F405094

General Info

Members Datasets Scaffolds Average Seq Length
319 218 638 319

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10006951|Ga0213876_100069511
Length 343
Sequence MTATNSVRDGQETVRNVIIIGSGPAGYTAALYTARAQLAPLVFEGTSFGGALMTTTEVENYPGFREGIMGPALMDEMREQALRFGADLRMEDVESVSLEGPIKSVVTADGETYRARAVILAMGAAARYLQVPGEQELLGRGVSSCATCDGFFFRDQDITVIGGGDSAMEEALFLTRFANNVTLVHRRDEFRASKIMLNRARDNEKIKFVTNHTPVAVDGDTTVTGLRLRHNVTGEETTLAVTGVFVAIGHEPRSALVRDVVDLDPDGYVLTKGRTTSTSLDGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEQESVASTDGATAGNAKDTDTLIGARR

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
49 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
100 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
103 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
145 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
191 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2547132424 Nocardia nova SH22a Isolate Unclassified
197 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
198 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
199 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
200 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
201 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
202 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
203 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
204 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
205 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
206 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
207 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
208 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
209 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
210 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
211 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
212 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
213 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
214 2922554459 Rhodococcus sp. 66b Isolate Unclassified
215 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
216 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
217 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
218 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.54
Metatranscriptomes 1.25
Isolates 7.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.97
Nodule 0
Rhizoplane 7.52
Rhizosphere 66.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10006951 3300021384 Bacteria 6167
2 JGI24739J22299_10040540 3300001989 Bacteria 1554
3 Ga0055540_1000041 3300003792 Bacteria 157379
4 Ga0055540_1000509 3300003792 Bacteria 29350
5 Ga0055540_1000908 3300003792 Bacteria 19483
6 Ga0070666_10004242 3300005335 Bacteria 8710
7 Ga0070666_10006723 3300005335 Bacteria 7078
8 Ga0068868_100444661 3300005338 Bacteria 1126
9 Ga0070668_100002910 3300005347 Bacteria 12652
10 Ga0070668_100010905 3300005347 Bacteria 6762
11 Ga0070669_100205317 3300005353 Bacteria 1552
12 Ga0070667_100000295 3300005367 Bacteria 56139
13 Ga0070667_100000965 3300005367 Bacteria 26473
14 Ga0070667_100004786 3300005367 Bacteria 11337
15 Ga0070667_100011295 3300005367 Bacteria 7387
16 Ga0070714_100001220 3300005435 Bacteria 18560
17 Ga0070714_100052570 3300005435 Bacteria 3474
18 Ga0070714_100115764 3300005435 Bacteria 2380
19 Ga0070714_100131826 3300005435 Bacteria 2234
20 Ga0070714_100178469 3300005435 Bacteria 1931
21 Ga0070714_100185253 3300005435 Bacteria 1896
22 Ga0070714_100202238 3300005435 Bacteria 1817
23 Ga0070713_100185589 3300005436 Bacteria 1871
24 Ga0070663_100121440 3300005455 Bacteria 1974
25 Ga0070698_100021458 3300005471 Bacteria 6764
26 Ga0070665_100003996 3300005548 Bacteria 15555
27 Ga0070665_100014742 3300005548 Bacteria 7844
28 Ga0068852_100146015 3300005616 Bacteria 2194
29 Ga0068859_100093387 3300005617 Bacteria 3060
30 Ga0068861_100138278 3300005719 Bacteria 1985
31 Ga0068863_100002962 3300005841 Bacteria 16787
32 Ga0068863_100005096 3300005841 Bacteria 12962
33 Ga0068858_100006774 3300005842 Bacteria 11148
34 Ga0068860_100000140 3300005843 Bacteria 118729
35 Ga0068860_100000147 3300005843 Bacteria 115672
36 Ga0068862_100000034 3300005844 Bacteria 176511
37 Ga0081455_10058733 3300005937 Bacteria 3252
38 Ga0081538_10112496 3300005981 Bacteria 1332
39 Ga0075365_10101028 3300006038 Bacteria 1975
40 Ga0075363_100004013 3300006048 Bacteria 6367
41 Ga0075363_100018627 3300006048 Bacteria 3463
42 Ga0075364_10000797 3300006051 Bacteria 16635
43 Ga0075364_10004573 3300006051 Bacteria 7964
44 Ga0075364_10021247 3300006051 Bacteria 4089
45 Ga0075369_10002111 3300006186 Bacteria 7024
46 Ga0075370_10030603 3300006353 Bacteria 3003
47 Ga0075428_100214280 3300006844 Bacteria 2081
48 Ga0075428_100308716 3300006844 Bacteria 1700
49 Ga0075431_100149166 3300006847 Bacteria 2408
50 Ga0075431_100356185 3300006847 Bacteria 1470
51 Ga0075429_100335722 3300006880 Bacteria 1323
52 Ga0097620_100093385 3300006931 Bacteria 3060
53 Ga0099795_10022907 3300007788 Bacteria 2067
54 Ga0105240_10588809 3300009093 Bacteria 1226
55 Ga0111539_10110051 3300009094 Bacteria 3233
56 Ga0105245_10149984 3300009098 Bacteria 2204
57 Ga0105247_10000065 3300009101 Bacteria 122503
58 Ga0114129_10246268 3300009147 Bacteria 2401
59 Ga0114129_10424127 3300009147 Bacteria 1749
60 Ga0105243_10000071 3300009148 Bacteria 118865
61 Ga0105248_10000067 3300009177 Bacteria 121245
62 Ga0105237_10134613 3300009545 Bacteria 2466
63 Ga0105249_10000051 3300009553 Bacteria 169445
64 Ga0157373_10073158 3300013100 Bacteria 2419
65 Ga0157369_10051475 3300013105 Bacteria 4457
66 Ga0163163_10237528 3300014325 Bacteria 1872
67 Ga0157380_10007764 3300014326 Bacteria 7635
68 Ga0157379_10042252 3300014968 Bacteria 4070
69 Ga0157379_10399711 3300014968 Bacteria 1263
70 Ga0197907_10469461 3300020069 Bacteria 2842
71 Ga0206355_1470114 3300020076 Bacteria 1864
72 Ga0206350_11543767 3300020080 Bacteria 1385
73 Ga0213873_10001719 3300021358 Bacteria 3675
74 Ga0213876_10003917 3300021384 Bacteria 8410
75 Ga0213875_10000449 3300021388 Bacteria 35798
76 Ga0224712_10048858 3300022467 Bacteria 1635
77 Ga0209051_1000014 3300025303 Bacteria 552732
78 Ga0209051_1000554 3300025303 Bacteria 45489
79 Ga0209051_1001057 3300025303 Bacteria 25731
80 Ga0209051_1002262 3300025303 Bacteria 14124
81 Ga0209051_1058558 3300025303 Bacteria 1226
82 Ga0207710_10000089 3300025900 Bacteria 122497
83 Ga0207688_10103059 3300025901 Bacteria 1650
84 Ga0207680_10198344 3300025903 Bacteria 1366
85 Ga0207647_10129738 3300025904 Bacteria 1482
86 Ga0207671_10035575 3300025914 Bacteria 3695
87 Ga0207681_10001917 3300025923 Bacteria 13314
88 Ga0207700_10034722 3300025928 Bacteria 3623
89 Ga0207664_10039172 3300025929 Bacteria 3678
90 Ga0207664_10117699 3300025929 Bacteria 2219
91 Ga0207709_10000967 3300025935 Bacteria 21449
92 Ga0207711_10000091 3300025941 Bacteria 96789
93 Ga0207712_10000043 3300025961 Bacteria 173580
94 Ga0207668_10006512 3300025972 Bacteria 6900
95 Ga0207658_10002469 3300025986 Bacteria 13498
96 Ga0207658_10002508 3300025986 Bacteria 13359
97 Ga0207658_10015623 3300025986 Bacteria 5210
98 Ga0207658_10309854 3300025986 Bacteria 1363
99 Ga0207703_10091890 3300026035 Bacteria 2553
100 Ga0207678_10084478 3300026067 Bacteria 2715
101 Ga0207641_10000451 3300026088 Bacteria 46849
102 Ga0207641_10000524 3300026088 Bacteria 42982
103 Ga0207675_100109968 3300026118 Bacteria 2601
104 Ga0207698_10391059 3300026142 Bacteria 1326
105 Ga0207428_10076646 3300027907 Bacteria 2618
106 Ga0268266_10007736 3300028379 Bacteria 9643
107 Ga0268266_10010829 3300028379 Bacteria 7944
108 Ga0268265_10000027 3300028380 Bacteria 240507
109 Ga0268264_10000033 3300028381 Bacteria 404123
110 Ga0268264_10000127 3300028381 Bacteria 185112
111 Ga0268264_10000138 3300028381 Bacteria 172597
112 Ga0268264_10177720 3300028381 Bacteria 1930
113 Ga0265338_10001469 3300028800 Bacteria 38157
114 Ga0265328_10026405 3300031239 Bacteria 2182
115 Ga0265329_10003983 3300031242 Bacteria 6298
116 Ga0265327_10000001 3300031251 Bacteria 894475
117 Ga0265327_10000340 3300031251 Bacteria 88806
118 Ga0265327_10003456 3300031251 Bacteria 15051
119 Ga0265327_10030020 3300031251 Bacteria 3081
120 Ga0265316_10092334 3300031344 Bacteria 2308
121 Ga0265314_10000284 3300031711 Bacteria 73660
122 Ga0307410_10065489 3300031852 Bacteria 2500
123 Ga0307409_100205390 3300031995 Bacteria 1766
124 Ga0316574_0084666 3300035398 Bacteria 2017
125 Ga0316574_0178186 3300035398 Bacteria 1368
126 Ga0373937_0019393 3300036401 Bacteria 6087
127 Ga0316582_0039268 3300036647 Bacteria 2947
128 Ga0316584_0028380 3300036712 Bacteria 4126
129 Ga0316584_0114016 3300036712 Bacteria 2022
130 Ga0373925_0176328 3300037068 Bacteria 1690
131 Ga0436364_0902613 3300037853 Bacteria 2502
132 Ga0436364_0971903 3300037853 Bacteria 128436
133 Ga0436365_0234313 3300039437 Bacteria 46110
134 Ga0436365_0866770 3300039437 Bacteria 27397
135 Ga0436365_1206948 3300039437 Bacteria 5877
136 Ga0436365_1620833 3300039437 Bacteria 10049
137 Ga0436362_0396477 3300039453 Bacteria 9201
138 Ga0439466_0004291 3300041411 Bacteria 5507
139 Ga0451789_1110598 3300041443 Bacteria 2351
140 Ga0439431_0003264 3300041997 Bacteria 3567
141 Ga0439448_0005165 3300042005 Bacteria 3716
142 Ga0466969_0025847 3300044656 Bacteria 3015
143 Ga0466972_0008878 3300044658 Bacteria 5042
144 Ga0466965_0005838 3300044683 Bacteria 5553
145 Ga0466965_0025495 3300044683 Bacteria 2862
146 Ga0466965_0054480 3300044683 Bacteria 1989
147 Ga0466965_0061631 3300044683 Bacteria 1875
148 Ga0466966_0000907 3300044684 Bacteria 18839
149 Ga0466966_0001214 3300044684 Bacteria 16543
150 Ga0466966_0041811 3300044684 Bacteria 2944
151 Ga0466961_0004854 3300044693 Bacteria 8459
152 Ga0466961_0006895 3300044693 Bacteria 7228
153 Ga0466963_0000111 3300044694 Bacteria 29959
154 Ga0466963_0073579 3300044694 Bacteria 2304
155 Ga0466964_0028368 3300044706 Bacteria 2205
156 Ga0453684_0035588 3300044712 Bacteria 6879
157 Ga0453684_0120661 3300044712 Bacteria 3166
158 Ga0466971_0004057 3300044719 Bacteria 6299
159 Ga0466968_0008967 3300044735 Bacteria 3843
160 Ga0466968_0023472 3300044735 Bacteria 2513
161 Ga0466968_0134704 3300044735 Bacteria 1126
162 Ga0466970_0003567 3300044765 Bacteria 7581
163 Ga0466970_0013337 3300044765 Bacteria 4213
164 Ga0466970_0054871 3300044765 Bacteria 2128
165 Ga0466957_0003471 3300044842 Bacteria 8658
166 Ga0466957_0005983 3300044842 Bacteria 6864
167 Ga0466957_0007058 3300044842 Bacteria 6350
168 Ga0466960_0001318 3300044901 Bacteria 9004
169 Ga0466960_0156459 3300044901 Bacteria 1221
170 Ga0466959_0011410 3300045049 Bacteria 6384
171 Ga0466959_0012705 3300045049 Bacteria 6090
172 Ga0466959_0015373 3300045049 Bacteria 5574
173 Ga0466959_0025877 3300045049 Bacteria 4351
174 Ga0466958_0000027 3300045836 Bacteria 41923
175 Ga0466958_0003917 3300045836 Bacteria 7799
176 Ga0466958_0149923 3300045836 Bacteria 1471
177 Ga0466967_0002384 3300045976 Bacteria 11646
178 Ga0466967_0070096 3300045976 Bacteria 3135
179 Ga0466967_0073675 3300045976 Bacteria 3064
180 Ga0466967_0098159 3300045976 Bacteria 2674
181 Ga0466967_0148258 3300045976 Bacteria 2190
182 Ga0466967_0200589 3300045976 Bacteria 1889
183 Ga0495603_0266472 3300046455 Bacteria 986
184 Ga0495629_0006984 3300046459 Bacteria 8324
185 Ga0495638_0001579 3300046460 Bacteria 20430
186 Ga0495641_0029212 3300046461 Bacteria 2658
187 Ga0495582_0108268 3300046473 Bacteria 1560
188 Ga0495607_0036448 3300046501 Bacteria 2963
189 Ga0495630_0053618 3300046517 Bacteria 3020
190 Ga0495640_0110875 3300046533 Bacteria 1793
191 Ga0495587_0142593 3300046536 Bacteria 1367
192 Ga0495668_0018366 3300046616 Bacteria 4040
193 Ga0495658_0014293 3300046683 Bacteria 4053
194 Ga0495624_0069673 3300046690 Bacteria 2190
195 Ga0495581_0004581 3300047315 Bacteria 7984
196 Ga0495676_0027822 3300047321 Bacteria 4844
197 Ga0495683_0001296 3300047323 Bacteria 16889
198 Ga0495684_0090369 3300047471 Bacteria 2320
199 Ga0495686_0001177 3300047472 Bacteria 30519
200 Ga0495593_0024134 3300047673 Bacteria 3373
201 Ga0496100_0000256 3300048903 Bacteria 27274
202 Ga0496101_0000182 3300048904 Bacteria 50352
203 Ga0496101_0004618 3300048904 Bacteria 8701
204 Ga0496101_0067304 3300048904 Bacteria 2615
205 Ga0496102_0000145 3300048905 Bacteria 96368
206 Ga0496102_0003146 3300048905 Bacteria 14004
207 Ga0496103_0001163 3300048906 Bacteria 18114
208 Ga0496103_0001753 3300048906 Bacteria 14168
209 Ga0496106_0003199 3300048909 Bacteria 12253
210 Ga0496106_0144053 3300048909 Bacteria 1876
211 Ga0496107_0000342 3300048910 Bacteria 25346
212 Ga0496108_0000431 3300048911 Bacteria 33906
213 Ga0496108_0051743 3300048911 Bacteria 3441
214 Ga0496108_0158503 3300048911 Bacteria 1955
215 Ga0496109_0000262 3300048912 Bacteria 50723
216 Ga0496110_0003866 3300048913 Bacteria 11543
217 Ga0496111_0014743 3300048914 Bacteria 5348
218 Ga0496112_0015772 3300048915 Bacteria 7060
219 Ga0496112_0019032 3300048915 Bacteria 6473
220 Ga0496113_0065081 3300048916 Bacteria 2758
221 Ga0496114_0000280 3300048917 Bacteria 37353
222 Ga0496114_0033369 3300048917 Bacteria 4241
223 Ga0496115_0003623 3300048918 Bacteria 11109
224 Ga0496116_0008673 3300048919 Bacteria 8787
225 Ga0496116_0031272 3300048919 Bacteria 3814
226 Ga0496117_0004985 3300048920 Bacteria 14245
227 Ga0496117_0008019 3300048920 Bacteria 10125
228 Ga0496117_0120900 3300048920 Bacteria 1609
229 Ga0496118_0000358 3300048921 Bacteria 77310
230 Ga0496118_0000874 3300048921 Bacteria 47574
231 Ga0496118_0042187 3300048921 Bacteria 3601
232 Ga0496119_0006050 3300048922 Bacteria 11349
233 Ga0496120_0022827 3300048923 Bacteria 3931
234 Ga0496120_0065055 3300048923 Bacteria 2022
235 Ga0496121_0000384 3300048924 Bacteria 90179
236 Ga0496121_0002371 3300048924 Bacteria 28966
237 Ga0496122_0000997 3300048925 Bacteria 50404
238 Ga0496123_0025411 3300048926 Bacteria 4466
239 Ga0496124_0000373 3300048927 Bacteria 81546
240 Ga0496125_0000003 3300048928 Bacteria 1189767
241 Ga0496125_0019350 3300048928 Bacteria 6425
242 Ga0496125_0133341 3300048928 Bacteria 1743
243 Ga0496126_0000390 3300048929 Bacteria 90153
244 Ga0496126_0002245 3300048929 Bacteria 26662
245 Ga0496126_0016108 3300048929 Bacteria 7491
246 Ga0496126_0040773 3300048929 Bacteria 4302
247 Ga0501031_0035096 3300049568 Bacteria 3271
248 Ga0501033_0072858 3300049570 Bacteria 2522
249 Ga0501034_0019202 3300049571 Bacteria 6997
250 Ga0501034_0224835 3300049571 Bacteria 1828
251 Ga0501036_0027884 3300049572 Bacteria 4774
252 Ga0501042_0078322 3300049578 Bacteria 2367
253 Ga0501043_0013642 3300049579 Bacteria 6358
254 Ga0501043_0083586 3300049579 Bacteria 2510
255 Ga0501047_0010020 3300049581 Bacteria 8959
256 Ga0501047_0035720 3300049581 Bacteria 4802
257 Ga0501048_0010467 3300049582 Bacteria 6926
258 Ga0501070_0002256 3300049586 Bacteria 16940
259 Ga0501071_0132382 3300049587 Bacteria 1853
260 Ga0501073_0101659 3300049589 Bacteria 1996
261 Ga0501074_0279125 3300049590 Bacteria 1188
262 Ga0501075_0118728 3300049591 Bacteria 2011
263 Ga0501079_0118507 3300049741 Bacteria 2058
264 Ga0501080_0774345 3300049742 Bacteria 843
265 Ga0501083_0278823 3300049744 Bacteria 1087
266 Ga0501035_0005577 3300049822 Bacteria 11892
267 Ga0501044_0001860 3300049823 Bacteria 24492
268 Ga0501045_0035704 3300049824 Bacteria 3609
269 nmdc:mga03683_32856_c1 3300050489 Bacteria 2090
270 nmdc:mga03n38_109924_c1 3300050490 Bacteria 1341
271 nmdc:mga03n38_2663_c1 3300050490 Bacteria 5574
272 nmdc:mga00v17_2976_c2 3300050491 Bacteria 4239
273 nmdc:mga00v17_539_c1 3300050491 Bacteria 21200
274 nmdc:mga0yw44_25894_c1 3300050492 Bacteria 3343
275 nmdc:mga06z11_31748_c1 3300050494 Bacteria 2569
276 nmdc:mga07m45_113197_c1 3300050496 Bacteria 1564
277 nmdc:mga07m45_9003_c1 3300050496 Bacteria 5157
278 nmdc:mga05p37_31996_c1 3300050507 Bacteria 6431
279 nmdc:mga05p37_353222_c1 3300050507 Bacteria 1730
280 nmdc:mga05p37_859261_c1 3300050507 Bacteria 984
281 nmdc:mga09592_256483_c1 3300050508 Bacteria 1516
282 nmdc:mga06r32_192727_c1 3300050510 Bacteria 2025
283 nmdc:mga08y16_82814_c1 3300050511 Bacteria 3345
284 nmdc:mga0n895_63198_c1 3300050512 Bacteria 3661
285 nmdc:mga0sz30_11503_c1 3300050516 Bacteria 3418
286 nmdc:mga0sz30_7085_c1 3300050516 Bacteria 4193
287 Ga0500610_0101594 3300053079 Bacteria 1487
288 Ga0495619_0047214 3300053085 Bacteria 2835
289 Ga0500641_0151491 3300053096 Bacteria 1001
290 Ga0500556_0003005 3300053104 Bacteria 5082
291 Ga0500562_000536 3300053108 Bacteria 9214
292 Ga0500652_000217 3300053131 Bacteria 22043
293 Ga0500616_0058733 3300053153 Bacteria 2000
294 Ga0500620_006128 3300053155 Bacteria 2851
295 Ga0500645_000383 3300053730 Bacteria 31090
296 Ga0466962_0027370 3300061719 Bacteria 2736
297 2548699893 2547132424 Bacteria 8348532
298 2566993003 2565956761 Bacteria 6601618
299 2644487977 2643221687 Bacteria 6500351
300 2644637920 2643221715 Bacteria 6671032
301 2738664752 2738541264 Bacteria 5935393
302 2738702939 2738541274 Bacteria 6909446
303 2738891831 2738541308 Bacteria 7020677
304 2739143886 2738541356 Bacteria 5935017
305 2739205768 2738543005 Bacteria 5278128
306 2739236085 2738543011 Bacteria 5731169
307 2739333882 2738543028 Bacteria 6917070
308 2842892347 2842888712 Bacteria 4279094
309 2889304453 2889300758 Bacteria 5690814
310 2902803747 2902799365 Bacteria 5419524
311 2902816526 2902810491 Bacteria 6794147
312 2902841114 2902837492 Bacteria 6697721
313 2904536421 2904535858 Bacteria 6308016
314 2919714940 2919713450 Bacteria 7431245
315 2922558364 2922554459 Bacteria 6683962
316 2928144142 2928142448 Bacteria 5288925
317 2932399704 2932398195 Bacteria 3847976
318 2939583419 2939582691 Bacteria 7088898
319 2939745149 2939743619 Bacteria 5762299
320 Ga0213876_10006951
321 JGI24739J22299_10040540
322 Ga0055540_1000041
323 Ga0055540_1000509
324 Ga0055540_1000908
325 Ga0070666_10004242
326 Ga0070666_10006723
327 Ga0068868_100444661
328 Ga0070668_100002910
329 Ga0070668_100010905
330 Ga0070669_100205317
331 Ga0070667_100000295
332 Ga0070667_100000965
333 Ga0070667_100004786
334 Ga0070667_100011295
335 Ga0070714_100001220
336 Ga0070714_100052570
337 Ga0070714_100115764
338 Ga0070714_100131826
339 Ga0070714_100178469
340 Ga0070714_100185253
341 Ga0070714_100202238
342 Ga0070713_100185589
343 Ga0070663_100121440
344 Ga0070698_100021458
345 Ga0070665_100003996
346 Ga0070665_100014742
347 Ga0068852_100146015
348 Ga0068859_100093387
349 Ga0068861_100138278
350 Ga0068863_100002962
351 Ga0068863_100005096
352 Ga0068858_100006774
353 Ga0068860_100000140
354 Ga0068860_100000147
355 Ga0068862_100000034
356 Ga0081455_10058733
357 Ga0081538_10112496
358 Ga0075365_10101028
359 Ga0075363_100004013
360 Ga0075363_100018627
361 Ga0075364_10000797
362 Ga0075364_10004573
363 Ga0075364_10021247
364 Ga0075369_10002111
365 Ga0075370_10030603
366 Ga0075428_100214280
367 Ga0075428_100308716
368 Ga0075431_100149166
369 Ga0075431_100356185
370 Ga0075429_100335722
371 Ga0097620_100093385
372 Ga0099795_10022907
373 Ga0105240_10588809
374 Ga0111539_10110051
375 Ga0105245_10149984
376 Ga0105247_10000065
377 Ga0114129_10246268
378 Ga0114129_10424127
379 Ga0105243_10000071
380 Ga0105248_10000067
381 Ga0105237_10134613
382 Ga0105249_10000051
383 Ga0157373_10073158
384 Ga0157369_10051475
385 Ga0163163_10237528
386 Ga0157380_10007764
387 Ga0157379_10042252
388 Ga0157379_10399711
389 Ga0197907_10469461
390 Ga0206355_1470114
391 Ga0206350_11543767
392 Ga0213873_10001719
393 Ga0213876_10003917
394 Ga0213875_10000449
395 Ga0224712_10048858
396 Ga0209051_1000014
397 Ga0209051_1000554
398 Ga0209051_1001057
399 Ga0209051_1002262
400 Ga0209051_1058558
401 Ga0207710_10000089
402 Ga0207688_10103059
403 Ga0207680_10198344
404 Ga0207647_10129738
405 Ga0207671_10035575
406 Ga0207681_10001917
407 Ga0207700_10034722
408 Ga0207664_10039172
409 Ga0207664_10117699
410 Ga0207709_10000967
411 Ga0207711_10000091
412 Ga0207712_10000043
413 Ga0207668_10006512
414 Ga0207658_10002469
415 Ga0207658_10002508
416 Ga0207658_10015623
417 Ga0207658_10309854
418 Ga0207703_10091890
419 Ga0207678_10084478
420 Ga0207641_10000451
421 Ga0207641_10000524
422 Ga0207675_100109968
423 Ga0207698_10391059
424 Ga0207428_10076646
425 Ga0268266_10007736
426 Ga0268266_10010829
427 Ga0268265_10000027
428 Ga0268264_10000033
429 Ga0268264_10000127
430 Ga0268264_10000138
431 Ga0268264_10177720
432 Ga0265338_10001469
433 Ga0265328_10026405
434 Ga0265329_10003983
435 Ga0265327_10000001
436 Ga0265327_10000340
437 Ga0265327_10003456
438 Ga0265327_10030020
439 Ga0265316_10092334
440 Ga0265314_10000284
441 Ga0307410_10065489
442 Ga0307409_100205390
443 Ga0316574_0084666
444 Ga0316574_0178186
445 Ga0373937_0019393
446 Ga0316582_0039268
447 Ga0316584_0028380
448 Ga0316584_0114016
449 Ga0373925_0176328
450 Ga0436364_0902613
451 Ga0436364_0971903
452 Ga0436365_0234313
453 Ga0436365_0866770
454 Ga0436365_1206948
455 Ga0436365_1620833
456 Ga0436362_0396477
457 Ga0439466_0004291
458 Ga0451789_1110598
459 Ga0439431_0003264
460 Ga0439448_0005165
461 Ga0466969_0025847
462 Ga0466972_0008878
463 Ga0466965_0005838
464 Ga0466965_0025495
465 Ga0466965_0054480
466 Ga0466965_0061631
467 Ga0466966_0000907
468 Ga0466966_0001214
469 Ga0466966_0041811
470 Ga0466961_0004854
471 Ga0466961_0006895
472 Ga0466963_0000111
473 Ga0466963_0073579
474 Ga0466964_0028368
475 Ga0453684_0035588
476 Ga0453684_0120661
477 Ga0466971_0004057
478 Ga0466968_0008967
479 Ga0466968_0023472
480 Ga0466968_0134704
481 Ga0466970_0003567
482 Ga0466970_0013337
483 Ga0466970_0054871
484 Ga0466957_0003471
485 Ga0466957_0005983
486 Ga0466957_0007058
487 Ga0466960_0001318
488 Ga0466960_0156459
489 Ga0466959_0011410
490 Ga0466959_0012705
491 Ga0466959_0015373
492 Ga0466959_0025877
493 Ga0466958_0000027
494 Ga0466958_0003917
495 Ga0466958_0149923
496 Ga0466967_0002384
497 Ga0466967_0070096
498 Ga0466967_0073675
499 Ga0466967_0098159
500 Ga0466967_0148258
501 Ga0466967_0200589
502 Ga0495603_0266472
503 Ga0495629_0006984
504 Ga0495638_0001579
505 Ga0495641_0029212
506 Ga0495582_0108268
507 Ga0495607_0036448
508 Ga0495630_0053618
509 Ga0495640_0110875
510 Ga0495587_0142593
511 Ga0495668_0018366
512 Ga0495658_0014293
513 Ga0495624_0069673
514 Ga0495581_0004581
515 Ga0495676_0027822
516 Ga0495683_0001296
517 Ga0495684_0090369
518 Ga0495686_0001177
519 Ga0495593_0024134
520 Ga0496100_0000256
521 Ga0496101_0000182
522 Ga0496101_0004618
523 Ga0496101_0067304
524 Ga0496102_0000145
525 Ga0496102_0003146
526 Ga0496103_0001163
527 Ga0496103_0001753
528 Ga0496106_0003199
529 Ga0496106_0144053
530 Ga0496107_0000342
531 Ga0496108_0000431
532 Ga0496108_0051743
533 Ga0496108_0158503
534 Ga0496109_0000262
535 Ga0496110_0003866
536 Ga0496111_0014743
537 Ga0496112_0015772
538 Ga0496112_0019032
539 Ga0496113_0065081
540 Ga0496114_0000280
541 Ga0496114_0033369
542 Ga0496115_0003623
543 Ga0496116_0008673
544 Ga0496116_0031272
545 Ga0496117_0004985
546 Ga0496117_0008019
547 Ga0496117_0120900
548 Ga0496118_0000358
549 Ga0496118_0000874
550 Ga0496118_0042187
551 Ga0496119_0006050
552 Ga0496120_0022827
553 Ga0496120_0065055
554 Ga0496121_0000384
555 Ga0496121_0002371
556 Ga0496122_0000997
557 Ga0496123_0025411
558 Ga0496124_0000373
559 Ga0496125_0000003
560 Ga0496125_0019350
561 Ga0496125_0133341
562 Ga0496126_0000390
563 Ga0496126_0002245
564 Ga0496126_0016108
565 Ga0496126_0040773
566 Ga0501031_0035096
567 Ga0501033_0072858
568 Ga0501034_0019202
569 Ga0501034_0224835
570 Ga0501036_0027884
571 Ga0501042_0078322
572 Ga0501043_0013642
573 Ga0501043_0083586
574 Ga0501047_0010020
575 Ga0501047_0035720
576 Ga0501048_0010467
577 Ga0501070_0002256
578 Ga0501071_0132382
579 Ga0501073_0101659
580 Ga0501074_0279125
581 Ga0501075_0118728
582 Ga0501079_0118507
583 Ga0501080_0774345
584 Ga0501083_0278823
585 Ga0501035_0005577
586 Ga0501044_0001860
587 Ga0501045_0035704
588 nmdc:mga03683_32856_c1
589 nmdc:mga03n38_109924_c1
590 nmdc:mga03n38_2663_c1
591 nmdc:mga00v17_2976_c2
592 nmdc:mga00v17_539_c1
593 nmdc:mga0yw44_25894_c1
594 nmdc:mga06z11_31748_c1
595 nmdc:mga07m45_113197_c1
596 nmdc:mga07m45_9003_c1
597 nmdc:mga05p37_31996_c1
598 nmdc:mga05p37_353222_c1
599 nmdc:mga05p37_859261_c1
600 nmdc:mga09592_256483_c1
601 nmdc:mga06r32_192727_c1
602 nmdc:mga08y16_82814_c1
603 nmdc:mga0n895_63198_c1
604 nmdc:mga0sz30_11503_c1
605 nmdc:mga0sz30_7085_c1
606 Ga0500610_0101594
607 Ga0495619_0047214
608 Ga0500641_0151491
609 Ga0500556_0003005
610 Ga0500562_000536
611 Ga0500652_000217
612 Ga0500616_0058733
613 Ga0500620_006128
614 Ga0500645_000383
615 Ga0466962_0027370
616 2548699893
617 2566993003
618 2644487977
619 2644637920
620 2738664752
621 2738702939
622 2738891831
623 2739143886
624 2739205768
625 2739236085
626 2739333882
627 2842892347
628 2889304453
629 2902803747
630 2902816526
631 2902841114
632 2904536421
633 2919714940
634 2922558364
635 2928144142
636 2932399704
637 2939583419
638 2939745149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

157

235

0.94

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

15

304

0.9

PF13738

Pyr_redox_3

Pyridine nucleotide-disulphide oxidoreductase

77

287

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.9167 5 308
3itj-assembly2.cif.gz_C crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.9126 8 309
2whd-assembly1.cif.gz_A barley nadph-dependent thioredoxin reductase 2 0.9106 3 309
5w4c-assembly1.cif.gz_B crystal structure of thioredoxin reductase from cryptococcus neoformans in complex with fad (fo conformation) 0.9059 1 316
4ccr-assembly2.cif.gz_D crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor 0.9026 5 308
ID Description Score Start End Superfamily
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9959 119 241 3.50.50.60
5uthA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9879 119 241 3.50.50.60
3f8rD02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9727 119 241 3.50.50.60
5uthA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9722 6 309 3.50.50.60
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9653 119 241 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6B3EPH4-F1-model_v4 FAD-dependent oxidoreductase 0.9899 115 227 GO:0016668
AF-A0A3C0YJU2-F1-model_v4 deleted 0.9852 137 203
AF-A0A7H4N4U0-F1-model_v4 Alkyl hydroperoxide reductase protein F (EC 1.8.1.-) 0.9811 123 203 GO:0016668
AF-A0A3D5UWY6-F1-model_v4 Thioredoxin-disulfide reductase 0.98 144 232 GO:0016491
AF-K1UEN0-F1-model_v4 Protein containing Pyridine nucleotide-disulfide oxidoreductase, NAD-binding region domain protein (EC 1.-.-.-) 0.9734 142 206 GO:0016491

Map