F405442

General Info

Members Datasets Scaffolds Average Seq Length
320 199 640 264

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100042999|Ga0070693_1000429992
Length 305
Sequence MKVVLFCGGLGMRLRDYAENVPKPMVPLGYRPMIWHVMKYYAHFGHRDFILCLGYRGDMIKNYFLHYEEGLSNDFILSEGGRRRELLTSDIEDWRITFVETGLASNIGERLSLVKKHLVGEEMFLANYSDGLSDVPLPQQIEAFRRDGATGCFLSVKPNLSYHFVSVDGRGRVESFRDIAQSGLRVNGGFFVFRQEIFDYIRDGEELVLEPFQRLVANNQLLAYPYDGFWLPMDTAKDKARLDELHATGKPPWYVWNQNGNGKPHGLAAAGNGDALSHSGTNGHGYTPAIANYRINSPERDVVRR

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
199 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 7.19
Rhizosphere 91.25
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100042999 3300005547 Unclassified 2549
2 JGI25404J52841_10012763 3300003659 Unclassified 1822
3 Ga0070676_10165153 3300005328 Bacteria 1428
4 Ga0070683_100010590 3300005329 Bacteria 7928
5 Ga0070670_100001055 3300005331 Bacteria 21884
6 Ga0070666_10266966 3300005335 Bacteria 1214
7 Ga0070666_10313461 3300005335 Bacteria 1118
8 Ga0070680_100024087 3300005336 Bacteria 4858
9 Ga0068868_100000363 3300005338 Bacteria 30758
10 Ga0070660_100301844 3300005339 Bacteria 1313
11 Ga0070669_100515150 3300005353 Bacteria 994
12 Ga0070675_100006546 3300005354 Bacteria 8952
13 Ga0070671_100056874 3300005355 Bacteria 3254
14 Ga0070709_10010178 3300005434 Bacteria 5197
15 Ga0070709_10011041 3300005434 Bacteria 5019
16 Ga0070713_100086069 3300005436 Bacteria 2694
17 Ga0070711_100264304 3300005439 Bacteria 1355
18 Ga0070708_100000254 3300005445 Bacteria 40031
19 Ga0070663_100011611 3300005455 Bacteria 5536
20 Ga0070662_100130455 3300005457 Bacteria 1937
21 Ga0070681_10000395 3300005458 Bacteria 35334
22 Ga0068867_100056826 3300005459 Bacteria 2896
23 Ga0070685_10117014 3300005466 Bacteria 1650
24 Ga0070699_100002730 3300005518 Bacteria 15736
25 Ga0070699_100457773 3300005518 Bacteria 1157
26 Ga0070679_100054259 3300005530 Bacteria 3990
27 Ga0070684_100042467 3300005535 Bacteria 3925
28 Ga0070697_100018993 3300005536 Bacteria 5423
29 Ga0070672_100016698 3300005543 Bacteria 5262
30 Ga0070693_100029540 3300005547 Bacteria 2991
31 Ga0070693_100255045 3300005547 Bacteria 1164
32 Ga0070665_100000733 3300005548 Bacteria 43685
33 Ga0070665_100039505 3300005548 Bacteria 4744
34 Ga0068855_100295611 3300005563 Bacteria 1794
35 Ga0070664_100008005 3300005564 Bacteria 8538
36 Ga0070664_100498544 3300005564 Bacteria 1122
37 Ga0068854_100174257 3300005578 Bacteria 1676
38 Ga0068852_100057752 3300005616 Bacteria 3359
39 Ga0068864_100120437 3300005618 Bacteria 2346
40 Ga0068866_10013392 3300005718 Bacteria 3598
41 Ga0068861_100000508 3300005719 Bacteria 22713
42 Ga0068851_10177486 3300005834 Bacteria 1178
43 Ga0068863_100123696 3300005841 Bacteria 2468
44 Ga0068860_100309792 3300005843 Bacteria 1548
45 Ga0081455_10097715 3300005937 Bacteria 2365
46 Ga0081455_10175087 3300005937 Bacteria 1630
47 Ga0081538_10003476 3300005981 Bacteria 14881
48 Ga0081540_1000389 3300005983 Bacteria 44066
49 Ga0070717_10073696 3300006028 Bacteria 2854
50 Ga0075366_10135501 3300006195 Bacteria 1487
51 Ga0097621_100003404 3300006237 Bacteria 10953
52 Ga0097621_100205081 3300006237 Bacteria 1713
53 Ga0068871_100001727 3300006358 Bacteria 14708
54 Ga0068871_100193486 3300006358 Bacteria 1753
55 Ga0075428_100001128 3300006844 Bacteria 28558
56 Ga0075428_100022063 3300006844 Bacteria 7049
57 Ga0075428_100189319 3300006844 Bacteria 2226
58 Ga0075428_100376342 3300006844 Bacteria 1522
59 Ga0075428_100512934 3300006844 Bacteria 1282
60 Ga0075430_100033860 3300006846 Bacteria 4335
61 Ga0075430_100099796 3300006846 Bacteria 2425
62 Ga0075430_100334204 3300006846 Bacteria 1252
63 Ga0075430_100359051 3300006846 Bacteria 1203
64 Ga0075431_100078000 3300006847 Bacteria 3419
65 Ga0075431_100379023 3300006847 Bacteria 1419
66 Ga0075434_100473883 3300006871 Bacteria 1273
67 Ga0075429_100063054 3300006880 Bacteria 3229
68 Ga0075429_100095861 3300006880 Unclassified 2587
69 Ga0075429_100138358 3300006880 Bacteria 2131
70 Ga0068865_100002725 3300006881 Bacteria 10488
71 Ga0099794_10000134 3300007265 Bacteria 27002
72 Ga0111539_10001350 3300009094 Bacteria 32659
73 Ga0111539_10004051 3300009094 Bacteria 19242
74 Ga0111539_10051234 3300009094 Bacteria 4917
75 Ga0111539_10178507 3300009094 Bacteria 2481
76 Ga0111539_10432277 3300009094 Bacteria 1533
77 Ga0111539_10594445 3300009094 Bacteria 1289
78 Ga0105245_10018703 3300009098 Bacteria 6061
79 Ga0105245_10077077 3300009098 Bacteria 3038
80 Ga0114129_10012019 3300009147 Bacteria 12315
81 Ga0114129_10298585 3300009147 Bacteria 2148
82 Ga0114129_10524013 3300009147 Bacteria 1545
83 Ga0114129_11026455 3300009147 Bacteria 1037
84 Ga0105242_10005116 3300009176 Bacteria 10115
85 Ga0105248_10000540 3300009177 Bacteria 43101
86 Ga0105248_10003765 3300009177 Bacteria 16798
87 Ga0105248_10029531 3300009177 Bacteria 6116
88 Ga0105248_10057448 3300009177 Bacteria 4368
89 Ga0105248_10070864 3300009177 Bacteria 3914
90 Ga0105238_10032143 3300009551 Bacteria 5340
91 Ga0157374_10233481 3300013296 Unclassified 1807
92 Ga0157378_10050378 3300013297 Bacteria 3706
93 Ga0163162_10000694 3300013306 Bacteria 31094
94 Ga0157372_10118814 3300013307 Bacteria 3034
95 Ga0157375_10052986 3300013308 Bacteria 3990
96 Ga0157380_10010029 3300014326 Bacteria 6799
97 Ga0157380_10030039 3300014326 Bacteria 4159
98 Ga0157379_10018334 3300014968 Bacteria 6170
99 Ga0157379_10019710 3300014968 Bacteria 5959
100 Ga0157376_10009444 3300014969 Bacteria 7081
101 Ga0163161_10019719 3300017792 Bacteria 4731
102 Ga0213871_10000094 3300021441 Bacteria 8056
103 Ga0207697_10010945 3300025315 Bacteria 3854
104 Ga0207642_10054623 3300025899 Bacteria 1823
105 Ga0207699_10005333 3300025906 Bacteria 6159
106 Ga0207699_10037998 3300025906 Bacteria 2756
107 Ga0207645_10349769 3300025907 Bacteria 989
108 Ga0207707_10131283 3300025912 Bacteria 2191
109 Ga0207707_10303217 3300025912 Bacteria 1381
110 Ga0207660_10032129 3300025917 Bacteria 3621
111 Ga0207660_10371930 3300025917 Bacteria 1148
112 Ga0207652_10100878 3300025921 Bacteria 2549
113 Ga0207694_10223172 3300025924 Bacteria 1538
114 Ga0207650_10002100 3300025925 Bacteria 13924
115 Ga0207659_10009703 3300025926 Bacteria 6019
116 Ga0207700_10064762 3300025928 Bacteria 2785
117 Ga0207644_10034717 3300025931 Bacteria 3531
118 Ga0207686_10023748 3300025934 Bacteria 3543
119 Ga0207704_10044012 3300025938 Bacteria 2641
120 Ga0207691_10105061 3300025940 Bacteria 2516
121 Ga0207711_10003947 3300025941 Bacteria 12756
122 Ga0207711_10012847 3300025941 Bacteria 6957
123 Ga0207711_10069566 3300025941 Bacteria 3051
124 Ga0207711_10079449 3300025941 Bacteria 2863
125 Ga0207711_10195265 3300025941 Bacteria 1846
126 Ga0207711_10823270 3300025941 Bacteria 864
127 Ga0207689_10032085 3300025942 Bacteria 4370
128 Ga0207689_10334919 3300025942 Bacteria 1257
129 Ga0207661_10009661 3300025944 Bacteria 6927
130 Ga0207679_10007941 3300025945 Bacteria 6748
131 Ga0207640_10215902 3300025981 Bacteria 1465
132 Ga0207658_10030511 3300025986 Bacteria 3818
133 Ga0207677_10014066 3300026023 Bacteria 4659
134 Ga0207703_10181015 3300026035 Bacteria 1860
135 Ga0207639_10025602 3300026041 Bacteria 4279
136 Ga0207678_10149549 3300026067 Bacteria 1993
137 Ga0207648_10011709 3300026089 Bacteria 8249
138 Ga0207648_10061770 3300026089 Bacteria 3266
139 Ga0207676_10079729 3300026095 Bacteria 2656
140 Ga0207676_10232160 3300026095 Bacteria 1650
141 Ga0207676_10490096 3300026095 Bacteria 1165
142 Ga0207675_100006010 3300026118 Bacteria 11554
143 Ga0209588_1002557 3300027671 Bacteria 4939
144 Ga0209588_1011420 3300027671 Bacteria 2683
145 Ga0268266_10000304 3300028379 Bacteria 78271
146 Ga0268265_10045256 3300028380 Bacteria 3283
147 Ga0307515_10380950 3300028794 Bacteria 1043
148 Ga0265324_10018020 3300029957 Bacteria 2562
149 Ga0307513_10261028 3300031456 Bacteria 1522
150 Ga0307406_10066123 3300031901 Bacteria 2352
151 Ga0307407_10100465 3300031903 Bacteria 1794
152 Ga0307412_10141311 3300031911 Bacteria 1764
153 Ga0307416_100177134 3300032002 Bacteria 1994
154 Ga0307414_10051494 3300032004 Bacteria 2859
155 Ga0307411_10086932 3300032005 Bacteria 2170
156 Ga0307415_100016297 3300032126 Bacteria 4427
157 Ga0373926_0017926 3300035083 Bacteria 2432
158 Ga0373943_0030474 3300035170 Bacteria 2553
159 Ga0373946_0009195 3300035171 Bacteria 3635
160 Ga0373955_0112199 3300035172 Bacteria 1577
161 Ga0373924_0019406 3300035410 Bacteria 2634
162 Ga0373935_0410971 3300035692 Bacteria 973
163 Ga0373927_0000874 3300035695 Bacteria 22945
164 Ga0373947_0001256 3300035725 Bacteria 15600
165 Ga0373947_0225926 3300035725 Bacteria 1232
166 Ga0373937_1073175 3300036401 Bacteria 754
167 Ga0373925_0000525 3300037068 Bacteria 38212
168 Ga0373925_0022601 3300037068 Bacteria 4589
169 Ga0373925_0114277 3300037068 Bacteria 2089
170 Ga0436361_0556359 3300039447 Unclassified 3872
171 Ga0451577_0448991 3300042876 Unclassified 1171
172 Ga0453683_0038354 3300044673 Bacteria 3012
173 Ga0453684_0032584 3300044712 Bacteria 7289
174 Ga0453684_0497872 3300044712 Unclassified 1350
175 Ga0451576_0004206 3300045051 Bacteria 18936
176 Ga0495629_0221263 3300046459 Bacteria 1306
177 Ga0495580_0315819 3300046472 Bacteria 1062
178 Ga0495608_0347869 3300046511 Bacteria 913
179 Ga0495618_0053058 3300046514 Bacteria 2564
180 Ga0495628_0215143 3300046516 Bacteria 1444
181 Ga0495630_0001049 3300046517 Bacteria 19032
182 Ga0495645_0049545 3300046543 Bacteria 3058
183 Ga0495667_0125852 3300046559 Bacteria 1654
184 Ga0495634_0034769 3300046642 Bacteria 3456
185 Ga0495635_0108776 3300046663 Bacteria 1894
186 Ga0495669_0016211 3300046684 Bacteria 3191
187 Ga0495613_0001660 3300046689 Bacteria 16927
188 Ga0495613_0023028 3300046689 Bacteria 4642
189 Ga0495581_0008891 3300047315 Bacteria 5816
190 Ga0495604_0052209 3300047317 Bacteria 3167
191 Ga0495604_0198629 3300047317 Unclassified 1393
192 Ga0495674_0010138 3300047319 Bacteria 8927
193 Ga0495680_0093755 3300047322 Bacteria 2247
194 Ga0495675_0135152 3300047444 Bacteria 1531
195 Ga0495684_0000162 3300047471 Bacteria 50004
196 Ga0496100_0107948 3300048903 Bacteria 1929
197 Ga0496101_0419330 3300048904 Bacteria 1055
198 Ga0496104_0009713 3300048907 Bacteria 8576
199 Ga0496104_0651439 3300048907 Bacteria 962
200 Ga0496105_0080522 3300048908 Bacteria 2690
201 Ga0496105_0156120 3300048908 Bacteria 1874
202 Ga0496106_0045485 3300048909 Bacteria 3297
203 Ga0496106_0151328 3300048909 Bacteria 1831
204 Ga0496107_0068872 3300048910 Bacteria 2568
205 Ga0496108_0001245 3300048911 Bacteria 19959
206 Ga0496108_0301131 3300048911 Bacteria 1397
207 Ga0496109_0000776 3300048912 Bacteria 26522
208 Ga0496109_0033749 3300048912 Bacteria 4606
209 Ga0496110_0009842 3300048913 Bacteria 7746
210 Ga0496111_0005089 3300048914 Bacteria 8365
211 Ga0496112_0001988 3300048915 Bacteria 16174
212 Ga0496112_0035220 3300048915 Bacteria 4874
213 Ga0496113_0008485 3300048916 Bacteria 6698
214 Ga0496113_0245055 3300048916 Bacteria 1430
215 Ga0496113_0590018 3300048916 Bacteria 890
216 Ga0496114_0076033 3300048917 Bacteria 2829
217 Ga0496115_0001904 3300048918 Bacteria 14908
218 Ga0496115_0419544 3300048918 Bacteria 1084
219 Ga0501031_0002486 3300049568 Bacteria 11759
220 Ga0501031_0461666 3300049568 Bacteria 820
221 Ga0501032_0047169 3300049569 Bacteria 2910
222 Ga0501032_0067819 3300049569 Bacteria 2383
223 Ga0501032_0142574 3300049569 Bacteria 1578
224 Ga0501033_0021231 3300049570 Bacteria 4899
225 Ga0501033_0104105 3300049570 Bacteria 2069
226 Ga0501033_0327966 3300049570 Bacteria 1075
227 Ga0501034_0004246 3300049571 Bacteria 15983
228 Ga0501034_0129333 3300049571 Bacteria 2509
229 Ga0501036_0029919 3300049572 Bacteria 4602
230 Ga0501036_0067829 3300049572 Bacteria 3018
231 Ga0501037_0186239 3300049573 Bacteria 1471
232 Ga0501037_0258165 3300049573 Bacteria 1218
233 Ga0501038_0202997 3300049574 Bacteria 1590
234 Ga0501038_0275517 3300049574 Bacteria 1325
235 Ga0501038_0507217 3300049574 Bacteria 922
236 Ga0501039_0001386 3300049575 Bacteria 17793
237 Ga0501039_0016094 3300049575 Bacteria 5728
238 Ga0501039_0040568 3300049575 Bacteria 3593
239 Ga0501040_0024254 3300049576 Bacteria 4069
240 Ga0501041_0001491 3300049577 Bacteria 12974
241 Ga0501041_0002016 3300049577 Bacteria 11425
242 Ga0501042_0013385 3300049578 Bacteria 5581
243 Ga0501042_0046804 3300049578 Bacteria 3084
244 Ga0501042_0074970 3300049578 Bacteria 2421
245 Ga0501043_0150094 3300049579 Bacteria 1824
246 Ga0501043_0307941 3300049579 Bacteria 1209
247 Ga0501046_0006289 3300049580 Bacteria 10527
248 Ga0501046_0019022 3300049580 Bacteria 5701
249 Ga0501046_0026859 3300049580 Bacteria 4702
250 Ga0501047_0000952 3300049581 Bacteria 29324
251 Ga0501047_0091854 3300049581 Bacteria 2914
252 Ga0501048_0334271 3300049582 Bacteria 1080
253 Ga0501068_0050560 3300049584 Bacteria 2513
254 Ga0501068_0312857 3300049584 Bacteria 1006
255 Ga0501071_0014715 3300049587 Bacteria 5354
256 Ga0501071_0037499 3300049587 Bacteria 3461
257 Ga0501071_0042350 3300049587 Bacteria 3262
258 Ga0501072_0013750 3300049588 Bacteria 6197
259 Ga0501072_0020634 3300049588 Bacteria 5106
260 Ga0501074_0002860 3300049590 Bacteria 12084
261 Ga0501075_0002856 3300049591 Bacteria 11578
262 Ga0501075_0042928 3300049591 Bacteria 3391
263 Ga0501075_0143533 3300049591 Bacteria 1820
264 Ga0501076_0001878 3300049592 Bacteria 14322
265 Ga0501076_0004544 3300049592 Bacteria 9885
266 Ga0501076_0040763 3300049592 Bacteria 3650
267 Ga0501077_0006021 3300049593 Bacteria 7407
268 Ga0501077_0010738 3300049593 Bacteria 5704
269 Ga0501077_0234770 3300049593 Bacteria 1166
270 Ga0501077_0639407 3300049593 Bacteria 683
271 Ga0501261_022522 3300049690 Bacteria 912
272 Ga0501079_0042853 3300049741 Bacteria 3494
273 Ga0501080_0565895 3300049742 Bacteria 1011
274 Ga0501081_0003965 3300049743 Bacteria 9489
275 Ga0501081_0007357 3300049743 Bacteria 7147
276 Ga0501081_0012375 3300049743 Bacteria 5605
277 Ga0501081_0012390 3300049743 Bacteria 5603
278 Ga0501081_0210867 3300049743 Bacteria 1411
279 Ga0501081_0613561 3300049743 Bacteria 815
280 Ga0501035_0001026 3300049822 Bacteria 29397
281 Ga0501035_0206773 3300049822 Bacteria 1681
282 Ga0501044_0010581 3300049823 Bacteria 10008
283 Ga0501045_0002228 3300049824 Bacteria 13168
284 Ga0501045_0005660 3300049824 Bacteria 8646
285 Ga0501045_0068675 3300049824 Bacteria 2604
286 Ga0501045_0104971 3300049824 Bacteria 2093
287 nmdc:mga05p37_122744_c1 3300050507 Bacteria 3191
288 nmdc:mga05p37_148510_c1 3300050507 Unclassified 2869
289 nmdc:mga05p37_245863_c1 3300050507 Bacteria 2148
290 nmdc:mga09592_418427_c1 3300050508 Bacteria 1158
291 nmdc:mga09592_437037_c1 3300050508 Bacteria 1129
292 nmdc:mga09592_78175_c1 3300050508 Bacteria 2816
293 nmdc:mga09592_82937_c1 3300050508 Unclassified 2732
294 nmdc:mga0qj67_161398_c1 3300050509 Bacteria 1820
295 nmdc:mga0qj67_190215_c1 3300050509 Bacteria 1668
296 nmdc:mga0qj67_366992_c1 3300050509 Bacteria 1163
297 nmdc:mga06r32_241571_c1 3300050510 Bacteria 1794
298 nmdc:mga06r32_348004_c1 3300050510 Bacteria 1467
299 nmdc:mga06r32_620698_c1 3300050510 Bacteria 1051
300 nmdc:mga08y16_107166_c1 3300050511 Bacteria 2909
301 nmdc:mga08y16_152532_c1 3300050511 Bacteria 2402
302 nmdc:mga08y16_318490_c1 3300050511 Bacteria 1601
303 nmdc:mga08y16_46878_c1 3300050511 Bacteria 4524
304 nmdc:mga08y16_6549_c1 3300050511 Bacteria 12210
305 nmdc:mga0n895_557560_c1 3300050512 Bacteria 1151
306 nmdc:mga0n895_6301_c1 3300050512 Bacteria 10060
307 nmdc:mga0rr50_363928_c1 3300050513 Bacteria 1218
308 Ga0495601_0002009 3300053077 Bacteria 11417
309 Ga0495595_0156129 3300053084 Bacteria 1124
310 Ga0495619_0006796 3300053085 Bacteria 7235
311 Ga0501084_0002911 3300054114 Bacteria 13865
312 Ga0501084_0004960 3300054114 Bacteria 10880
313 Ga0501082_0020639 3300060353 Bacteria 5679
314 Ga0501082_0030895 3300060353 Bacteria 4617
315 Ga0501082_0191047 3300060353 Bacteria 1781
316 Ga0530510_0002152 3300061734 Bacteria 13524
317 Ga0530510_0013677 3300061734 Bacteria 5711
318 Ga0530510_0052540 3300061734 Bacteria 2944
319 2688069065 2687453257 Bacteria 6784659
320 2688391509 2687453341 Bacteria 6534136
321 Ga0070693_100042999
322 JGI25404J52841_10012763
323 Ga0070676_10165153
324 Ga0070683_100010590
325 Ga0070670_100001055
326 Ga0070666_10266966
327 Ga0070666_10313461
328 Ga0070680_100024087
329 Ga0068868_100000363
330 Ga0070660_100301844
331 Ga0070669_100515150
332 Ga0070675_100006546
333 Ga0070671_100056874
334 Ga0070709_10010178
335 Ga0070709_10011041
336 Ga0070713_100086069
337 Ga0070711_100264304
338 Ga0070708_100000254
339 Ga0070663_100011611
340 Ga0070662_100130455
341 Ga0070681_10000395
342 Ga0068867_100056826
343 Ga0070685_10117014
344 Ga0070699_100002730
345 Ga0070699_100457773
346 Ga0070679_100054259
347 Ga0070684_100042467
348 Ga0070697_100018993
349 Ga0070672_100016698
350 Ga0070693_100029540
351 Ga0070693_100255045
352 Ga0070665_100000733
353 Ga0070665_100039505
354 Ga0068855_100295611
355 Ga0070664_100008005
356 Ga0070664_100498544
357 Ga0068854_100174257
358 Ga0068852_100057752
359 Ga0068864_100120437
360 Ga0068866_10013392
361 Ga0068861_100000508
362 Ga0068851_10177486
363 Ga0068863_100123696
364 Ga0068860_100309792
365 Ga0081455_10097715
366 Ga0081455_10175087
367 Ga0081538_10003476
368 Ga0081540_1000389
369 Ga0070717_10073696
370 Ga0075366_10135501
371 Ga0097621_100003404
372 Ga0097621_100205081
373 Ga0068871_100001727
374 Ga0068871_100193486
375 Ga0075428_100001128
376 Ga0075428_100022063
377 Ga0075428_100189319
378 Ga0075428_100376342
379 Ga0075428_100512934
380 Ga0075430_100033860
381 Ga0075430_100099796
382 Ga0075430_100334204
383 Ga0075430_100359051
384 Ga0075431_100078000
385 Ga0075431_100379023
386 Ga0075434_100473883
387 Ga0075429_100063054
388 Ga0075429_100095861
389 Ga0075429_100138358
390 Ga0068865_100002725
391 Ga0099794_10000134
392 Ga0111539_10001350
393 Ga0111539_10004051
394 Ga0111539_10051234
395 Ga0111539_10178507
396 Ga0111539_10432277
397 Ga0111539_10594445
398 Ga0105245_10018703
399 Ga0105245_10077077
400 Ga0114129_10012019
401 Ga0114129_10298585
402 Ga0114129_10524013
403 Ga0114129_11026455
404 Ga0105242_10005116
405 Ga0105248_10000540
406 Ga0105248_10003765
407 Ga0105248_10029531
408 Ga0105248_10057448
409 Ga0105248_10070864
410 Ga0105238_10032143
411 Ga0157374_10233481
412 Ga0157378_10050378
413 Ga0163162_10000694
414 Ga0157372_10118814
415 Ga0157375_10052986
416 Ga0157380_10010029
417 Ga0157380_10030039
418 Ga0157379_10018334
419 Ga0157379_10019710
420 Ga0157376_10009444
421 Ga0163161_10019719
422 Ga0213871_10000094
423 Ga0207697_10010945
424 Ga0207642_10054623
425 Ga0207699_10005333
426 Ga0207699_10037998
427 Ga0207645_10349769
428 Ga0207707_10131283
429 Ga0207707_10303217
430 Ga0207660_10032129
431 Ga0207660_10371930
432 Ga0207652_10100878
433 Ga0207694_10223172
434 Ga0207650_10002100
435 Ga0207659_10009703
436 Ga0207700_10064762
437 Ga0207644_10034717
438 Ga0207686_10023748
439 Ga0207704_10044012
440 Ga0207691_10105061
441 Ga0207711_10003947
442 Ga0207711_10012847
443 Ga0207711_10069566
444 Ga0207711_10079449
445 Ga0207711_10195265
446 Ga0207711_10823270
447 Ga0207689_10032085
448 Ga0207689_10334919
449 Ga0207661_10009661
450 Ga0207679_10007941
451 Ga0207640_10215902
452 Ga0207658_10030511
453 Ga0207677_10014066
454 Ga0207703_10181015
455 Ga0207639_10025602
456 Ga0207678_10149549
457 Ga0207648_10011709
458 Ga0207648_10061770
459 Ga0207676_10079729
460 Ga0207676_10232160
461 Ga0207676_10490096
462 Ga0207675_100006010
463 Ga0209588_1002557
464 Ga0209588_1011420
465 Ga0268266_10000304
466 Ga0268265_10045256
467 Ga0307515_10380950
468 Ga0265324_10018020
469 Ga0307513_10261028
470 Ga0307406_10066123
471 Ga0307407_10100465
472 Ga0307412_10141311
473 Ga0307416_100177134
474 Ga0307414_10051494
475 Ga0307411_10086932
476 Ga0307415_100016297
477 Ga0373926_0017926
478 Ga0373943_0030474
479 Ga0373946_0009195
480 Ga0373955_0112199
481 Ga0373924_0019406
482 Ga0373935_0410971
483 Ga0373927_0000874
484 Ga0373947_0001256
485 Ga0373947_0225926
486 Ga0373937_1073175
487 Ga0373925_0000525
488 Ga0373925_0022601
489 Ga0373925_0114277
490 Ga0436361_0556359
491 Ga0451577_0448991
492 Ga0453683_0038354
493 Ga0453684_0032584
494 Ga0453684_0497872
495 Ga0451576_0004206
496 Ga0495629_0221263
497 Ga0495580_0315819
498 Ga0495608_0347869
499 Ga0495618_0053058
500 Ga0495628_0215143
501 Ga0495630_0001049
502 Ga0495645_0049545
503 Ga0495667_0125852
504 Ga0495634_0034769
505 Ga0495635_0108776
506 Ga0495669_0016211
507 Ga0495613_0001660
508 Ga0495613_0023028
509 Ga0495581_0008891
510 Ga0495604_0052209
511 Ga0495604_0198629
512 Ga0495674_0010138
513 Ga0495680_0093755
514 Ga0495675_0135152
515 Ga0495684_0000162
516 Ga0496100_0107948
517 Ga0496101_0419330
518 Ga0496104_0009713
519 Ga0496104_0651439
520 Ga0496105_0080522
521 Ga0496105_0156120
522 Ga0496106_0045485
523 Ga0496106_0151328
524 Ga0496107_0068872
525 Ga0496108_0001245
526 Ga0496108_0301131
527 Ga0496109_0000776
528 Ga0496109_0033749
529 Ga0496110_0009842
530 Ga0496111_0005089
531 Ga0496112_0001988
532 Ga0496112_0035220
533 Ga0496113_0008485
534 Ga0496113_0245055
535 Ga0496113_0590018
536 Ga0496114_0076033
537 Ga0496115_0001904
538 Ga0496115_0419544
539 Ga0501031_0002486
540 Ga0501031_0461666
541 Ga0501032_0047169
542 Ga0501032_0067819
543 Ga0501032_0142574
544 Ga0501033_0021231
545 Ga0501033_0104105
546 Ga0501033_0327966
547 Ga0501034_0004246
548 Ga0501034_0129333
549 Ga0501036_0029919
550 Ga0501036_0067829
551 Ga0501037_0186239
552 Ga0501037_0258165
553 Ga0501038_0202997
554 Ga0501038_0275517
555 Ga0501038_0507217
556 Ga0501039_0001386
557 Ga0501039_0016094
558 Ga0501039_0040568
559 Ga0501040_0024254
560 Ga0501041_0001491
561 Ga0501041_0002016
562 Ga0501042_0013385
563 Ga0501042_0046804
564 Ga0501042_0074970
565 Ga0501043_0150094
566 Ga0501043_0307941
567 Ga0501046_0006289
568 Ga0501046_0019022
569 Ga0501046_0026859
570 Ga0501047_0000952
571 Ga0501047_0091854
572 Ga0501048_0334271
573 Ga0501068_0050560
574 Ga0501068_0312857
575 Ga0501071_0014715
576 Ga0501071_0037499
577 Ga0501071_0042350
578 Ga0501072_0013750
579 Ga0501072_0020634
580 Ga0501074_0002860
581 Ga0501075_0002856
582 Ga0501075_0042928
583 Ga0501075_0143533
584 Ga0501076_0001878
585 Ga0501076_0004544
586 Ga0501076_0040763
587 Ga0501077_0006021
588 Ga0501077_0010738
589 Ga0501077_0234770
590 Ga0501077_0639407
591 Ga0501261_022522
592 Ga0501079_0042853
593 Ga0501080_0565895
594 Ga0501081_0003965
595 Ga0501081_0007357
596 Ga0501081_0012375
597 Ga0501081_0012390
598 Ga0501081_0210867
599 Ga0501081_0613561
600 Ga0501035_0001026
601 Ga0501035_0206773
602 Ga0501044_0010581
603 Ga0501045_0002228
604 Ga0501045_0005660
605 Ga0501045_0068675
606 Ga0501045_0104971
607 nmdc:mga05p37_122744_c1
608 nmdc:mga05p37_148510_c1
609 nmdc:mga05p37_245863_c1
610 nmdc:mga09592_418427_c1
611 nmdc:mga09592_437037_c1
612 nmdc:mga09592_78175_c1
613 nmdc:mga09592_82937_c1
614 nmdc:mga0qj67_161398_c1
615 nmdc:mga0qj67_190215_c1
616 nmdc:mga0qj67_366992_c1
617 nmdc:mga06r32_241571_c1
618 nmdc:mga06r32_348004_c1
619 nmdc:mga06r32_620698_c1
620 nmdc:mga08y16_107166_c1
621 nmdc:mga08y16_152532_c1
622 nmdc:mga08y16_318490_c1
623 nmdc:mga08y16_46878_c1
624 nmdc:mga08y16_6549_c1
625 nmdc:mga0n895_557560_c1
626 nmdc:mga0n895_6301_c1
627 nmdc:mga0rr50_363928_c1
628 Ga0495601_0002009
629 Ga0495595_0156129
630 Ga0495619_0006796
631 Ga0501084_0002911
632 Ga0501084_0004960
633 Ga0501082_0020639
634 Ga0501082_0030895
635 Ga0501082_0191047
636 Ga0530510_0002152
637 Ga0530510_0013677
638 Ga0530510_0052540
639 2688069065
640 2688391509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

244

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8494 9 245
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8427 8 245
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.7982 8 245
4y7t-assembly1.cif.gz_A structural analysis of muru 0.7957 2 239
7d73-assembly1.cif.gz_F cryo-em structure of gmppa/gmppb complex bound to gtp (state i) 0.7848 9 236
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8427 8 245 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7982 8 245 3.90.550.10
af_K7LRM0_18_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7712 88 222 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7643 2 238 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7604 2 238 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7Y2C8T6-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9836 5 111 GO:0047343
AF-A0A2V5YUL8-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9787 29 253 GO:0047343
AF-A0A2V5YUL8-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9744 29 253 GO:0047343
AF-A0A2V5QWW3-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9664 2 233 GO:0009058
GO:0047343
AF-A0A3B8ZAJ3-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9611 2 253 GO:0009058
GO:0047343

Map