300045976 Ga0466967_0701588 Ga0466967_0701588_13_588 174
207 3300047320 Ga0495672_0009472 Ga0495672_0009472_6292_6873 174
208 3300048903 Ga0496100_0000534 Ga0496100_0000534_4242_4835 174
209 3300048904 Ga0496101_0004677 Ga0496101_0004677_79_672 174
210 3300048907 Ga0496104_0000034 Ga0496104_0000034_60069_60647 174
211 3300048909 Ga0496106_0175547 Ga0496106_0175547_920_1495 174
212 3300048913 Ga0496110_0004422 Ga0496110_0004422_1980_2558 174
213 3300048913 Ga0496110_0320844 Ga0496110_0320844_532_1125 174
214 3300048914 Ga0496111_0000130 Ga0496111_0000130_23224_23802 174
215 3300048914 Ga0496111_0043364 Ga0496111_0043364_463_1056 174
216 3300048915 Ga0496112_0214057 Ga0496112_0214057_470_1045 174
217 3300005329 Ga0070683_100000645 Ga0070683_1000006457 175
218 3300005334 Ga0068869_100013296 Ga0068869_1000132967 175
219 3300005337 Ga0070682_100007928 Ga0070682_1000079285 175
220 3300005338 Ga0068868_100022502 Ga0068868_1000225021 175
221 3300005340 Ga0070689_100032679 Ga0070689_1000326795 175
222 3300005344 Ga0070661_100144755 Ga0070661_1001447553 175
223 3300005364 Ga0070673_100031260 Ga0070673_1000312602 175
224 3300005365 Ga0070688_100783309 Ga0070688_1007833091 175
225 3300005366 Ga0070659_100061599 Ga0070659_1000615993 175
226 3300005437 Ga0070710_10181272 Ga0070710_101812721 175
227 3300005440 Ga0070705_100456976 Ga0070705_1004569762 175
228 3300005441 Ga0070700_100008738 Ga0070700_1000087384 175
229 3300005456 Ga0070678_100016305 Ga0070678_1000163053 175
230 3300005457 Ga0070662_100036848 Ga0070662_1000368482 175
231 3300005466 Ga0070685_10019794 Ga0070685_100197945 175
232 3300005535 Ga0070684_100003617 Ga0070684_1000036175 175
233 3300005548 Ga0070665_100109040 Ga0070665_1001090402 175
234 3300005549 Ga0070704_100035306 Ga0070704_1000353062 175
235 3300005563 Ga0068855_100651697 Ga0068855_1006516972 175
236 3300005564 Ga0070664_100003373 Ga0070664_10000337311 175
237 3300005578 Ga0068854_100041065 Ga0068854_1000410652 175
238 3300005614 Ga0068856_100005907 Ga0068856_1000059078 175
239 3300005834 Ga0068851_10284688 Ga0068851_102846881 175
240 3300006058 Ga0075432_10045578 Ga0075432_100455782 175
241 3300006175 Ga0070712_100183845 Ga0070712_1001838453 175
242 3300006847 Ga0075431_100033246 Ga0075431_1000332467 175
243 3300006871 Ga0075434_100023596 Ga0075434_1000235965 175
244 3300006881 Ga0068865_100052661 Ga0068865_1000526614 175
245 3300006914 Ga0075436_100234023 Ga0075436_1002340232 175
246 3300007076 Ga0075435_100041548 Ga0075435_1000415485 175
247 3300009094 Ga0111539_10009419 Ga0111539_1000941911 175
248 3300009094 Ga0111539_10248830 Ga0111539_102488303 175
249 3300009098 Ga0105245_10004181 Ga0105245_100041817 175
250 3300009148 Ga0105243_10017175 Ga0105243_100171753 175
251 3300009176 Ga0105242_10110455 Ga0105242_101104553 175
252 3300009177 Ga0105248_10087752 Ga0105248_100877523 175
253 3300009553 Ga0105249_10058789 Ga0105249_100587893 175
254 3300010375 Ga0105239_10051102 Ga0105239_100511023 175
255 3300011119 Ga0105246_10007691 Ga0105246_100076915 175
256 3300013296 Ga0157374_10007098 Ga0157374_100070988 175
257 3300013297 Ga0157378_11640122 Ga0157378_116401221 175
258 3300013306 Ga0163162_10186192 Ga0163162_101861924 175
259 3300013307 Ga0157372_10012336 Ga0157372_100123365 175
260 3300013308 Ga0157375_10017301 Ga0157375_100173015 175
261 3300014325 Ga0163163_10043652 Ga0163163_100436522 175
262 3300014326 Ga0157380_10057796 Ga0157380_100577964 175
263 3300014745 Ga0157377_10000822 Ga0157377_100008226 175
264 3300020070 Ga0206356_11760707 Ga0206356_117607072 175
265 3300020078 Ga0206352_10787252 Ga0206352_107872521 175
266 3300020080 Ga0206350_10232437 Ga0206350_102324371 175
267 3300020081 Ga0206354_10556497 Ga0206354_105564971 175
268 3300025321 Ga0207656_10257279 Ga0207656_102572791 175
269 3300025898 Ga0207692_10131359 Ga0207692_101313592 175
270 3300025901 Ga0207688_10000691 Ga0207688_100006918 175
271 3300025915 Ga0207693_10115665 Ga0207693_101156651 175
272 3300025920 Ga0207649_10183095 Ga0207649_101830951 175
273 3300025926 Ga0207659_10039209 Ga0207659_100392094 175
274 3300025931 Ga0207644_10031153 Ga0207644_100311534 175
275 3300025936 Ga0207670_10415608 Ga0207670_104156082 175
276 3300025941 Ga0207711_10044758 Ga0207711_100447584 175
277 3300025942 Ga0207689_10040643 Ga0207689_100406432 175
278 3300025944 Ga0207661_10056730 Ga0207661_100567302 175
279 3300025945 Ga0207679_10066260 Ga0207679_100662603 175
280 3300025949 Ga0207667_10220780 Ga0207667_102207801 175
281 3300025960 Ga0207651_10587339 Ga0207651_105873392 175
282 3300025981 Ga0207640_10022533 Ga0207640_100225334 175
283 3300026023 Ga0207677_10072034 Ga0207677_100720343 175
284 3300026075 Ga0207708_10001612 Ga0207708_100016124 175
285 3300026078 Ga0207702_10059280 Ga0207702_100592803 175
286 3300026088 Ga0207641_10058565 Ga0207641_100585651 175
287 3300026095 Ga0207676_10018388 Ga0207676_100183885 175
288 3300026121 Ga0207683_10082155 Ga0207683_100821555 175
289 3300037466 Ga0395898_0317295 Ga0395898_0317295_366_959 175
290 3300038443 Ga0395901_0459229 Ga0395901_0459229_167_760 175
291 3300047444 Ga0495675_0185493 Ga0495675_0185493_283_867 175
292 3300048904 Ga0496101_0017662 Ga0496101_0017662_2232_2822 175
293 3300048906 Ga0496103_0018758 Ga0496103_0018758_2608_3198 175
294 3300048907 Ga0496104_0023168 Ga0496104_0023168_2066_2656 175
295 3300048908 Ga0496105_0018448 Ga0496105_0018448_3001_3591 175
296 3300048911 Ga0496108_0013122 Ga0496108_0013122_5074_5664 175
297 3300048914 Ga0496111_0016010 Ga0496111_0016010_1227_1817 175
298 3300048915 Ga0496112_0167287 Ga0496112_0167287_1089_1679 175
299 3300048916 Ga0496113_0022346 Ga0496113_0022346_3181_3771 175
300 3300048917 Ga0496114_0027848 Ga0496114_0027848_2876_3466 175
301 3300050510 nmdc:mga06r32_534293_c1 nmdc:mga06r32_534293_c1_262_852 175
302 3300050511 nmdc:mga08y16_7369_c1 nmdc:mga08y16_7369_c1_10095_10685 175
303 3300050512 nmdc:mga0n895_540389_c1 nmdc:mga0n895_540389_c1_89_679 175
304 3300050514 nmdc:mga08x19_53588_c1 nmdc:mga08x19_53588_c1_1190_1780 175
305 3300050515 nmdc:mga0a205_114793_c1 nmdc:mga0a205_114793_c1_1645_2235 175
306 3300050515 nmdc:mga0a205_471992_c1 nmdc:mga0a205_471992_c1_464_1054 175
307 3300026067 Ga0207678_10132141 Ga0207678_101321412 177
308 3300005445 Ga0070708_100423212 Ga0070708_1004232121 178
309 3300009174 Ga0105241_10157552 Ga0105241_101575522 178
310 3300020078 Ga0206352_10535192 Ga0206352_105351921 178
311 3300025911 Ga0207654_10106983 Ga0207654_101069832 178
312 3300031251 Ga0265327_10069655 Ga0265327_100696552 178
313 3300020082 Ga0206353_11100348 Ga0206353_111003483 190
314 3300044901 Ga0466960_0030346 Ga0466960_0030346_1524_2159 190
315 3300045976 Ga0466967_0753115 Ga0466967_0753115_46_681 190
316 3300006175 Ga0070712_100259040 Ga0070712_1002590402 193
317 3300020075 Ga0206349_1457507 Ga0206349_14575071 193
318 3300002074 JGI24748J21848_1002127 JGI24748J21848_10021272 206
319 3300002239 JGI24034J26672_10000251 JGI24034J26672_100002514 206
320 3300002244 JGI24742J22300_10002911 JGI24742J22300_100029113 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

140

203

0.93

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

127

213

0.93

PF07295

DUF1451

Zinc-ribbon containing domain

2

72

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9462 114 204
3gqs-assembly2.cif.gz_B crystal structure of the fha domain of ct664 protein from chlamydia trachomatis 0.9452 111 206
3poa-assembly1.cif.gz_A structural and functional analysis of phosphothreonine-dependent fha domain interactions 0.9377 111 206
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9361 110 204
3oun-assembly1.cif.gz_A crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910 0.9323 111 203
ID Description Score Start End Superfamily
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9489 131 202 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9433 113 204 2.60.200.20
af_Q54ST8_470_584_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9416 111 204 2.60.200.20
3poaA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9377 111 206 2.60.200.20
af_Q54PF7_21_118_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9298 128 197 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7X7LKD5-F1-model_v4 FHA domain-containing protein 0.9774 132 197 GO:0004252
GO:0006508
GO:0016020
AF-A0A3M1VCJ6-F1-model_v4 FHA domain-containing protein 0.9757 110 205
AF-A0A3N5R2H6-F1-model_v4 FHA domain-containing protein 0.97 111 206 GO:0016791
AF-A0A7X0LJ64-F1-model_v4 Putative component of type VI protein secretion system 0.9699 111 204
AF-A0A7Y4VRF8-F1-model_v4 SpoIIE family protein phosphatase 0.9642 112 205 GO:0016791

Feature Viewer

pLDDT pTM Quality
71.18 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map