F405356

General Info

Members Datasets Scaffolds Average Seq Length
320 176 641 69

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10236802|rootH2_102368021
Length 81
Sequence LHEDYQYKKTKIYTMKKLSVLLLLMLAFTATFAQQNTTVEMADALRSSGKIYVVITTIAIVFIGLAIYLFAIDRRLKKLEK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
130 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
133 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
164 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
169 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
174 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
175 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 1.56
Rhizosphere 81.88
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10236802 3300003320 Bacteria 2265
2 JGI24737J22298_10001071 3300001990 Bacteria 9660
3 JGI24735J21928_10000006 3300002067 Bacteria 339303
4 JGI24744J21845_10010113 3300002077 Bacteria 1934
5 JGI25162J39368_1000046 3300002737 Bacteria 169695
6 JGI25162J39368_1001380 3300002737 Bacteria 13335
7 JGI25157J39369_1015465 3300002741 Bacteria 939
8 JGI25157J39369_1016410 3300002741 Bacteria 906
9 JGI25164J39214_1002070 3300002772 Bacteria 3461
10 JGI25165J46597_1003150 3300003214 Bacteria 4383
11 rootH1_10043432 3300003316 Bacteria 19858
12 rootH1_10043432 3300003323 Bacteria 7287
13 rootH2_10006566 3300003320 Bacteria 99379
14 rootH2_10221717 3300003320 Bacteria 2211
15 rootH1_10010186 3300003323 Bacteria 30481
16 rootH1_10115523 3300003323 Bacteria 2369
17 rootH1_10239003 3300003323 Bacteria 1084
18 Ga0055536_1000001 3300003781 Bacteria 630663
19 Ga0055530_10001734 3300003791 Bacteria 15300
20 Ga0065714_10084966 3300005288 Bacteria 2171
21 Ga0070658_10077873 3300005327 Bacteria 2720
22 Ga0070658_10311815 3300005327 Bacteria 1342
23 Ga0070676_10004438 3300005328 Bacteria 7380
24 Ga0070683_100052502 3300005329 Bacteria 3777
25 Ga0068868_100023430 3300005338 Bacteria 4672
26 Ga0068868_102142208 3300005338 Bacteria 532
27 Ga0070660_100064780 3300005339 Bacteria 2844
28 Ga0070671_100007471 3300005355 Bacteria 8736
29 Ga0070673_100002056 3300005364 Bacteria 12136
30 Ga0070673_101021812 3300005364 Bacteria 770
31 Ga0070659_100255809 3300005366 Bacteria 1452
32 Ga0070711_101928236 3300005439 Bacteria 519
33 Ga0070678_100010398 3300005456 Bacteria 5683
34 Ga0070662_100000030 3300005457 Bacteria 81418
35 Ga0068867_100001243 3300005459 Bacteria 17541
36 Ga0070684_100249190 3300005535 Bacteria 1623
37 Ga0068853_100006223 3300005539 Bacteria 9455
38 Ga0068853_100095287 3300005539 Bacteria 2624
39 Ga0068853_102083298 3300005539 Bacteria 550
40 Ga0070672_100214796 3300005543 Bacteria 1612
41 Ga0068855_100000009 3300005563 Bacteria 246035
42 Ga0068855_100003439 3300005563 Bacteria 19374
43 Ga0068855_100028521 3300005563 Bacteria 6677
44 Ga0068855_100923459 3300005563 Bacteria 921
45 Ga0068854_100610816 3300005578 Bacteria 932
46 Ga0068856_100046870 3300005614 Bacteria 4258
47 Ga0068856_100300663 3300005614 Bacteria 1622
48 Ga0068856_101587233 3300005614 Bacteria 668
49 Ga0068852_100002407 3300005616 Bacteria 12895
50 Ga0068852_101260088 3300005616 Bacteria 761
51 Ga0068851_10185450 3300005834 Bacteria 1154
52 Ga0068870_10122947 3300005840 Bacteria 1497
53 Ga0068863_100541317 3300005841 Bacteria 1149
54 Ga0068858_101570795 3300005842 Unclassified 649
55 Ga0075369_10400560 3300006186 Bacteria 647
56 Ga0075369_10546961 3300006186 Bacteria 552
57 Ga0075366_10071760 3300006195 Bacteria 2063
58 Ga0075366_10721571 3300006195 Bacteria 619
59 Ga0097621_100000093 3300006237 Bacteria 49437
60 Ga0075370_10138819 3300006353 Bacteria 1421
61 Ga0068871_100001507 3300006358 Bacteria 15615
62 Ga0068865_100000788 3300006881 Bacteria 17830
63 Ga0105240_10017733 3300009093 Bacteria 9585
64 Ga0105240_10018587 3300009093 Bacteria 9324
65 Ga0105240_10210896 3300009093 Bacteria 2270
66 Ga0105240_10284646 3300009093 Bacteria 1898
67 Ga0105240_10613250 3300009093 Bacteria 1197
68 Ga0105240_11082562 3300009093 Bacteria 854
69 Ga0105240_12014648 3300009093 Bacteria 600
70 Ga0105245_10192498 3300009098 Bacteria 1954
71 Ga0105243_10105394 3300009148 Bacteria 2348
72 Ga0105241_10001376 3300009174 Bacteria 18545
73 Ga0105241_10001783 3300009174 Bacteria 16342
74 Ga0105241_10611870 3300009174 Bacteria 985
75 Ga0105242_10006850 3300009176 Bacteria 8786
76 Ga0105237_10001246 3300009545 Bacteria 33969
77 Ga0105237_10001416 3300009545 Bacteria 31687
78 Ga0105237_10014458 3300009545 Bacteria 8251
79 Ga0105237_10020840 3300009545 Bacteria 6751
80 Ga0105237_10163204 3300009545 Bacteria 2227
81 Ga0105237_12521963 3300009545 Unclassified 525
82 Ga0105238_10205478 3300009551 Bacteria 1945
83 Ga0105238_12952898 3300009551 Unclassified 511
84 Ga0105249_10659800 3300009553 Bacteria 1104
85 Ga0105239_10000002 3300010375 Bacteria 610298
86 Ga0105239_10000228 3300010375 Bacteria 82820
87 Ga0105239_10005643 3300010375 Bacteria 14625
88 Ga0105239_10047902 3300010375 Bacteria 4684
89 Ga0105239_10048473 3300010375 Bacteria 4658
90 Ga0105239_10280528 3300010375 Bacteria 1876
91 Ga0157373_10000249 3300013100 Bacteria 44077
92 Ga0157373_10011317 3300013100 Bacteria 6560
93 Ga0157373_10025458 3300013100 Bacteria 4279
94 Ga0157373_10081286 3300013100 Bacteria 2284
95 Ga0157371_10000016 3300013102 Bacteria 330495
96 Ga0157371_10006181 3300013102 Bacteria 9932
97 Ga0157371_10080940 3300013102 Bacteria 2300
98 Ga0157371_10882936 3300013102 Bacteria 677
99 Ga0157370_10000350 3300013104 Bacteria 58500
100 Ga0157370_10191337 3300013104 Bacteria 1899
101 Ga0157370_10194305 3300013104 Bacteria 1883
102 Ga0157370_10471360 3300013104 Bacteria 1154
103 Ga0157370_10617223 3300013104 Bacteria 992
104 Ga0157369_10000129 3300013105 Bacteria 108473
105 Ga0157369_10064119 3300013105 Bacteria 3957
106 Ga0157369_10143831 3300013105 Bacteria 2522
107 Ga0157374_10000203 3300013296 Bacteria 54699
108 Ga0157374_10007226 3300013296 Bacteria 9463
109 Ga0157374_10110651 3300013296 Bacteria 2642
110 Ga0157374_10429782 3300013296 Bacteria 1320
111 Ga0157374_10673170 3300013296 Bacteria 1047
112 Ga0157374_10990988 3300013296 Bacteria 859
113 Ga0157378_10030483 3300013297 Bacteria 4767
114 Ga0157378_10097932 3300013297 Bacteria 2674
115 Ga0157378_10964729 3300013297 Bacteria 886
116 Ga0157378_12208960 3300013297 Bacteria 601
117 Ga0163162_10000399 3300013306 Bacteria 39845
118 Ga0163162_10006812 3300013306 Bacteria 11085
119 Ga0163162_10008274 3300013306 Bacteria 10151
120 Ga0163162_11421947 3300013306 Bacteria 789
121 Ga0163162_12870006 3300013306 Bacteria 555
122 Ga0157372_10002801 3300013307 Bacteria 18838
123 Ga0157372_10004976 3300013307 Bacteria 14115
124 Ga0157372_10079307 3300013307 Bacteria 3713
125 Ga0157372_10114246 3300013307 Bacteria 3095
126 Ga0157372_10218342 3300013307 Bacteria 2210
127 Ga0157372_10658203 3300013307 Bacteria 1220
128 Ga0157375_10013093 3300013308 Bacteria 7373
129 Ga0157375_10078392 3300013308 Bacteria 3337
130 Ga0157375_10453835 3300013308 Bacteria 1447
131 Ga0157375_11067253 3300013308 Bacteria 945
132 Ga0157375_12665325 3300013308 Bacteria 597
133 Ga0157377_10010955 3300014745 Bacteria 4508
134 Ga0157377_10309929 3300014745 Unclassified 1045
135 Ga0157377_10757348 3300014745 Bacteria 711
136 Ga0157376_10577076 3300014969 Unclassified 1116
137 Ga0182006_1000542 3300015261 Bacteria 28640
138 Ga0182007_10000003 3300015262 Bacteria 548244
139 Ga0182007_10206088 3300015262 Bacteria 689
140 Ga0163161_10000074 3300017792 Bacteria 101784
141 Ga0163161_10000159 3300017792 Bacteria 62460
142 Ga0163161_10360033 3300017792 Bacteria 1158
143 Ga0213872_10033521 3300021361 Bacteria 2353
144 Ga0209563_111135 3300025230 Bacteria 1281
145 Ga0207427_100076 3300025231 Bacteria 149885
146 Ga0209437_100008 3300025233 Bacteria 921142
147 Ga0209437_100070 3300025233 Bacteria 306718
148 Ga0209026_1000279 3300025250 Bacteria 59283
149 Ga0209026_1004267 3300025250 Bacteria 4327
150 Ga0209026_1009259 3300025250 Bacteria 1952
151 Ga0209129_1026261 3300025258 Bacteria 1008
152 Ga0209233_1000024 3300025261 Bacteria 695418
153 Ga0209233_1016229 3300025261 Bacteria 2056
154 Ga0209676_1000008 3300025292 Bacteria 991778
155 Ga0209050_1000045 3300025298 Bacteria 388022
156 Ga0207647_10000247 3300025904 Bacteria 44109
157 Ga0207647_10660678 3300025904 Bacteria 572
158 Ga0207645_10007969 3300025907 Bacteria 7433
159 Ga0207643_10504956 3300025908 Bacteria 773
160 Ga0207654_10043347 3300025911 Bacteria 2551
161 Ga0207654_10053450 3300025911 Bacteria 2331
162 Ga0207654_10129587 3300025911 Bacteria 1595
163 Ga0207695_10012386 3300025913 Bacteria 10242
164 Ga0207695_10014337 3300025913 Bacteria 9399
165 Ga0207695_10228662 3300025913 Bacteria 1765
166 Ga0207695_10239478 3300025913 Bacteria 1716
167 Ga0207695_10273036 3300025913 Bacteria 1586
168 Ga0207695_10416296 3300025913 Bacteria 1228
169 Ga0207671_10005430 3300025914 Bacteria 11736
170 Ga0207671_10006626 3300025914 Bacteria 10273
171 Ga0207671_10012719 3300025914 Bacteria 6751
172 Ga0207671_10032104 3300025914 Bacteria 3909
173 Ga0207671_10212159 3300025914 Bacteria 1515
174 Ga0207671_10719012 3300025914 Bacteria 794
175 Ga0207657_10009743 3300025919 Bacteria 9633
176 Ga0207657_10122043 3300025919 Bacteria 2143
177 Ga0207694_10039084 3300025924 Bacteria 3650
178 Ga0207687_10212463 3300025927 Bacteria 1518
179 Ga0207644_10090203 3300025931 Bacteria 2283
180 Ga0207690_10079743 3300025932 Bacteria 2282
181 Ga0207706_10000129 3300025933 Bacteria 81280
182 Ga0207686_10024965 3300025934 Bacteria 3470
183 Ga0207669_10423352 3300025937 Bacteria 1049
184 Ga0207669_11679497 3300025937 Bacteria 542
185 Ga0207704_10000074 3300025938 Bacteria 61994
186 Ga0207691_10142837 3300025940 Bacteria 2108
187 Ga0207689_11558328 3300025942 Unclassified 551
188 Ga0207661_10036892 3300025944 Bacteria 3819
189 Ga0207667_10000045 3300025949 Bacteria 246053
190 Ga0207667_10006792 3300025949 Bacteria 13818
191 Ga0207667_10011160 3300025949 Bacteria 10456
192 Ga0207667_10099840 3300025949 Bacteria 2995
193 Ga0207667_10103296 3300025949 Bacteria 2940
194 Ga0207667_10826272 3300025949 Bacteria 922
195 Ga0207667_11414643 3300025949 Bacteria 669
196 Ga0207651_10192116 3300025960 Bacteria 1629
197 Ga0207651_10257030 3300025960 Bacteria 1432
198 Ga0207712_10468205 3300025961 Bacteria 1072
199 Ga0207640_10564972 3300025981 Bacteria 958
200 Ga0207677_10294058 3300026023 Bacteria 1339
201 Ga0207677_11020600 3300026023 Unclassified 751
202 Ga0207639_10014985 3300026041 Bacteria 5463
203 Ga0207639_10072600 3300026041 Bacteria 2695
204 Ga0207702_10000899 3300026078 Bacteria 30910
205 Ga0207702_10033727 3300026078 Bacteria 4277
206 Ga0207641_10591843 3300026088 Unclassified 1085
207 Ga0207648_10011294 3300026089 Bacteria 8420
208 Ga0207683_10003055 3300026121 Bacteria 14640
209 Ga0207698_10011691 3300026142 Bacteria 5704
210 Ga0207698_11662409 3300026142 Bacteria 654
211 Ga0307517_10000719 3300028786 Bacteria 56987
212 Ga0307515_10262128 3300028794 Bacteria 1463
213 Ga0265327_10265721 3300031251 Unclassified 761
214 Ga0307513_10582631 3300031456 Bacteria 829
215 Ga0307513_10919191 3300031456 Bacteria 583
216 Ga0307509_10505839 3300031507 Bacteria 892
217 Ga0307405_10415990 3300031731 Bacteria 1056
218 Ga0307405_11976080 3300031731 Bacteria 521
219 Ga0307413_11926549 3300031824 Unclassified 531
220 Ga0307410_11761913 3300031852 Bacteria 550
221 Ga0307406_11577827 3300031901 Bacteria 579
222 Ga0307407_10000008 3300031903 Bacteria 191228
223 Ga0307412_10048751 3300031911 Bacteria 2787
224 Ga0307412_10310918 3300031911 Bacteria 1249
225 Ga0307412_10644142 3300031911 Unclassified 903
226 Ga0307412_11007142 3300031911 Bacteria 736
227 Ga0307409_100198802 3300031995 Bacteria 1791
228 Ga0307416_100000009 3300032002 Bacteria 374271
229 Ga0307414_10003272 3300032004 Bacteria 8637
230 Ga0307414_10013944 3300032004 Bacteria 4800
231 Ga0307414_10087459 3300032004 Bacteria 2303
232 Ga0307414_10460044 3300032004 Bacteria 1118
233 Ga0307414_10510227 3300032004 Bacteria 1065
234 Ga0307411_10127873 3300032005 Bacteria 1851
235 Ga0307411_10810443 3300032005 Bacteria 825
236 Ga0307507_10005550 3300033179 Bacteria 20618
237 Ga0307510_10506081 3300033180 Bacteria 651
238 Ga0316582_0204798 3300036647 Bacteria 1347
239 Ga0316584_0396352 3300036712 Bacteria 984
240 Ga0395899_0000033 3300037312 Bacteria 306589
241 Ga0395899_0022553 3300037312 Bacteria 4771
242 Ga0395899_0024608 3300037312 Bacteria 4551
243 Ga0395900_0002719 3300037418 Bacteria 19337
244 Ga0395900_0004411 3300037418 Bacteria 14918
245 Ga0395898_0099904 3300037466 Bacteria 2787
246 Ga0395898_0101009 3300037466 Bacteria 2770
247 Ga0395905_0000379 3300037471 Bacteria 63171
248 Ga0395905_0001752 3300037471 Bacteria 25335
249 Ga0395901_0003457 3300038443 Bacteria 15913
250 Ga0395901_0022366 3300038443 Bacteria 6479
251 Ga0436361_0621820 3300039447 Bacteria 6131
252 Ga0451802_0706208 3300041460 Bacteria 771
253 Ga0451802_1038781 3300041460 Bacteria 622
254 Ga0451806_593535 3300041462 Unclassified 506
255 Ga0451807_1222358 3300041486 Bacteria 644
256 Ga0451807_2773842 3300041486 Bacteria 685
257 Ga0451833_0741036 3300041491 Bacteria 582
258 Ga0451837_1123312 3300041494 Bacteria 591
259 Ga0439448_0012542 3300042005 Bacteria 2537
260 Ga0495638_0063496 3300046460 Bacteria 2277
261 Ga0495650_0000014 3300046471 Bacteria 581606
262 Ga0495650_0045046 3300046471 Bacteria 1860
263 Ga0495585_0000081 3300046492 Bacteria 99243
264 Ga0495585_0369247 3300046492 Bacteria 695
265 Ga0495583_0036179 3300046506 Bacteria 2351
266 Ga0495606_0000020 3300046507 Bacteria 274490
267 Ga0495606_0019742 3300046507 Bacteria 4997
268 Ga0495606_0039826 3300046507 Bacteria 3161
269 Ga0495606_0436000 3300046507 Unclassified 674
270 Ga0495610_0001403 3300046512 Bacteria 21412
271 Ga0495616_0022192 3300046513 Bacteria 3429
272 Ga0495631_0004041 3300046518 Bacteria 7895
273 Ga0495631_0445925 3300046518 Bacteria 551
274 Ga0495644_0038359 3300046523 Bacteria 1807
275 Ga0495648_0176926 3300046524 Bacteria 1088
276 Ga0495652_0253477 3300046529 Unclassified 1303
277 Ga0495652_0474784 3300046529 Bacteria 871
278 Ga0495609_0017780 3300046538 Bacteria 3299
279 Ga0495633_0058194 3300046558 Bacteria 1814
280 Ga0495633_0073399 3300046558 Bacteria 1595
281 Ga0495668_0069030 3300046616 Bacteria 1944
282 Ga0495668_0516303 3300046616 Unclassified 659
283 Ga0495611_0489566 3300046648 Bacteria 559
284 Ga0495625_0000009 3300046660 Bacteria 404954
285 Ga0495625_0032312 3300046660 Bacteria 3883
286 Ga0495625_0092868 3300046660 Bacteria 2084
287 Ga0495625_0901720 3300046660 Bacteria 507
288 Ga0495661_0012768 3300046665 Bacteria 5668
289 Ga0495661_0203211 3300046665 Bacteria 1036
290 Ga0495661_0421528 3300046665 Bacteria 646
291 Ga0495670_0372619 3300046691 Bacteria 770
292 Ga0495671_0181299 3300046692 Bacteria 1023
293 Ga0495649_0000172 3300046694 Bacteria 56537
294 Ga0495649_0049757 3300046694 Bacteria 2276
295 Ga0495660_0005166 3300046810 Bacteria 7844
296 Ga0495683_0061644 3300047323 Bacteria 1857
297 Ga0495683_0130794 3300047323 Bacteria 1184
298 Ga0495687_000516 3300047443 Bacteria 46369
299 Ga0495687_007868 3300047443 Bacteria 6199
300 Ga0495687_013663 3300047443 Bacteria 4221
301 Ga0495685_029286 3300047447 Bacteria 1893
302 Ga0495686_0001273 3300047472 Bacteria 28543
303 Ga0495686_0017005 3300047472 Bacteria 4912
304 Ga0495614_0007101 3300048089 Bacteria 4995
305 Ga0501223_000841 3300049663 Bacteria 7289
306 Ga0501243_130413 3300049675 Bacteria 525
307 Ga0501250_023741 3300049680 Unclassified 812
308 nmdc:mga0k408_67853_c1 3300050493 Bacteria 2079
309 nmdc:mga07m45_705879_c1 3300050496 Bacteria 580
310 nmdc:mga0sz30_581020_c1 3300050516 Bacteria 506
311 Ga0500635_0003045 3300053080 Bacteria 4187
312 Ga0500635_0007550 3300053080 Bacteria 2952
313 Ga0500608_000271 3300053122 Bacteria 20029
314 Ga0500618_032256 3300053125 Bacteria 1226
315 Ga0500642_0060038 3300053130 Bacteria 1704
316 Ga0500652_264855 3300053131 Bacteria 676
317 Ga0500564_384746 3300053138 Bacteria 512
318 Ga0500622_0381380 3300053156 Bacteria 577
319 Ga0500624_001066 3300053157 Bacteria 5315
320 Ga0587067_161971 3300059640 Bacteria 570
321 Ga0587072_113939 3300059643 Bacteria 620
322 rootH2_10236802
323 JGI24737J22298_10001071
324 JGI24735J21928_10000006
325 JGI24744J21845_10010113
326 JGI25162J39368_1000046
327 JGI25162J39368_1001380
328 JGI25157J39369_1015465
329 JGI25157J39369_1016410
330 JGI25164J39214_1002070
331 JGI25165J46597_1003150
332 rootH1_10043432
333 rootH2_10006566
334 rootH2_10221717
335 rootH1_10010186
336 rootH1_10115523
337 rootH1_10239003
338 Ga0055536_1000001
339 Ga0055530_10001734
340 Ga0065714_10084966
341 Ga0070658_10077873
342 Ga0070658_10311815
343 Ga0070676_10004438
344 Ga0070683_100052502
345 Ga0068868_100023430
346 Ga0068868_102142208
347 Ga0070660_100064780
348 Ga0070671_100007471
349 Ga0070673_100002056
350 Ga0070673_101021812
351 Ga0070659_100255809
352 Ga0070711_101928236
353 Ga0070678_100010398
354 Ga0070662_100000030
355 Ga0068867_100001243
356 Ga0070684_100249190
357 Ga0068853_100006223
358 Ga0068853_100095287
359 Ga0068853_102083298
360 Ga0070672_100214796
361 Ga0068855_100000009
362 Ga0068855_100003439
363 Ga0068855_100028521
364 Ga0068855_100923459
365 Ga0068854_100610816
366 Ga0068856_100046870
367 Ga0068856_100300663
368 Ga0068856_101587233
369 Ga0068852_100002407
370 Ga0068852_101260088
371 Ga0068851_10185450
372 Ga0068870_10122947
373 Ga0068863_100541317
374 Ga0068858_101570795
375 Ga0075369_10400560
376 Ga0075369_10546961
377 Ga0075366_10071760
378 Ga0075366_10721571
379 Ga0097621_100000093
380 Ga0075370_10138819
381 Ga0068871_100001507
382 Ga0068865_100000788
383 Ga0105240_10017733
384 Ga0105240_10018587
385 Ga0105240_10210896
386 Ga0105240_10284646
387 Ga0105240_10613250
388 Ga0105240_11082562
389 Ga0105240_12014648
390 Ga0105245_10192498
391 Ga0105243_10105394
392 Ga0105241_10001376
393 Ga0105241_10001783
394 Ga0105241_10611870
395 Ga0105242_10006850
396 Ga0105237_10001246
397 Ga0105237_10001416
398 Ga0105237_10014458
399 Ga0105237_10020840
400 Ga0105237_10163204
401 Ga0105237_12521963
402 Ga0105238_10205478
403 Ga0105238_12952898
404 Ga0105249_10659800
405 Ga0105239_10000002
406 Ga0105239_10000228
407 Ga0105239_10005643
408 Ga0105239_10047902
409 Ga0105239_10048473
410 Ga0105239_10280528
411 Ga0157373_10000249
412 Ga0157373_10011317
413 Ga0157373_10025458
414 Ga0157373_10081286
415 Ga0157371_10000016
416 Ga0157371_10006181
417 Ga0157371_10080940
418 Ga0157371_10882936
419 Ga0157370_10000350
420 Ga0157370_10191337
421 Ga0157370_10194305
422 Ga0157370_10471360
423 Ga0157370_10617223
424 Ga0157369_10000129
425 Ga0157369_10064119
426 Ga0157369_10143831
427 Ga0157374_10000203
428 Ga0157374_10007226
429 Ga0157374_10110651
430 Ga0157374_10429782
431 Ga0157374_10673170
432 Ga0157374_10990988
433 Ga0157378_10030483
434 Ga0157378_10097932
435 Ga0157378_10964729
436 Ga0157378_12208960
437 Ga0163162_10000399
438 Ga0163162_10006812
439 Ga0163162_10008274
440 Ga0163162_11421947
441 Ga0163162_12870006
442 Ga0157372_10002801
443 Ga0157372_10004976
444 Ga0157372_10079307
445 Ga0157372_10114246
446 Ga0157372_10218342
447 Ga0157372_10658203
448 Ga0157375_10013093
449 Ga0157375_10078392
450 Ga0157375_10453835
451 Ga0157375_11067253
452 Ga0157375_12665325
453 Ga0157377_10010955
454 Ga0157377_10309929
455 Ga0157377_10757348
456 Ga0157376_10577076
457 Ga0182006_1000542
458 Ga0182007_10000003
459 Ga0182007_10206088
460 Ga0163161_10000074
461 Ga0163161_10000159
462 Ga0163161_10360033
463 Ga0213872_10033521
464 Ga0209563_111135
465 Ga0207427_100076
466 Ga0209437_100008
467 Ga0209437_100070
468 Ga0209026_1000279
469 Ga0209026_1004267
470 Ga0209026_1009259
471 Ga0209129_1026261
472 Ga0209233_1000024
473 Ga0209233_1016229
474 Ga0209676_1000008
475 Ga0209050_1000045
476 Ga0207647_10000247
477 Ga0207647_10660678
478 Ga0207645_10007969
479 Ga0207643_10504956
480 Ga0207654_10043347
481 Ga0207654_10053450
482 Ga0207654_10129587
483 Ga0207695_10012386
484 Ga0207695_10014337
485 Ga0207695_10228662
486 Ga0207695_10239478
487 Ga0207695_10273036
488 Ga0207695_10416296
489 Ga0207671_10005430
490 Ga0207671_10006626
491 Ga0207671_10012719
492 Ga0207671_10032104
493 Ga0207671_10212159
494 Ga0207671_10719012
495 Ga0207657_10009743
496 Ga0207657_10122043
497 Ga0207694_10039084
498 Ga0207687_10212463
499 Ga0207644_10090203
500 Ga0207690_10079743
501 Ga0207706_10000129
502 Ga0207686_10024965
503 Ga0207669_10423352
504 Ga0207669_11679497
505 Ga0207704_10000074
506 Ga0207691_10142837
507 Ga0207689_11558328
508 Ga0207661_10036892
509 Ga0207667_10000045
510 Ga0207667_10006792
511 Ga0207667_10011160
512 Ga0207667_10099840
513 Ga0207667_10103296
514 Ga0207667_10826272
515 Ga0207667_11414643
516 Ga0207651_10192116
517 Ga0207651_10257030
518 Ga0207712_10468205
519 Ga0207640_10564972
520 Ga0207677_10294058
521 Ga0207677_11020600
522 Ga0207639_10014985
523 Ga0207639_10072600
524 Ga0207702_10000899
525 Ga0207702_10033727
526 Ga0207641_10591843
527 Ga0207648_10011294
528 Ga0207683_10003055
529 Ga0207698_10011691
530 Ga0207698_11662409
531 Ga0307517_10000719
532 Ga0307515_10262128
533 Ga0265327_10265721
534 Ga0307513_10582631
535 Ga0307513_10919191
536 Ga0307509_10505839
537 Ga0307405_10415990
538 Ga0307405_11976080
539 Ga0307413_11926549
540 Ga0307410_11761913
541 Ga0307406_11577827
542 Ga0307407_10000008
543 Ga0307412_10048751
544 Ga0307412_10310918
545 Ga0307412_10644142
546 Ga0307412_11007142
547 Ga0307409_100198802
548 Ga0307416_100000009
549 Ga0307414_10003272
550 Ga0307414_10013944
551 Ga0307414_10087459
552 Ga0307414_10460044
553 Ga0307414_10510227
554 Ga0307411_10127873
555 Ga0307411_10810443
556 Ga0307507_10005550
557 Ga0307510_10506081
558 Ga0316582_0204798
559 Ga0316584_0396352
560 Ga0395899_0000033
561 Ga0395899_0022553
562 Ga0395899_0024608
563 Ga0395900_0002719
564 Ga0395900_0004411
565 Ga0395898_0099904
566 Ga0395898_0101009
567 Ga0395905_0000379
568 Ga0395905_0001752
569 Ga0395901_0003457
570 Ga0395901_0022366
571 Ga0436361_0621820
572 Ga0451802_0706208
573 Ga0451802_1038781
574 Ga0451806_593535
575 Ga0451807_1222358
576 Ga0451807_2773842
577 Ga0451833_0741036
578 Ga0451837_1123312
579 Ga0439448_0012542
580 Ga0495638_0063496
581 Ga0495650_0000014
582 Ga0495650_0045046
583 Ga0495585_0000081
584 Ga0495585_0369247
585 Ga0495583_0036179
586 Ga0495606_0000020
587 Ga0495606_0019742
588 Ga0495606_0039826
589 Ga0495606_0436000
590 Ga0495610_0001403
591 Ga0495616_0022192
592 Ga0495631_0004041
593 Ga0495631_0445925
594 Ga0495644_0038359
595 Ga0495648_0176926
596 Ga0495652_0253477
597 Ga0495652_0474784
598 Ga0495609_0017780
599 Ga0495633_0058194
600 Ga0495633_0073399
601 Ga0495668_0069030
602 Ga0495668_0516303
603 Ga0495611_0489566
604 Ga0495625_0000009
605 Ga0495625_0032312
606 Ga0495625_0092868
607 Ga0495625_0901720
608 Ga0495661_0012768
609 Ga0495661_0203211
610 Ga0495661_0421528
611 Ga0495670_0372619
612 Ga0495671_0181299
613 Ga0495649_0000172
614 Ga0495649_0049757
615 Ga0495660_0005166
616 Ga0495683_0061644
617 Ga0495683_0130794
618 Ga0495687_000516
619 Ga0495687_007868
620 Ga0495687_013663
621 Ga0495685_029286
622 Ga0495686_0001273
623 Ga0495686_0017005
624 Ga0495614_0007101
625 Ga0501223_000841
626 Ga0501243_130413
627 Ga0501250_023741
628 nmdc:mga0k408_67853_c1
629 nmdc:mga07m45_705879_c1
630 nmdc:mga0sz30_581020_c1
631 Ga0500635_0003045
632 Ga0500635_0007550
633 Ga0500608_000271
634 Ga0500618_032256
635 Ga0500642_0060038
636 Ga0500652_264855
637 Ga0500564_384746
638 Ga0500622_0381380
639 Ga0500624_001066
640 Ga0587067_161971
641 Ga0587072_113939

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20077

CcmD_alt

CcmD family protein

19

80

0.98

Map