F405425

General Info

Members Datasets Scaffolds Average Seq Length
320 236 640 423

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100002849|Ga0070706_1000028497
Length 469
Sequence VSARVTVVGLGKIGLPLAVQIAGKGFRVWGADTSPDVAGHVCGGRVPFPGEPGLAGRLSDVVAAGRLTATTDTADAVSSSDVVIIIVPLVMGASGRPDYASVDAATAAVASGLRPGTLVSYETTLPVHTTRHRLAPALAAGCGLRPGMDFALCHSPERVSSGRVFADLRRYPKLVGGIDVASGENATAFYESILDFDERPDLPRRNGVWDLGSAEAAELAKLAETTYRDVNIALANEFARFAAAAGLDAYRVIEAANSQPFSHIHRPGISVGGHCIPVYPHLYLAGDPDARLPAIAREINDAVPGEAVRLLAGMTGGLARLRVAVLGAAYRAGVKETAFSGVFAIVSELRRSGAVPVVHDPLYTAAELARLGLPPYSLGEPCDAAILHTDHRGYAALTPADLPGIRALLDGRAITDPGLWTAVPRKVLGIGTPPRSATGPDQRPRGHARDDRALGLVMGDNGARADRGA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
81 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
101 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
102 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
105 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 2501939600 Micromonospora sp. L5 Isolate Unclassified
187 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
188 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
189 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
190 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
191 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
192 2643221548 Streptomyces sp. Root55 Isolate Unclassified
193 2643221576 Nocardioides sp. Root614 Isolate Unclassified
194 2643221578 Streptomyces sp. Root63 Isolate Unclassified
195 2643221590 Nocardioides sp. Root682 Isolate Unclassified
196 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
197 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
198 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
199 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
200 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
201 2643221714 Streptomyces sp. Root264 Isolate Unclassified
202 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
203 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
204 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
205 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
206 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
207 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
208 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
209 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
210 2855683550 Micromonospora sp. RP3T Isolate Unclassified
211 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
212 2858868258 Micromonospora sp. MH33 Isolate Unclassified
213 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
214 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
215 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
216 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
217 2902582711 Micromonospora sp. AP08 Isolate Unclassified
218 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
219 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
220 2919395869 Microbacterium resistens 2980 Isolate Unclassified
221 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
222 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
223 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
224 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
225 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
226 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
227 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
228 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
229 649633069 Micromonospora sp. L5 Isolate Unclassified
230 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
231 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
232 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
233 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
234 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
235 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
236 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.75
Metatranscriptomes 0
Isolates 16.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0.31
Rhizoplane 8.44
Rhizosphere 74.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100002849 3300005467 Bacteria 17264
2 JGI24740J21852_10000214 3300001979 Bacteria 24313
3 JGI25406J46586_10016922 3300003203 Bacteria 3025
4 JGI25153J46596_10026978 3300003215 Bacteria 2021
5 rootH2_10003015 3300003320 Bacteria 8405
6 rootH1_10004737 3300003323 Bacteria 9954
7 Ga0070658_10039947 3300005327 Bacteria 3785
8 Ga0070676_10090266 3300005328 Bacteria 1876
9 Ga0070682_100001411 3300005337 Bacteria 13527
10 Ga0068868_100003682 3300005338 Bacteria 10709
11 Ga0068868_100211489 3300005338 Bacteria 1621
12 Ga0070660_100002206 3300005339 Bacteria 13418
13 Ga0070660_100018928 3300005339 Bacteria 5041
14 Ga0070669_100067420 3300005353 Bacteria 2640
15 Ga0070659_100000002 3300005366 Bacteria 369239
16 Ga0070659_100000652 3300005366 Bacteria 25359
17 Ga0070659_100002540 3300005366 Bacteria 12978
18 Ga0070709_10053457 3300005434 Bacteria 2543
19 Ga0070714_100000457 3300005435 Bacteria 29655
20 Ga0070714_100005078 3300005435 Bacteria 10013
21 Ga0070714_100072384 3300005435 Bacteria 2984
22 Ga0070713_100244177 3300005436 Bacteria 1636
23 Ga0070710_10000007 3300005437 Bacteria 215320
24 Ga0070705_100019366 3300005440 Bacteria 3582
25 Ga0070708_100225932 3300005445 Bacteria 1756
26 Ga0070678_100049103 3300005456 Bacteria 3043
27 Ga0070685_10121889 3300005466 Bacteria 1620
28 Ga0070698_100002084 3300005471 Bacteria 22205
29 Ga0070698_100017184 3300005471 Bacteria 7624
30 Ga0070665_100001808 3300005548 Bacteria 24253
31 Ga0070665_100046477 3300005548 Bacteria 4361
32 Ga0070665_100259261 3300005548 Bacteria 1740
33 Ga0070664_100087109 3300005564 Bacteria 2699
34 Ga0068857_100061234 3300005577 Bacteria 3344
35 Ga0068854_100053793 3300005578 Bacteria 2892
36 Ga0068856_100034628 3300005614 Bacteria 4945
37 Ga0068852_100200895 3300005616 Bacteria 1886
38 Ga0068866_10008834 3300005718 Bacteria 4258
39 Ga0068861_100015867 3300005719 Bacteria 5319
40 Ga0081455_10103492 3300005937 Bacteria 2280
41 Ga0081538_10000733 3300005981 Bacteria 35847
42 Ga0081540_1001056 3300005983 Bacteria 24538
43 Ga0081539_10003365 3300005985 Bacteria 19793
44 Ga0081539_10014618 3300005985 Bacteria 5785
45 Ga0081539_10033352 3300005985 Bacteria 3137
46 Ga0070717_10000005 3300006028 Bacteria 357819
47 Ga0070717_10022089 3300006028 Bacteria 5024
48 Ga0070717_10053494 3300006028 Bacteria 3328
49 Ga0075365_10093637 3300006038 Bacteria 2050
50 Ga0075364_10018018 3300006051 Bacteria 4417
51 Ga0070712_100000054 3300006175 Bacteria 57683
52 Ga0075429_100092169 3300006880 Bacteria 2643
53 Ga0105240_10100028 3300009093 Bacteria 3528
54 Ga0105243_10015409 3300009148 Bacteria 5779
55 Ga0105248_10151107 3300009177 Bacteria 2620
56 Ga0105249_10308314 3300009553 Bacteria 1590
57 Ga0105239_10009554 3300010375 Bacteria 10914
58 Ga0157369_10001226 3300013105 Bacteria 31968
59 Ga0157369_10017199 3300013105 Bacteria 8126
60 Ga0157372_10034971 3300013307 Bacteria 5529
61 Ga0157375_10351002 3300013308 Bacteria 1641
62 Ga0163163_10112009 3300014325 Bacteria 2758
63 Ga0157379_10001599 3300014968 Bacteria 18677
64 Ga0157379_10044508 3300014968 Bacteria 3962
65 Ga0157379_10092195 3300014968 Bacteria 2718
66 Ga0213876_10005648 3300021384 Bacteria 6868
67 Ga0213875_10000150 3300021388 Bacteria 73975
68 Ga0209758_1006402 3300025297 Bacteria 8478
69 Ga0207692_10000001 3300025898 Bacteria 558345
70 Ga0207688_10000381 3300025901 Bacteria 20708
71 Ga0207688_10062612 3300025901 Bacteria 2097
72 Ga0207645_10017652 3300025907 Bacteria 4706
73 Ga0207705_10062603 3300025909 Bacteria 2688
74 Ga0207684_10002496 3300025910 Bacteria 18499
75 Ga0207684_10046986 3300025910 Bacteria 3662
76 Ga0207695_10034958 3300025913 Bacteria 5456
77 Ga0207693_10000001 3300025915 Bacteria 469535
78 Ga0207662_10100977 3300025918 Bacteria 1787
79 Ga0207657_10023341 3300025919 Bacteria 5762
80 Ga0207657_10042730 3300025919 Bacteria 3997
81 Ga0207681_10077534 3300025923 Bacteria 2336
82 Ga0207687_10082644 3300025927 Bacteria 2324
83 Ga0207687_10117018 3300025927 Bacteria 1988
84 Ga0207664_10000008 3300025929 Bacteria 309301
85 Ga0207664_10000817 3300025929 Bacteria 21110
86 Ga0207664_10012424 3300025929 Bacteria 6087
87 Ga0207664_10054499 3300025929 Bacteria 3169
88 Ga0207664_10074207 3300025929 Bacteria 2747
89 Ga0207690_10000024 3300025932 Bacteria 194416
90 Ga0207690_10000219 3300025932 Bacteria 43461
91 Ga0207690_10004994 3300025932 Bacteria 7834
92 Ga0207669_10043036 3300025937 Bacteria 2642
93 Ga0207704_10056373 3300025938 Bacteria 2407
94 Ga0207689_10019262 3300025942 Bacteria 5753
95 Ga0207661_10034342 3300025944 Bacteria 3943
96 Ga0207661_10036590 3300025944 Bacteria 3833
97 Ga0207661_10235002 3300025944 Bacteria 1625
98 Ga0207640_10038496 3300025981 Bacteria 3018
99 Ga0207678_10000665 3300026067 Bacteria 31567
100 Ga0207678_10153289 3300026067 Bacteria 1968
101 Ga0207702_10176535 3300026078 Bacteria 1963
102 Ga0207648_10024365 3300026089 Bacteria 5403
103 Ga0207674_10053098 3300026116 Bacteria 4131
104 Ga0207675_100029041 3300026118 Bacteria 5153
105 Ga0268266_10023567 3300028379 Bacteria 5239
106 Ga0268266_10026200 3300028379 Bacteria 4961
107 Ga0268266_10224697 3300028379 Bacteria 1727
108 Ga0265326_10000004 3300028558 Bacteria 283947
109 Ga0265319_1000406 3300028563 Bacteria 31126
110 Ga0265334_10000019 3300028573 Bacteria 143921
111 Ga0307517_10120265 3300028786 Bacteria 1945
112 Ga0307515_10000088 3300028794 Bacteria 215810
113 Ga0265338_10002049 3300028800 Bacteria 31164
114 Ga0307513_10000001 3300031456 Bacteria 1660464
115 Ga0316576_10020157 3300031727 Bacteria 4581
116 Ga0307516_10010152 3300031730 Bacteria 10395
117 Ga0307413_10120950 3300031824 Bacteria 1773
118 Ga0307406_10047516 3300031901 Bacteria 2705
119 Ga0307407_10037695 3300031903 Bacteria 2673
120 Ga0307409_100042011 3300031995 Bacteria 3420
121 Ga0307416_100019407 3300032002 Bacteria 4819
122 Ga0307415_100017239 3300032126 Bacteria 4325
123 Ga0307507_10000007 3300033179 Bacteria 269525
124 Ga0373937_0331807 3300036401 Bacteria 1440
125 Ga0395899_0003287 3300037312 Bacteria 12816
126 Ga0395900_0055505 3300037418 Bacteria 4079
127 Ga0395898_0034709 3300037466 Bacteria 5022
128 Ga0395898_0118547 3300037466 Bacteria 2536
129 Ga0436364_0169833 3300037853 Bacteria 83429
130 Ga0395901_0006746 3300038443 Bacteria 11594
131 Ga0395901_0064244 3300038443 Bacteria 3820
132 Ga0436365_1835638 3300039437 Bacteria 10552
133 Ga0439436_0008648 3300041404 Bacteria 3129
134 Ga0439439_0000813 3300041406 Bacteria 5673
135 Ga0439466_0012891 3300041411 Bacteria 3067
136 Ga0451853_0338738 3300041512 Bacteria 5217
137 Ga0439457_004225 3300042014 Bacteria 3785
138 Ga0466966_0000718 3300044684 Bacteria 21019
139 Ga0466961_0071150 3300044693 Bacteria 2208
140 Ga0466963_0064445 3300044694 Bacteria 2455
141 Ga0466971_0000455 3300044719 Bacteria 15991
142 Ga0466970_0022844 3300044765 Bacteria 3263
143 Ga0466960_0000295 3300044901 Bacteria 17349
144 Ga0466960_0004853 3300044901 Bacteria 5286
145 Ga0466960_0020775 3300044901 Bacteria 2914
146 Ga0466959_0022611 3300045049 Bacteria 4649
147 Ga0466967_0267587 3300045976 Bacteria 1637
148 Ga0495592_0017010 3300046454 Bacteria 5522
149 Ga0495603_0003062 3300046455 Bacteria 9922
150 Ga0495629_0080495 3300046459 Bacteria 2274
151 Ga0495629_0085405 3300046459 Bacteria 2202
152 Ga0495651_0002523 3300046462 Bacteria 14171
153 Ga0495650_0000049 3300046471 Bacteria 325092
154 Ga0495584_0034818 3300046491 Bacteria 2546
155 Ga0495585_0006257 3300046492 Bacteria 7411
156 Ga0495594_0003165 3300046499 Bacteria 8515
157 Ga0495594_0003281 3300046499 Bacteria 8373
158 Ga0495618_0010977 3300046514 Bacteria 5488
159 Ga0495628_0058907 3300046516 Bacteria 3017
160 Ga0495630_0022515 3300046517 Bacteria 4654
161 Ga0495640_0021338 3300046533 Bacteria 4755
162 Ga0495657_0041079 3300046675 Bacteria 3168
163 Ga0495623_0045793 3300046679 Bacteria 2777
164 Ga0495646_0055489 3300046680 Bacteria 2379
165 Ga0495613_0003133 3300046689 Bacteria 12387
166 Ga0495604_0003001 3300047317 Bacteria 13501
167 Ga0495672_0001687 3300047320 Bacteria 21390
168 Ga0495602_0197356 3300048088 Bacteria 1538
169 Ga0496100_0020016 3300048903 Bacteria 4005
170 Ga0496100_0132745 3300048903 Bacteria 1756
171 Ga0496101_0055591 3300048904 Bacteria 2859
172 Ga0496102_0060488 3300048905 Bacteria 3464
173 Ga0496104_0013013 3300048907 Bacteria 7492
174 Ga0496104_0252624 3300048907 Bacteria 1676
175 Ga0496105_0050809 3300048908 Bacteria 3425
176 Ga0496105_0060822 3300048908 Bacteria 3117
177 Ga0496105_0076239 3300048908 Bacteria 2769
178 Ga0496106_0010336 3300048909 Bacteria 6897
179 Ga0496106_0133135 3300048909 Bacteria 1951
180 Ga0496107_0032786 3300048910 Bacteria 3714
181 Ga0496108_0009990 3300048911 Bacteria 7693
182 Ga0496108_0062551 3300048911 Bacteria 3134
183 Ga0496108_0067353 3300048911 Bacteria 3020
184 Ga0496109_0000385 3300048912 Bacteria 40032
185 Ga0496109_0030453 3300048912 Bacteria 4836
186 Ga0496109_0052461 3300048912 Bacteria 3717
187 Ga0496109_0135517 3300048912 Bacteria 2300
188 Ga0496109_0369274 3300048912 Bacteria 1355
189 Ga0496110_0002036 3300048913 Bacteria 15070
190 Ga0496110_0118702 3300048913 Bacteria 2382
191 Ga0496112_0001445 3300048915 Bacteria 18234
192 Ga0496112_0003642 3300048915 Bacteria 12833
193 Ga0496112_0006798 3300048915 Bacteria 10080
194 Ga0496112_0031487 3300048915 Bacteria 5146
195 Ga0496112_0066851 3300048915 Bacteria 3547
196 Ga0496118_0004112 3300048921 Bacteria 17615
197 Ga0496120_0022376 3300048923 Bacteria 3977
198 Ga0496121_0003289 3300048924 Bacteria 23206
199 Ga0496121_0024497 3300048924 Bacteria 5768
200 Ga0496126_0019602 3300048929 Bacteria 6659
201 Ga0501031_0043148 3300049568 Bacteria 2944
202 Ga0501031_0052348 3300049568 Bacteria 2660
203 Ga0501032_0000349 3300049569 Bacteria 38615
204 Ga0501034_0010201 3300049571 Bacteria 9799
205 Ga0501034_0020333 3300049571 Bacteria 6776
206 Ga0501036_0113030 3300049572 Bacteria 2295
207 Ga0501038_0039902 3300049574 Bacteria 4104
208 Ga0501039_0083883 3300049575 Bacteria 2482
209 Ga0501039_0115870 3300049575 Bacteria 2097
210 Ga0501040_0004569 3300049576 Bacteria 8985
211 Ga0501040_0011667 3300049576 Bacteria 5750
212 Ga0501040_0047492 3300049576 Bacteria 2931
213 Ga0501041_0003724 3300049577 Bacteria 8763
214 Ga0501041_0012262 3300049577 Bacteria 5077
215 Ga0501042_0008134 3300049578 Bacteria 6908
216 Ga0501042_0013988 3300049578 Bacteria 5468
217 Ga0501043_0014127 3300049579 Bacteria 6248
218 Ga0501046_0016157 3300049580 Bacteria 6259
219 Ga0501046_0136132 3300049580 Bacteria 1860
220 Ga0501047_0005214 3300049581 Bacteria 12201
221 Ga0501047_0170693 3300049581 Bacteria 2044
222 Ga0501047_0182944 3300049581 Bacteria 1962
223 Ga0501048_0002522 3300049582 Bacteria 13989
224 Ga0501048_0172035 3300049582 Bacteria 1534
225 Ga0501067_0002254 3300049583 Bacteria 10636
226 Ga0501068_0007551 3300049584 Bacteria 6017
227 Ga0501068_0028817 3300049584 Bacteria 3286
228 Ga0501069_0005929 3300049585 Bacteria 6371
229 Ga0501069_0029063 3300049585 Bacteria 3033
230 Ga0501070_0032695 3300049586 Bacteria 4354
231 Ga0501071_0005879 3300049587 Bacteria 7931
232 Ga0501071_0006593 3300049587 Bacteria 7541
233 Ga0501071_0009815 3300049587 Bacteria 6390
234 Ga0501072_0000317 3300049588 Bacteria 34327
235 Ga0501072_0009655 3300049588 Bacteria 7340
236 Ga0501074_0007301 3300049590 Bacteria 7990
237 Ga0501074_0077767 3300049590 Bacteria 2381
238 Ga0501076_0014122 3300049592 Bacteria 6005
239 Ga0501076_0014777 3300049592 Bacteria 5887
240 Ga0501076_0024024 3300049592 Bacteria 4706
241 Ga0501077_0011094 3300049593 Bacteria 5622
242 Ga0501079_0008485 3300049741 Bacteria 7789
243 Ga0501079_0015465 3300049741 Bacteria 5823
244 Ga0501079_0112964 3300049741 Bacteria 2111
245 Ga0501080_0014852 3300049742 Bacteria 7171
246 Ga0501080_0019197 3300049742 Bacteria 6330
247 Ga0501081_0065504 3300049743 Bacteria 2525
248 Ga0501083_0003239 3300049744 Bacteria 11358
249 Ga0501083_0005194 3300049744 Bacteria 9212
250 Ga0501035_0085235 3300049822 Bacteria 2785
251 Ga0501044_0020537 3300049823 Bacteria 7052
252 Ga0501045_0001629 3300049824 Bacteria 15048
253 Ga0501045_0008995 3300049824 Bacteria 6976
254 nmdc:mga0yw44_108625_c1 3300050492 Bacteria 1775
255 nmdc:mga0yw44_179882_c1 3300050492 Bacteria 1391
256 nmdc:mga09592_1226_c2 3300050508 Bacteria 19678
257 Ga0500560_000531 3300053107 Bacteria 5405
258 Ga0500573_0032188 3300053140 Bacteria 3026
259 Ga0500588_0005121 3300053146 Bacteria 2892
260 Ga0500616_0002702 3300053153 Bacteria 14418
261 Ga0501084_0014795 3300054114 Bacteria 6471
262 Ga0501084_0035831 3300054114 Bacteria 4147
263 Ga0501084_0083232 3300054114 Bacteria 2685
264 Ga0501082_0002650 3300060353 Bacteria 15649
265 Ga0466962_0000347 3300061719 Bacteria 19854
266 Ga0530510_0039694 3300061734 Bacteria 3398
267 Ga0530510_0085149 3300061734 Bacteria 2303
268 Ga0530510_0149095 3300061734 Bacteria 1726
269 2501945204 2501939600 Bacteria 6907073
270 2515755379 2515154137 Bacteria 5711575
271 2516090014 2515154203 Bacteria 5458536
272 2554258590 2554235005 Bacteria 6457341
273 2585301896 2582581312 Bacteria 7308206
274 2623587743 2622736626 Bacteria 7181580
275 2643759749 2643221548 Bacteria 8053412
276 2643892772 2643221576 Bacteria 5214352
277 2643897874 2643221578 Bacteria 9213798
278 2643962221 2643221590 Bacteria 5214697
279 2644013481 2643221601 Bacteria 7493239
280 2644179338 2643221631 Bacteria 8168043
281 2644409019 2643221673 Bacteria 9196637
282 2644436375 2643221678 Bacteria 9540101
283 2644462834 2643221682 Bacteria 6743283
284 2644625776 2643221714 Bacteria 9015452
285 2731908759 2731639228 Bacteria 4187555
286 2799184787 2799112218 Bacteria 4315149
287 2808841263 2808606359 Bacteria 9866990
288 2808919940 2808606375 Bacteria 9466072
289 2811848267 2808606982 Bacteria 7791042
290 2819693682 2818991463 Bacteria 7948711
291 2837269294 2837268691 Bacteria 7850704
292 2848552965 2848551377 Bacteria 3720646
293 2855683673 2855683550 Bacteria 7134265
294 2856861762 2856858025 Bacteria 7255264
295 2858868637 2858868258 Bacteria 7683772
296 2861521366 2861520306 Bacteria 8348283
297 2875393784 2875391855 Bacteria 7600475
298 2887483674 2887478801 Bacteria 8972725
299 2897564089 2897561785 Bacteria 3256946
300 2902586944 2902582711 Bacteria 6187705
301 2904431422 2904430863 Bacteria 3486923
302 2912759919 2912757875 Bacteria 7940295
303 2919396792 2919395869 Bacteria 3704152
304 2919468665 2919468124 Bacteria 9133025
305 2928091146 2928090899 Bacteria 3158267
306 2945970820 2945968032 Bacteria 4111363
307 2945971275 2945968032 Bacteria 4111363
308 2946050868 2946045630 Bacteria 8527308
309 2946075207 2946072368 Bacteria 8999607
310 2966603292 2966598605 Bacteria 7676064
311 2995728807 2995726249 Bacteria 3470435
312 2996221797 2996221748 Bacteria 6799777
313 649812362 649633069 Bacteria 6962533
314 8001782536 8001781756 Bacteria 9586736
315 8002812255 8002811521 Bacteria 2942897
316 8003857007 8003856774 Bacteria 7675274
317 8004213561 8004212874 Bacteria 2861420
318 8025535122 8025530807 Bacteria 8495698
319 8055414613 8055412473 Bacteria 6257500
320 8056056928 8056054917 Bacteria 5736694
321 Ga0070706_100002849
322 JGI24740J21852_10000214
323 JGI25406J46586_10016922
324 JGI25153J46596_10026978
325 rootH2_10003015
326 rootH1_10004737
327 Ga0070658_10039947
328 Ga0070676_10090266
329 Ga0070682_100001411
330 Ga0068868_100003682
331 Ga0068868_100211489
332 Ga0070660_100002206
333 Ga0070660_100018928
334 Ga0070669_100067420
335 Ga0070659_100000002
336 Ga0070659_100000652
337 Ga0070659_100002540
338 Ga0070709_10053457
339 Ga0070714_100000457
340 Ga0070714_100005078
341 Ga0070714_100072384
342 Ga0070713_100244177
343 Ga0070710_10000007
344 Ga0070705_100019366
345 Ga0070708_100225932
346 Ga0070678_100049103
347 Ga0070685_10121889
348 Ga0070698_100002084
349 Ga0070698_100017184
350 Ga0070665_100001808
351 Ga0070665_100046477
352 Ga0070665_100259261
353 Ga0070664_100087109
354 Ga0068857_100061234
355 Ga0068854_100053793
356 Ga0068856_100034628
357 Ga0068852_100200895
358 Ga0068866_10008834
359 Ga0068861_100015867
360 Ga0081455_10103492
361 Ga0081538_10000733
362 Ga0081540_1001056
363 Ga0081539_10003365
364 Ga0081539_10014618
365 Ga0081539_10033352
366 Ga0070717_10000005
367 Ga0070717_10022089
368 Ga0070717_10053494
369 Ga0075365_10093637
370 Ga0075364_10018018
371 Ga0070712_100000054
372 Ga0075429_100092169
373 Ga0105240_10100028
374 Ga0105243_10015409
375 Ga0105248_10151107
376 Ga0105249_10308314
377 Ga0105239_10009554
378 Ga0157369_10001226
379 Ga0157369_10017199
380 Ga0157372_10034971
381 Ga0157375_10351002
382 Ga0163163_10112009
383 Ga0157379_10001599
384 Ga0157379_10044508
385 Ga0157379_10092195
386 Ga0213876_10005648
387 Ga0213875_10000150
388 Ga0209758_1006402
389 Ga0207692_10000001
390 Ga0207688_10000381
391 Ga0207688_10062612
392 Ga0207645_10017652
393 Ga0207705_10062603
394 Ga0207684_10002496
395 Ga0207684_10046986
396 Ga0207695_10034958
397 Ga0207693_10000001
398 Ga0207662_10100977
399 Ga0207657_10023341
400 Ga0207657_10042730
401 Ga0207681_10077534
402 Ga0207687_10082644
403 Ga0207687_10117018
404 Ga0207664_10000008
405 Ga0207664_10000817
406 Ga0207664_10012424
407 Ga0207664_10054499
408 Ga0207664_10074207
409 Ga0207690_10000024
410 Ga0207690_10000219
411 Ga0207690_10004994
412 Ga0207669_10043036
413 Ga0207704_10056373
414 Ga0207689_10019262
415 Ga0207661_10034342
416 Ga0207661_10036590
417 Ga0207661_10235002
418 Ga0207640_10038496
419 Ga0207678_10000665
420 Ga0207678_10153289
421 Ga0207702_10176535
422 Ga0207648_10024365
423 Ga0207674_10053098
424 Ga0207675_100029041
425 Ga0268266_10023567
426 Ga0268266_10026200
427 Ga0268266_10224697
428 Ga0265326_10000004
429 Ga0265319_1000406
430 Ga0265334_10000019
431 Ga0307517_10120265
432 Ga0307515_10000088
433 Ga0265338_10002049
434 Ga0307513_10000001
435 Ga0316576_10020157
436 Ga0307516_10010152
437 Ga0307413_10120950
438 Ga0307406_10047516
439 Ga0307407_10037695
440 Ga0307409_100042011
441 Ga0307416_100019407
442 Ga0307415_100017239
443 Ga0307507_10000007
444 Ga0373937_0331807
445 Ga0395899_0003287
446 Ga0395900_0055505
447 Ga0395898_0034709
448 Ga0395898_0118547
449 Ga0436364_0169833
450 Ga0395901_0006746
451 Ga0395901_0064244
452 Ga0436365_1835638
453 Ga0439436_0008648
454 Ga0439439_0000813
455 Ga0439466_0012891
456 Ga0451853_0338738
457 Ga0439457_004225
458 Ga0466966_0000718
459 Ga0466961_0071150
460 Ga0466963_0064445
461 Ga0466971_0000455
462 Ga0466970_0022844
463 Ga0466960_0000295
464 Ga0466960_0004853
465 Ga0466960_0020775
466 Ga0466959_0022611
467 Ga0466967_0267587
468 Ga0495592_0017010
469 Ga0495603_0003062
470 Ga0495629_0080495
471 Ga0495629_0085405
472 Ga0495651_0002523
473 Ga0495650_0000049
474 Ga0495584_0034818
475 Ga0495585_0006257
476 Ga0495594_0003165
477 Ga0495594_0003281
478 Ga0495618_0010977
479 Ga0495628_0058907
480 Ga0495630_0022515
481 Ga0495640_0021338
482 Ga0495657_0041079
483 Ga0495623_0045793
484 Ga0495646_0055489
485 Ga0495613_0003133
486 Ga0495604_0003001
487 Ga0495672_0001687
488 Ga0495602_0197356
489 Ga0496100_0020016
490 Ga0496100_0132745
491 Ga0496101_0055591
492 Ga0496102_0060488
493 Ga0496104_0013013
494 Ga0496104_0252624
495 Ga0496105_0050809
496 Ga0496105_0060822
497 Ga0496105_0076239
498 Ga0496106_0010336
499 Ga0496106_0133135
500 Ga0496107_0032786
501 Ga0496108_0009990
502 Ga0496108_0062551
503 Ga0496108_0067353
504 Ga0496109_0000385
505 Ga0496109_0030453
506 Ga0496109_0052461
507 Ga0496109_0135517
508 Ga0496109_0369274
509 Ga0496110_0002036
510 Ga0496110_0118702
511 Ga0496112_0001445
512 Ga0496112_0003642
513 Ga0496112_0006798
514 Ga0496112_0031487
515 Ga0496112_0066851
516 Ga0496118_0004112
517 Ga0496120_0022376
518 Ga0496121_0003289
519 Ga0496121_0024497
520 Ga0496126_0019602
521 Ga0501031_0043148
522 Ga0501031_0052348
523 Ga0501032_0000349
524 Ga0501034_0010201
525 Ga0501034_0020333
526 Ga0501036_0113030
527 Ga0501038_0039902
528 Ga0501039_0083883
529 Ga0501039_0115870
530 Ga0501040_0004569
531 Ga0501040_0011667
532 Ga0501040_0047492
533 Ga0501041_0003724
534 Ga0501041_0012262
535 Ga0501042_0008134
536 Ga0501042_0013988
537 Ga0501043_0014127
538 Ga0501046_0016157
539 Ga0501046_0136132
540 Ga0501047_0005214
541 Ga0501047_0170693
542 Ga0501047_0182944
543 Ga0501048_0002522
544 Ga0501048_0172035
545 Ga0501067_0002254
546 Ga0501068_0007551
547 Ga0501068_0028817
548 Ga0501069_0005929
549 Ga0501069_0029063
550 Ga0501070_0032695
551 Ga0501071_0005879
552 Ga0501071_0006593
553 Ga0501071_0009815
554 Ga0501072_0000317
555 Ga0501072_0009655
556 Ga0501074_0007301
557 Ga0501074_0077767
558 Ga0501076_0014122
559 Ga0501076_0014777
560 Ga0501076_0024024
561 Ga0501077_0011094
562 Ga0501079_0008485
563 Ga0501079_0015465
564 Ga0501079_0112964
565 Ga0501080_0014852
566 Ga0501080_0019197
567 Ga0501081_0065504
568 Ga0501083_0003239
569 Ga0501083_0005194
570 Ga0501035_0085235
571 Ga0501044_0020537
572 Ga0501045_0001629
573 Ga0501045_0008995
574 nmdc:mga0yw44_108625_c1
575 nmdc:mga0yw44_179882_c1
576 nmdc:mga09592_1226_c2
577 Ga0500560_000531
578 Ga0500573_0032188
579 Ga0500588_0005121
580 Ga0500616_0002702
581 Ga0501084_0014795
582 Ga0501084_0035831
583 Ga0501084_0083232
584 Ga0501082_0002650
585 Ga0466962_0000347
586 Ga0530510_0039694
587 Ga0530510_0085149
588 Ga0530510_0149095
589 2501945204
590 2515755379
591 2516090014
592 2554258590
593 2585301896
594 2623587743
595 2643759749
596 2643892772
597 2643897874
598 2643962221
599 2644013481
600 2644179338
601 2644409019
602 2644436375
603 2644462834
604 2644625776
605 2731908759
606 2799184787
607 2808841263
608 2808919940
609 2811848267
610 2819693682
611 2837269294
612 2848552965
613 2855683673
614 2856861762
615 2858868637
616 2861521366
617 2875393784
618 2887483674
619 2897564089
620 2902586944
621 2904431422
622 2912759919
623 2919396792
624 2919468665
625 2928091146
626 2945970820
627 2945971275
628 2946050868
629 2946075207
630 2966603292
631 2995728807
632 2996221797
633 649812362
634 8001782536
635 8002812255
636 8003857007
637 8004213561
638 8025535122
639 8055414613
640 8056056928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03721

UDPG_MGDP_dh_N

UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

3

189

0.93

PF00984

UDPG_MGDP_dh

UDP-glucose/GDP-mannose dehydrogenase family, central domain

215

302

0.89

PF03720

UDPG_MGDP_dh_C

UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain

324

417

0.88

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

4

144

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.956 3 33
3zdn-assembly2.cif.gz_D d11-c mutant of monoamine oxidase from aspergillus niger 0.9434 3 31
6cr0-assembly1.cif.gz_A 1.55 a resolution structure of (s)-6-hydroxynicotine oxidase from shinella hzn7 0.9428 3 33
2vvm-assembly1.cif.gz_A the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.9388 3 31
2vvm-assembly1.cif.gz_B the structure of mao-n-d5, a variant of monoamine oxidase from aspergillus niger. 0.937 3 31
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9656 3 31 3.50.50.60
4xr9B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 3 198 3.40.50.720
4cnjC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.952 3 33 3.50.50.60
4r16B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9459 2 212 3.40.50.720
4r16B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 2 212 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A095ZI80-F1-model_v4 Nucleotide sugar dehydrogenase 0.9852 94 280 GO:0000271
GO:0016616
GO:0016628
GO:0051287
AF-A0A3C1FD39-F1-model_v4 Nucleotide sugar dehydrogenase 0.985 1 312 GO:0000271
GO:0016616
GO:0016628
GO:0051287
AF-A0A3A8SSB6-F1-model_v4 deleted 0.9836 316 428
AF-W4TVD3-F1-model_v4 deleted 0.9832 1 319
AF-A0A3N5K6H8-F1-model_v4 UDP-glucose/GDP-mannose dehydrogenase N-terminal domain-containing protein 0.9824 1 197 GO:0000271
GO:0016616
GO:0016628
GO:0051287

Map