F405124

General Info

Members Datasets Scaffolds Average Seq Length
319 225 638 199

Family's Representative Sequence

Representative Sequence 3300026023|Ga0207677_10410006|Ga0207677_104100061
Length 193
Sequence VPAANERITTVSQLIGIMSMSLDGFVADPDDGVAEVFDWYVSSGDVEIHTGGSAPMTFRMSEPSAEHVRTLTSELGAVLTGRRTFEVAQGWGGNHAWGPAYVLAHQVPDGWPRADSSVGKSVGVHGANTIQQLLNAGLLDELSVDVTAVLLGSGVGLFDHLAGTPAVLGSPTVTQGVGVTHLRYPVQKAQSRR

Samples

Sample ID Description Type Environment
1 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
176 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 2.82
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207677_10410006 3300026023 Bacteria 1151
2 CNAas_1003373 3300000532 Bacteria 1063
3 JGI26145J50221_1001742 3300003371 Bacteria 1712
4 Ga0065712_10073327 3300005290 Bacteria 4429
5 Ga0065707_10159569 3300005295 Bacteria 1576
6 Ga0070658_10215025 3300005327 Bacteria 1624
7 Ga0070676_10065352 3300005328 Bacteria 2171
8 Ga0070683_100169575 3300005329 Bacteria 2072
9 Ga0070683_100257006 3300005329 Bacteria 1661
10 Ga0070683_100272242 3300005329 Bacteria 1611
11 Ga0070683_101046711 3300005329 Bacteria 784
12 Ga0070690_100015327 3300005330 Bacteria 4570
13 Ga0070670_100254572 3300005331 Bacteria 1530
14 Ga0068869_100043354 3300005334 Bacteria 3231
15 Ga0068869_100046521 3300005334 Bacteria 3129
16 Ga0068869_100103132 3300005334 Bacteria 2161
17 Ga0070666_10116541 3300005335 Bacteria 1850
18 Ga0070666_10296037 3300005335 Bacteria 1152
19 Ga0070680_100068985 3300005336 Bacteria 2902
20 Ga0070680_100152529 3300005336 Bacteria 1940
21 Ga0068868_100022080 3300005338 Bacteria 4799
22 Ga0068868_100161278 3300005338 Bacteria 1852
23 Ga0070660_100338408 3300005339 Bacteria 1238
24 Ga0070689_100016259 3300005340 Bacteria 5442
25 Ga0070689_100054051 3300005340 Bacteria 3108
26 Ga0070687_100007996 3300005343 Bacteria 4451
27 Ga0070661_100002072 3300005344 Bacteria 13801
28 Ga0070668_100958302 3300005347 Bacteria 767
29 Ga0070675_100001147 3300005354 Bacteria 19118
30 Ga0070675_100018234 3300005354 Bacteria 5587
31 Ga0070675_100539577 3300005354 Bacteria 1054
32 Ga0070675_100601952 3300005354 Bacteria 997
33 Ga0070674_100000459 3300005356 Bacteria 20555
34 Ga0070674_100191530 3300005356 Bacteria 1573
35 Ga0070674_100288389 3300005356 Bacteria 1304
36 Ga0070673_100044278 3300005364 Bacteria 3445
37 Ga0070673_100367138 3300005364 Bacteria 1281
38 Ga0070688_100036778 3300005365 Bacteria 2979
39 Ga0070688_100038678 3300005365 Bacteria 2914
40 Ga0070667_100018308 3300005367 Bacteria 5806
41 Ga0070701_10023737 3300005438 Bacteria 2958
42 Ga0070711_100170110 3300005439 Bacteria 1660
43 Ga0070705_100004397 3300005440 Bacteria 6863
44 Ga0070705_100148184 3300005440 Bacteria 1553
45 Ga0070694_100046697 3300005444 Bacteria 2909
46 Ga0070708_100284217 3300005445 Bacteria 1557
47 Ga0070678_100260958 3300005456 Bacteria 1457
48 Ga0070678_100385856 3300005456 Bacteria 1213
49 Ga0070662_100064872 3300005457 Bacteria 2675
50 Ga0070681_10787925 3300005458 Bacteria 867
51 Ga0068867_100034404 3300005459 Bacteria 3672
52 Ga0070706_100062620 3300005467 Bacteria 3437
53 Ga0070706_100375515 3300005467 Bacteria 1324
54 Ga0070699_100148306 3300005518 Bacteria 2073
55 Ga0070679_100094280 3300005530 Bacteria 2980
56 Ga0070684_100039796 3300005535 Bacteria 4045
57 Ga0070684_100128544 3300005535 Bacteria 2284
58 Ga0070697_100454982 3300005536 Bacteria 1115
59 Ga0068853_100005407 3300005539 Bacteria 10005
60 Ga0070672_100006769 3300005543 Bacteria 7735
61 Ga0070686_100090762 3300005544 Bacteria 2043
62 Ga0070695_100132331 3300005545 Bacteria 1720
63 Ga0070696_100011188 3300005546 Bacteria 6005
64 Ga0070696_100229414 3300005546 Bacteria 1396
65 Ga0070693_100001824 3300005547 Bacteria 9725
66 Ga0070665_100001269 3300005548 Bacteria 30298
67 Ga0070665_100018716 3300005548 Bacteria 6943
68 Ga0070665_100048111 3300005548 Bacteria 4282
69 Ga0070665_100678866 3300005548 Bacteria 1043
70 Ga0068855_100034057 3300005563 Bacteria 6077
71 Ga0070664_100007449 3300005564 Bacteria 8836
72 Ga0070664_100042304 3300005564 Bacteria 3846
73 Ga0070664_100085846 3300005564 Bacteria 2719
74 Ga0068857_100232363 3300005577 Bacteria 1687
75 Ga0068856_100053322 3300005614 Bacteria 3987
76 Ga0070702_100052170 3300005615 Bacteria 2345
77 Ga0068859_100381644 3300005617 Bacteria 1504
78 Ga0068864_100000046 3300005618 Bacteria 151661
79 Ga0068861_100066574 3300005719 Bacteria 2777
80 Ga0068851_10016073 3300005834 Bacteria 3576
81 Ga0068863_100003611 3300005841 Bacteria 15274
82 Ga0068863_100469039 3300005841 Bacteria 1237
83 Ga0068858_100458514 3300005842 Bacteria 1229
84 Ga0068860_100028624 3300005843 Bacteria 5363
85 Ga0068862_100009967 3300005844 Bacteria 7850
86 Ga0075364_10210947 3300006051 Bacteria 1317
87 Ga0070716_100192478 3300006173 Bacteria 1349
88 Ga0075367_10298035 3300006178 Bacteria 1015
89 Ga0097621_100352094 3300006237 Bacteria 1310
90 Ga0075430_100018531 3300006846 Bacteria 5923
91 Ga0075430_100067926 3300006846 Bacteria 2991
92 Ga0075431_100148717 3300006847 Bacteria 2412
93 Ga0075431_100168161 3300006847 Bacteria 2254
94 Ga0075434_100056853 3300006871 Bacteria 3888
95 Ga0075434_100105101 3300006871 Bacteria 2834
96 Ga0075434_100810019 3300006871 Bacteria 953
97 Ga0075429_100558862 3300006880 Bacteria 1003
98 Ga0068865_100001559 3300006881 Bacteria 13392
99 Ga0068865_100003363 3300006881 Bacteria 9579
100 Ga0068865_100303310 3300006881 Bacteria 1279
101 Ga0097620_100381644 3300006931 Bacteria 1504
102 Ga0075435_100084960 3300007076 Bacteria 2605
103 Ga0075435_100238951 3300007076 Bacteria 1545
104 Ga0099794_10135816 3300007265 Bacteria 1244
105 Ga0105245_10026016 3300009098 Bacteria 5149
106 Ga0105245_10035312 3300009098 Bacteria 4436
107 Ga0105245_10193601 3300009098 Bacteria 1949
108 Ga0105245_10268370 3300009098 Bacteria 1663
109 Ga0114129_11446507 3300009147 Bacteria 846
110 Ga0105243_10003059 3300009148 Bacteria 13782
111 Ga0105242_10005728 3300009176 Bacteria 9579
112 Ga0105248_10025770 3300009177 Bacteria 6540
113 Ga0105248_10056165 3300009177 Bacteria 4416
114 Ga0105249_10041058 3300009553 Bacteria 4204
115 Ga0105239_10004359 3300010375 Bacteria 16957
116 Ga0105239_10870404 3300010375 Bacteria 1034
117 Ga0105246_10221612 3300011119 Bacteria 1483
118 Ga0105246_10498085 3300011119 Bacteria 1034
119 Ga0157371_10036763 3300013102 Bacteria 3506
120 Ga0157369_10064667 3300013105 Bacteria 3939
121 Ga0157374_10016519 3300013296 Bacteria 6489
122 Ga0163162_10012258 3300013306 Bacteria 8366
123 Ga0163162_10248926 3300013306 Bacteria 1909
124 Ga0163162_10547521 3300013306 Bacteria 1285
125 Ga0157372_10035802 3300013307 Bacteria 5466
126 Ga0157372_10823044 3300013307 Unclassified 1078
127 Ga0157375_10009883 3300013308 Bacteria 8392
128 Ga0157375_10045132 3300013308 Bacteria 4288
129 Ga0157375_10226779 3300013308 Bacteria 2027
130 Ga0157377_10008532 3300014745 Bacteria 5002
131 Ga0157377_10138633 3300014745 Bacteria 1492
132 Ga0157379_10012695 3300014968 Bacteria 7362
133 Ga0157376_10111996 3300014969 Bacteria 2404
134 Ga0163161_10018510 3300017792 Bacteria 4880
135 Ga0163161_10507509 3300017792 Bacteria 983
136 Ga0213876_10008896 3300021384 Bacteria 5416
137 Ga0213875_10017399 3300021388 Bacteria 3472
138 Ga0207697_10022031 3300025315 Bacteria 2611
139 Ga0207656_10143036 3300025321 Bacteria 1128
140 Ga0207680_10532187 3300025903 Bacteria 838
141 Ga0207645_10011297 3300025907 Bacteria 6102
142 Ga0207645_10081495 3300025907 Bacteria 2075
143 Ga0207705_10621560 3300025909 Bacteria 840
144 Ga0207684_10051613 3300025910 Bacteria 3490
145 Ga0207707_10106306 3300025912 Bacteria 2453
146 Ga0207663_10416341 3300025916 Bacteria 1031
147 Ga0207660_10060593 3300025917 Bacteria 2722
148 Ga0207660_10124792 3300025917 Bacteria 1954
149 Ga0207662_10014013 3300025918 Bacteria 4491
150 Ga0207662_10014247 3300025918 Bacteria 4458
151 Ga0207657_10306129 3300025919 Bacteria 1258
152 Ga0207657_10515117 3300025919 Bacteria 936
153 Ga0207652_10128542 3300025921 Bacteria 2258
154 Ga0207646_10048635 3300025922 Bacteria 3801
155 Ga0207681_10346258 3300025923 Bacteria 1188
156 Ga0207694_10117503 3300025924 Bacteria 2120
157 Ga0207659_10019899 3300025926 Bacteria 4427
158 Ga0207687_10077607 3300025927 Bacteria 2389
159 Ga0207687_10097684 3300025927 Bacteria 2155
160 Ga0207687_10179703 3300025927 Bacteria 1638
161 Ga0207687_10623455 3300025927 Bacteria 911
162 Ga0207700_10138460 3300025928 Unclassified 1997
163 Ga0207664_10199414 3300025929 Bacteria 1727
164 Ga0207690_10168604 3300025932 Bacteria 1638
165 Ga0207690_10514026 3300025932 Bacteria 970
166 Ga0207690_10634295 3300025932 Unclassified 874
167 Ga0207690_10961618 3300025932 Bacteria 710
168 Ga0207706_10002237 3300025933 Bacteria 18881
169 Ga0207706_10201923 3300025933 Bacteria 1744
170 Ga0207670_10051516 3300025936 Bacteria 2764
171 Ga0207670_10163585 3300025936 Bacteria 1663
172 Ga0207669_10077280 3300025937 Bacteria 2116
173 Ga0207669_10095844 3300025937 Bacteria 1946
174 Ga0207704_10001566 3300025938 Bacteria 10250
175 Ga0207704_10027971 3300025938 Bacteria 3121
176 Ga0207665_10121492 3300025939 Bacteria 1846
177 Ga0207691_10021906 3300025940 Bacteria 6030
178 Ga0207691_10046847 3300025940 Bacteria 3971
179 Ga0207711_10372409 3300025941 Bacteria 1324
180 Ga0207689_10057006 3300025942 Bacteria 3214
181 Ga0207661_10600376 3300025944 Bacteria 1010
182 Ga0207661_10604232 3300025944 Bacteria 1007
183 Ga0207679_10002284 3300025945 Bacteria 11824
184 Ga0207679_10044140 3300025945 Bacteria 3215
185 Ga0207679_11184139 3300025945 Bacteria 701
186 Ga0207651_10130688 3300025960 Bacteria 1922
187 Ga0207712_10027053 3300025961 Bacteria 3827
188 Ga0207668_10063811 3300025972 Bacteria 2600
189 Ga0207668_10569876 3300025972 Bacteria 983
190 Ga0207640_10247129 3300025981 Bacteria 1382
191 Ga0207658_10117084 3300025986 Bacteria 2117
192 Ga0207703_10023800 3300026035 Bacteria 4817
193 Ga0207703_10529849 3300026035 Bacteria 1109
194 Ga0207639_10036714 3300026041 Bacteria 3633
195 Ga0207678_10044834 3300026067 Bacteria 3824
196 Ga0207708_10371686 3300026075 Bacteria 1177
197 Ga0207708_10783568 3300026075 Bacteria 820
198 Ga0207702_10024704 3300026078 Bacteria 4986
199 Ga0207702_10444972 3300026078 Bacteria 1256
200 Ga0207648_10017288 3300026089 Bacteria 6569
201 Ga0207676_10000008 3300026095 Bacteria 588913
202 Ga0207676_11249226 3300026095 Bacteria 737
203 Ga0207674_10047433 3300026116 Bacteria 4404
204 Ga0207674_10091590 3300026116 Bacteria 3030
205 Ga0207675_100000209 3300026118 Bacteria 54603
206 Ga0207683_10004928 3300026121 Bacteria 11484
207 Ga0207683_10233639 3300026121 Bacteria 1677
208 Ga0209995_1004022 3300027471 Bacteria 2348
209 Ga0209968_1006094 3300027526 Bacteria 1816
210 Ga0209999_1001634 3300027543 Bacteria 3870
211 Ga0209970_1000718 3300027614 Bacteria 5748
212 Ga0210002_1000613 3300027617 Bacteria 4866
213 Ga0209983_1003534 3300027665 Bacteria 3327
214 Ga0209588_1008149 3300027671 Bacteria 3102
215 Ga0209971_1000317 3300027682 Bacteria 13417
216 Ga0209966_1002773 3300027695 Bacteria 2934
217 Ga0209974_10000287 3300027876 Bacteria 16478
218 Ga0268266_10030459 3300028379 Bacteria 4584
219 Ga0268266_10109289 3300028379 Bacteria 2448
220 Ga0268266_10539829 3300028379 Bacteria 1116
221 Ga0268265_10429643 3300028380 Bacteria 1228
222 Ga0268264_10540892 3300028381 Bacteria 1141
223 Ga0307405_10091490 3300031731 Bacteria 2016
224 Ga0307416_100247704 3300032002 Bacteria 1732
225 Ga0307416_100647681 3300032002 Bacteria 1141
226 Ga0307416_101194663 3300032002 Bacteria 866
227 Ga0307411_10828556 3300032005 Bacteria 817
228 Ga0307415_100494188 3300032126 Bacteria 1068
229 Ga0373926_0009210 3300035083 Bacteria 3296
230 Ga0373945_0025174 3300035116 Bacteria 2066
231 Ga0373953_0124640 3300035117 Bacteria 1096
232 Ga0373943_0036667 3300035170 Bacteria 2349
233 Ga0373946_0004943 3300035171 Bacteria 4799
234 Ga0373955_0136603 3300035172 Bacteria 1435
235 Ga0373927_0006403 3300035695 Bacteria 8021
236 Ga0373947_0000021 3300035725 Bacteria 89576
237 Ga0373925_0002222 3300037068 Bacteria 15745
238 Ga0436364_1208260 3300037853 Bacteria 9932
239 Ga0395901_0412157 3300038443 Bacteria 1387
240 Ga0436365_1821690 3300039437 Bacteria 6334
241 Ga0451807_2775479 3300041486 Bacteria 2667
242 Ga0451845_0903891 3300041501 Bacteria 964
243 Ga0451577_0036337 3300042876 Bacteria 4434
244 Ga0451577_0381734 3300042876 Bacteria 1279
245 Ga0453684_0200658 3300044712 Bacteria 2325
246 Ga0451576_0027243 3300045051 Bacteria 6140
247 Ga0495603_0008933 3300046455 Bacteria 6059
248 Ga0495629_0040730 3300046459 Bacteria 3268
249 Ga0495629_0067563 3300046459 Bacteria 2494
250 Ga0495641_0157455 3300046461 Bacteria 1016
251 Ga0495653_0614144 3300046463 Bacteria 667
252 Ga0495580_0007912 3300046472 Bacteria 8501
253 Ga0495582_0006378 3300046473 Bacteria 6557
254 Ga0495582_0092790 3300046473 Bacteria 1685
255 Ga0495639_0000434 3300046475 Bacteria 19950
256 Ga0495596_0067494 3300046500 Bacteria 1390
257 Ga0495628_0203654 3300046516 Bacteria 1490
258 Ga0495630_0007809 3300046517 Bacteria 7660
259 Ga0495643_0002127 3300046522 Bacteria 16326
260 Ga0495665_0005032 3300046531 Bacteria 7127
261 Ga0495622_0185351 3300046557 Bacteria 932
262 Ga0495635_0049822 3300046663 Bacteria 2887
263 Ga0495635_0300746 3300046663 Bacteria 1076
264 Ga0495588_0000489 3300046674 Bacteria 19529
265 Ga0495647_0080391 3300046681 Bacteria 1321
266 Ga0495658_0000069 3300046683 Bacteria 52593
267 Ga0495658_0123873 3300046683 Bacteria 1566
268 Ga0495669_0046057 3300046684 Bacteria 1946
269 Ga0495613_0041254 3300046689 Bacteria 3418
270 Ga0495660_0310431 3300046810 Bacteria 712
271 Ga0495581_0002756 3300047315 Bacteria 10029
272 Ga0495604_0194153 3300047317 Bacteria 1413
273 Ga0495674_0165422 3300047319 Bacteria 1849
274 Ga0495679_037213 3300047446 Bacteria 1532
275 Ga0495593_0000176 3300047673 Bacteria 33279
276 Ga0495614_0006473 3300048089 Bacteria 5254
277 Ga0496104_0432206 3300048907 Bacteria 1228
278 Ga0496108_0288392 3300048911 Bacteria 1429
279 Ga0496109_0066863 3300048912 Bacteria 3292
280 Ga0496110_0187850 3300048913 Bacteria 1876
281 Ga0496110_0391586 3300048913 Bacteria 1267
282 Ga0496111_0122220 3300048914 Bacteria 1923
283 Ga0496113_0247841 3300048916 Bacteria 1422
284 Ga0496115_0167766 3300048918 Bacteria 1815
285 Ga0501031_0042014 3300049568 Bacteria 2985
286 Ga0501036_0374402 3300049572 Bacteria 1189
287 Ga0501070_0000041 3300049586 Bacteria 113106
288 Ga0501073_0014967 3300049589 Bacteria 5627
289 Ga0501073_0026893 3300049589 Bacteria 4119
290 Ga0501074_0033828 3300049590 Bacteria 3706
291 Ga0501080_0028538 3300049742 Bacteria 5193
292 Ga0501080_0082631 3300049742 Bacteria 2983
293 Ga0501080_0612284 3300049742 Bacteria 966
294 Ga0501081_0063973 3300049743 Unclassified 2554
295 Ga0501081_0445563 3300049743 Bacteria 961
296 Ga0501083_0129463 3300049744 Unclassified 1654
297 Ga0501045_0042621 3300049824 Bacteria 3304
298 nmdc:mga06z11_167896_c1 3300050494 Bacteria 1258
299 nmdc:mga07m45_456860_c1 3300050496 Bacteria 740
300 nmdc:mga09592_576716_c1 3300050508 Bacteria 965
301 nmdc:mga09592_97851_c1 3300050508 Bacteria 2511
302 nmdc:mga0qj67_106020_c1 3300050509 Bacteria 2268
303 nmdc:mga0qj67_131293_c1 3300050509 Bacteria 2029
304 nmdc:mga0qj67_70880_c1 3300050509 Bacteria 2781
305 nmdc:mga06r32_246027_c1 3300050510 Bacteria 1776
306 nmdc:mga06r32_51894_c1 3300050510 Bacteria 3926
307 nmdc:mga0n895_144640_c1 3300050512 Bacteria 2406
308 nmdc:mga0n895_152427_c1 3300050512 Bacteria 2342
309 nmdc:mga0n895_202632_c1 3300050512 Bacteria 2015
310 nmdc:mga0rr50_322974_c1 3300050513 Bacteria 1294
311 nmdc:mga08x19_364869_c1 3300050514 Bacteria 1010
312 Ga0495601_0038249 3300053077 Bacteria 3000
313 Ga0495612_0370580 3300053078 Bacteria 648
314 Ga0495595_0014487 3300053084 Bacteria 3347
315 Ga0495619_0128802 3300053085 Bacteria 1738
316 Ga0590071_064239 3300059421 Bacteria 900
317 Ga0501082_0019724 3300060353 Bacteria 5814
318 Ga0501082_0677754 3300060353 Bacteria 902
319 Ga0501082_1197223 3300060353 Bacteria 664
320 Ga0207677_10410006
321 CNAas_1003373
322 JGI26145J50221_1001742
323 Ga0065712_10073327
324 Ga0065707_10159569
325 Ga0070658_10215025
326 Ga0070676_10065352
327 Ga0070683_100169575
328 Ga0070683_100257006
329 Ga0070683_100272242
330 Ga0070683_101046711
331 Ga0070690_100015327
332 Ga0070670_100254572
333 Ga0068869_100043354
334 Ga0068869_100046521
335 Ga0068869_100103132
336 Ga0070666_10116541
337 Ga0070666_10296037
338 Ga0070680_100068985
339 Ga0070680_100152529
340 Ga0068868_100022080
341 Ga0068868_100161278
342 Ga0070660_100338408
343 Ga0070689_100016259
344 Ga0070689_100054051
345 Ga0070687_100007996
346 Ga0070661_100002072
347 Ga0070668_100958302
348 Ga0070675_100001147
349 Ga0070675_100018234
350 Ga0070675_100539577
351 Ga0070675_100601952
352 Ga0070674_100000459
353 Ga0070674_100191530
354 Ga0070674_100288389
355 Ga0070673_100044278
356 Ga0070673_100367138
357 Ga0070688_100036778
358 Ga0070688_100038678
359 Ga0070667_100018308
360 Ga0070701_10023737
361 Ga0070711_100170110
362 Ga0070705_100004397
363 Ga0070705_100148184
364 Ga0070694_100046697
365 Ga0070708_100284217
366 Ga0070678_100260958
367 Ga0070678_100385856
368 Ga0070662_100064872
369 Ga0070681_10787925
370 Ga0068867_100034404
371 Ga0070706_100062620
372 Ga0070706_100375515
373 Ga0070699_100148306
374 Ga0070679_100094280
375 Ga0070684_100039796
376 Ga0070684_100128544
377 Ga0070697_100454982
378 Ga0068853_100005407
379 Ga0070672_100006769
380 Ga0070686_100090762
381 Ga0070695_100132331
382 Ga0070696_100011188
383 Ga0070696_100229414
384 Ga0070693_100001824
385 Ga0070665_100001269
386 Ga0070665_100018716
387 Ga0070665_100048111
388 Ga0070665_100678866
389 Ga0068855_100034057
390 Ga0070664_100007449
391 Ga0070664_100042304
392 Ga0070664_100085846
393 Ga0068857_100232363
394 Ga0068856_100053322
395 Ga0070702_100052170
396 Ga0068859_100381644
397 Ga0068864_100000046
398 Ga0068861_100066574
399 Ga0068851_10016073
400 Ga0068863_100003611
401 Ga0068863_100469039
402 Ga0068858_100458514
403 Ga0068860_100028624
404 Ga0068862_100009967
405 Ga0075364_10210947
406 Ga0070716_100192478
407 Ga0075367_10298035
408 Ga0097621_100352094
409 Ga0075430_100018531
410 Ga0075430_100067926
411 Ga0075431_100148717
412 Ga0075431_100168161
413 Ga0075434_100056853
414 Ga0075434_100105101
415 Ga0075434_100810019
416 Ga0075429_100558862
417 Ga0068865_100001559
418 Ga0068865_100003363
419 Ga0068865_100303310
420 Ga0097620_100381644
421 Ga0075435_100084960
422 Ga0075435_100238951
423 Ga0099794_10135816
424 Ga0105245_10026016
425 Ga0105245_10035312
426 Ga0105245_10193601
427 Ga0105245_10268370
428 Ga0114129_11446507
429 Ga0105243_10003059
430 Ga0105242_10005728
431 Ga0105248_10025770
432 Ga0105248_10056165
433 Ga0105249_10041058
434 Ga0105239_10004359
435 Ga0105239_10870404
436 Ga0105246_10221612
437 Ga0105246_10498085
438 Ga0157371_10036763
439 Ga0157369_10064667
440 Ga0157374_10016519
441 Ga0163162_10012258
442 Ga0163162_10248926
443 Ga0163162_10547521
444 Ga0157372_10035802
445 Ga0157372_10823044
446 Ga0157375_10009883
447 Ga0157375_10045132
448 Ga0157375_10226779
449 Ga0157377_10008532
450 Ga0157377_10138633
451 Ga0157379_10012695
452 Ga0157376_10111996
453 Ga0163161_10018510
454 Ga0163161_10507509
455 Ga0213876_10008896
456 Ga0213875_10017399
457 Ga0207697_10022031
458 Ga0207656_10143036
459 Ga0207680_10532187
460 Ga0207645_10011297
461 Ga0207645_10081495
462 Ga0207705_10621560
463 Ga0207684_10051613
464 Ga0207707_10106306
465 Ga0207663_10416341
466 Ga0207660_10060593
467 Ga0207660_10124792
468 Ga0207662_10014013
469 Ga0207662_10014247
470 Ga0207657_10306129
471 Ga0207657_10515117
472 Ga0207652_10128542
473 Ga0207646_10048635
474 Ga0207681_10346258
475 Ga0207694_10117503
476 Ga0207659_10019899
477 Ga0207687_10077607
478 Ga0207687_10097684
479 Ga0207687_10179703
480 Ga0207687_10623455
481 Ga0207700_10138460
482 Ga0207664_10199414
483 Ga0207690_10168604
484 Ga0207690_10514026
485 Ga0207690_10634295
486 Ga0207690_10961618
487 Ga0207706_10002237
488 Ga0207706_10201923
489 Ga0207670_10051516
490 Ga0207670_10163585
491 Ga0207669_10077280
492 Ga0207669_10095844
493 Ga0207704_10001566
494 Ga0207704_10027971
495 Ga0207665_10121492
496 Ga0207691_10021906
497 Ga0207691_10046847
498 Ga0207711_10372409
499 Ga0207689_10057006
500 Ga0207661_10600376
501 Ga0207661_10604232
502 Ga0207679_10002284
503 Ga0207679_10044140
504 Ga0207679_11184139
505 Ga0207651_10130688
506 Ga0207712_10027053
507 Ga0207668_10063811
508 Ga0207668_10569876
509 Ga0207640_10247129
510 Ga0207658_10117084
511 Ga0207703_10023800
512 Ga0207703_10529849
513 Ga0207639_10036714
514 Ga0207678_10044834
515 Ga0207708_10371686
516 Ga0207708_10783568
517 Ga0207702_10024704
518 Ga0207702_10444972
519 Ga0207648_10017288
520 Ga0207676_10000008
521 Ga0207676_11249226
522 Ga0207674_10047433
523 Ga0207674_10091590
524 Ga0207675_100000209
525 Ga0207683_10004928
526 Ga0207683_10233639
527 Ga0209995_1004022
528 Ga0209968_1006094
529 Ga0209999_1001634
530 Ga0209970_1000718
531 Ga0210002_1000613
532 Ga0209983_1003534
533 Ga0209588_1008149
534 Ga0209971_1000317
535 Ga0209966_1002773
536 Ga0209974_10000287
537 Ga0268266_10030459
538 Ga0268266_10109289
539 Ga0268266_10539829
540 Ga0268265_10429643
541 Ga0268264_10540892
542 Ga0307405_10091490
543 Ga0307416_100247704
544 Ga0307416_100647681
545 Ga0307416_101194663
546 Ga0307411_10828556
547 Ga0307415_100494188
548 Ga0373926_0009210
549 Ga0373945_0025174
550 Ga0373953_0124640
551 Ga0373943_0036667
552 Ga0373946_0004943
553 Ga0373955_0136603
554 Ga0373927_0006403
555 Ga0373947_0000021
556 Ga0373925_0002222
557 Ga0436364_1208260
558 Ga0395901_0412157
559 Ga0436365_1821690
560 Ga0451807_2775479
561 Ga0451845_0903891
562 Ga0451577_0036337
563 Ga0451577_0381734
564 Ga0453684_0200658
565 Ga0451576_0027243
566 Ga0495603_0008933
567 Ga0495629_0040730
568 Ga0495629_0067563
569 Ga0495641_0157455
570 Ga0495653_0614144
571 Ga0495580_0007912
572 Ga0495582_0006378
573 Ga0495582_0092790
574 Ga0495639_0000434
575 Ga0495596_0067494
576 Ga0495628_0203654
577 Ga0495630_0007809
578 Ga0495643_0002127
579 Ga0495665_0005032
580 Ga0495622_0185351
581 Ga0495635_0049822
582 Ga0495635_0300746
583 Ga0495588_0000489
584 Ga0495647_0080391
585 Ga0495658_0000069
586 Ga0495658_0123873
587 Ga0495669_0046057
588 Ga0495613_0041254
589 Ga0495660_0310431
590 Ga0495581_0002756
591 Ga0495604_0194153
592 Ga0495674_0165422
593 Ga0495679_037213
594 Ga0495593_0000176
595 Ga0495614_0006473
596 Ga0496104_0432206
597 Ga0496108_0288392
598 Ga0496109_0066863
599 Ga0496110_0187850
600 Ga0496110_0391586
601 Ga0496111_0122220
602 Ga0496113_0247841
603 Ga0496115_0167766
604 Ga0501031_0042014
605 Ga0501036_0374402
606 Ga0501070_0000041
607 Ga0501073_0014967
608 Ga0501073_0026893
609 Ga0501074_0033828
610 Ga0501080_0028538
611 Ga0501080_0082631
612 Ga0501080_0612284
613 Ga0501081_0063973
614 Ga0501081_0445563
615 Ga0501083_0129463
616 Ga0501045_0042621
617 nmdc:mga06z11_167896_c1
618 nmdc:mga07m45_456860_c1
619 nmdc:mga09592_576716_c1
620 nmdc:mga09592_97851_c1
621 nmdc:mga0qj67_106020_c1
622 nmdc:mga0qj67_131293_c1
623 nmdc:mga0qj67_70880_c1
624 nmdc:mga06r32_246027_c1
625 nmdc:mga06r32_51894_c1
626 nmdc:mga0n895_144640_c1
627 nmdc:mga0n895_152427_c1
628 nmdc:mga0n895_202632_c1
629 nmdc:mga0rr50_322974_c1
630 nmdc:mga08x19_364869_c1
631 Ga0495601_0038249
632 Ga0495612_0370580
633 Ga0495595_0014487
634 Ga0495619_0128802
635 Ga0590071_064239
636 Ga0501082_0019724
637 Ga0501082_0677754
638 Ga0501082_1197223

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7608 1 194
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7533 1 194
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7475 1 194
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7364 1 194
3kgy-assembly1.cif.gz_B crystal structure of putative dihydrofolate reductase (yp_001636057.1) from chloroflexus aurantiacus j-10-fl at 1.50 a resolution 0.7351 1 194
ID Description Score Start End Superfamily
af_F4JMH8_41_126_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7584 174 198 2.60.40.790
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7296 1 198 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7249 2 198 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7223 1 198 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7148 1 194 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q3QIT0-F1-model_v4 deleted 0.9157 46 198
AF-A0A4Q3QIT0-F1-model_v4 deleted 0.91 46 198
AF-A0A534XRZ0-F1-model_v4 Dihydrofolate reductase 0.8985 1 123
AF-A0A535B5C8-F1-model_v4 Deaminase 0.8968 54 195 GO:0008703
GO:0009231
AF-E3FW03-F1-model_v4 Dihydrofolate reductase 0.8963 2 198 GO:0008703
GO:0009231

Map