F404992

General Info

Members Datasets Scaffolds Average Seq Length
319 232 638 221

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100128093|Ga0068855_1001280933
Length 247
Sequence MPSQRGMTLSEIKAECLVAGLNCNMKVVLPSSHGRDVNVMVGSWRLPGFLTVPSEASALVVFAHGSGSSRFSGRNRQVAQTLNHAGMATLLFDLLQPEEESVRSRAPVFDIELLANRLIDAVEWADETLGDELTSIGLFGASTGAAAALVAAAGLEGRIGAVVSRGGRPDLAGDALERVSAPTLLIVGGEDHDVLELNKQARARMKCLTALQVVPGATHLFEEPGTLQQVMTLARDWFETYLTAAPT

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
106 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
116 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
125 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
126 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
220 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
221 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
222 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
223 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
224 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
225 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
226 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
227 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
228 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
229 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
230 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
231 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
232 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.3
Metatranscriptomes 0.31
Isolates 4.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 1.57
Rhizoplane 1.25
Rhizosphere 92.48
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100128093 3300005563 Bacteria 2901
2 Ga0070658_10003236 3300005327 Bacteria 13450
3 Ga0070658_10003312 3300005327 Bacteria 13290
4 Ga0070676_10094306 3300005328 Bacteria 1839
5 Ga0070683_100323221 3300005329 Bacteria 1468
6 Ga0070670_100063631 3300005331 Bacteria 3166
7 Ga0070670_100066986 3300005331 Bacteria 3082
8 Ga0068869_100037691 3300005334 Bacteria 3439
9 Ga0070666_10181029 3300005335 Bacteria 1478
10 Ga0070666_10209589 3300005335 Bacteria 1372
11 Ga0070680_100009958 3300005336 Bacteria 7321
12 Ga0068868_100094250 3300005338 Bacteria 2415
13 Ga0070660_100031203 3300005339 Bacteria 4001
14 Ga0070660_100062455 3300005339 Bacteria 2894
15 Ga0070660_100122283 3300005339 Bacteria 2078
16 Ga0070691_10150058 3300005341 Bacteria 1194
17 Ga0070661_100040500 3300005344 Bacteria 3399
18 Ga0070668_100005475 3300005347 Bacteria 9427
19 Ga0070675_100571884 3300005354 Bacteria 1023
20 Ga0070671_100007927 3300005355 Bacteria 8494
21 Ga0070671_100223476 3300005355 Bacteria 1597
22 Ga0070673_100027976 3300005364 Bacteria 4186
23 Ga0070673_100040004 3300005364 Bacteria 3593
24 Ga0070688_100044561 3300005365 Bacteria 2738
25 Ga0070667_100020810 3300005367 Bacteria 5449
26 Ga0070667_100052928 3300005367 Bacteria 3426
27 Ga0070713_100686365 3300005436 Bacteria 977
28 Ga0070700_100041903 3300005441 Bacteria 2809
29 Ga0070708_100612716 3300005445 Bacteria 1026
30 Ga0070663_100064988 3300005455 Bacteria 2639
31 Ga0070662_100091559 3300005457 Bacteria 2284
32 Ga0070662_100627588 3300005457 Bacteria 905
33 Ga0070662_100752994 3300005457 Bacteria 826
34 Ga0070681_10033783 3300005458 Bacteria 5134
35 Ga0068867_100789373 3300005459 Bacteria 846
36 Ga0070707_100630482 3300005468 Bacteria 1035
37 Ga0070679_100010641 3300005530 Bacteria 8729
38 Ga0070679_100018909 3300005530 Bacteria 6690
39 Ga0070672_100012251 3300005543 Bacteria 6011
40 Ga0070672_100046024 3300005543 Bacteria 3379
41 Ga0070672_100564264 3300005543 Bacteria 989
42 Ga0070665_100238232 3300005548 Bacteria 1820
43 Ga0068855_100029996 3300005563 Bacteria 6504
44 Ga0068855_100169197 3300005563 Bacteria 2475
45 Ga0070664_100598755 3300005564 Bacteria 1022
46 Ga0068857_100001155 3300005577 Bacteria 20617
47 Ga0068857_100010840 3300005577 Bacteria 7935
48 Ga0068857_100174657 3300005577 Bacteria 1954
49 Ga0068854_100057987 3300005578 Bacteria 2794
50 Ga0068854_100418765 3300005578 Bacteria 1112
51 Ga0068856_100001750 3300005614 Bacteria 22690
52 Ga0068856_100343715 3300005614 Bacteria 1510
53 Ga0068856_100879110 3300005614 Bacteria 915
54 Ga0070702_100109047 3300005615 Bacteria 1713
55 Ga0070702_100197653 3300005615 Bacteria 1328
56 Ga0068859_100000014 3300005617 Bacteria 280955
57 Ga0068864_100069397 3300005618 Bacteria 3065
58 Ga0068864_100101157 3300005618 Bacteria 2556
59 Ga0068864_100133014 3300005618 Bacteria 2237
60 Ga0068863_100263329 3300005841 Bacteria 1667
61 Ga0068862_100000026 3300005844 Bacteria 194499
62 Ga0068862_100005143 3300005844 Bacteria 10998
63 Ga0068862_100134630 3300005844 Bacteria 2189
64 Ga0081538_10039082 3300005981 Bacteria 3049
65 Ga0070717_10232004 3300006028 Unclassified 1625
66 Ga0068871_100653440 3300006358 Bacteria 960
67 Ga0075433_10269456 3300006852 Bacteria 1509
68 Ga0075429_100032558 3300006880 Bacteria 4531
69 Ga0097620_100000014 3300006931 Bacteria 280955
70 Ga0105240_10024042 3300009093 Bacteria 8046
71 Ga0105240_10038420 3300009093 Bacteria 6141
72 Ga0105240_10129369 3300009093 Bacteria 3030
73 Ga0111539_10590312 3300009094 Bacteria 1294
74 Ga0105245_10084597 3300009098 Unclassified 2907
75 Ga0114129_10098343 3300009147 Bacteria 4050
76 Ga0105243_10035964 3300009148 Bacteria 3841
77 Ga0105248_10067486 3300009177 Bacteria 4016
78 Ga0105248_10393333 3300009177 Bacteria 1561
79 Ga0105238_10276355 3300009551 Bacteria 1660
80 Ga0105249_10002150 3300009553 Bacteria 17073
81 Ga0105239_10836131 3300010375 Unclassified 1055
82 Ga0157373_10304188 3300013100 Bacteria 1132
83 Ga0157371_10079017 3300013102 Bacteria 2330
84 Ga0157370_10036086 3300013104 Bacteria 4800
85 Ga0157370_10069010 3300013104 Bacteria 3339
86 Ga0157369_10006459 3300013105 Bacteria 13591
87 Ga0157369_10020065 3300013105 Bacteria 7475
88 Ga0157369_10444741 3300013105 Bacteria 1342
89 Ga0163162_10284715 3300013306 Bacteria 1785
90 Ga0163163_10003733 3300014325 Bacteria 12967
91 Ga0163163_10079049 3300014325 Bacteria 3287
92 Ga0163163_10103483 3300014325 Bacteria 2872
93 Ga0157380_10012020 3300014326 Bacteria 6264
94 Ga0157379_10019088 3300014968 Bacteria 6053
95 Ga0157379_11211496 3300014968 Bacteria 726
96 Ga0182007_10122057 3300015262 Bacteria 872
97 Ga0206350_11440281 3300020080 Bacteria 1376
98 Ga0209148_1001077 3300025254 Bacteria 16630
99 Ga0209455_1001066 3300025272 Bacteria 13541
100 Ga0207680_10031942 3300025903 Bacteria 2987
101 Ga0207645_10098987 3300025907 Bacteria 1880
102 Ga0207643_10037712 3300025908 Bacteria 2712
103 Ga0207705_10018074 3300025909 Bacteria 5042
104 Ga0207705_10455937 3300025909 Bacteria 992
105 Ga0207707_10073541 3300025912 Bacteria 2981
106 Ga0207695_10032180 3300025913 Bacteria 5742
107 Ga0207657_10019971 3300025919 Bacteria 6346
108 Ga0207657_10024626 3300025919 Bacteria 5567
109 Ga0207657_10145185 3300025919 Bacteria 1936
110 Ga0207649_10305786 3300025920 Bacteria 1164
111 Ga0207652_10012328 3300025921 Bacteria 6907
112 Ga0207652_10190569 3300025921 Bacteria 1844
113 Ga0207646_10252079 3300025922 Bacteria 1595
114 Ga0207681_10078492 3300025923 Bacteria 2323
115 Ga0207694_10146875 3300025924 Bacteria 1898
116 Ga0207650_10119037 3300025925 Bacteria 2054
117 Ga0207650_10339545 3300025925 Bacteria 1233
118 Ga0207690_10004768 3300025932 Bacteria 8002
119 Ga0207706_10144678 3300025933 Bacteria 2091
120 Ga0207709_10022015 3300025935 Bacteria 3612
121 Ga0207691_10015758 3300025940 Bacteria 7183
122 Ga0207691_10061531 3300025940 Bacteria 3410
123 Ga0207711_10267748 3300025941 Bacteria 1571
124 Ga0207679_10015139 3300025945 Bacteria 5087
125 Ga0207667_10043648 3300025949 Bacteria 4757
126 Ga0207667_10188269 3300025949 Bacteria 2118
127 Ga0207667_10488732 3300025949 Bacteria 1249
128 Ga0207667_10570385 3300025949 Bacteria 1143
129 Ga0207651_10017742 3300025960 Bacteria 4213
130 Ga0207651_10032298 3300025960 Bacteria 3361
131 Ga0207712_10005866 3300025961 Bacteria 7739
132 Ga0207712_10018592 3300025961 Bacteria 4529
133 Ga0207640_10068874 3300025981 Bacteria 2373
134 Ga0207658_10015998 3300025986 Bacteria 5154
135 Ga0207658_10046366 3300025986 Bacteria 3174
136 Ga0207677_10260975 3300026023 Bacteria 1412
137 Ga0207678_10031832 3300026067 Bacteria 4599
138 Ga0207708_10075778 3300026075 Bacteria 2580
139 Ga0207702_10005335 3300026078 Bacteria 11272
140 Ga0207702_10787446 3300026078 Bacteria 940
141 Ga0207641_10059537 3300026088 Bacteria 3253
142 Ga0207676_10017677 3300026095 Bacteria 5172
143 Ga0207674_10000223 3300026116 Bacteria 70785
144 Ga0207674_10065857 3300026116 Bacteria 3651
145 Ga0207428_10025872 3300027907 Bacteria 4905
146 Ga0268265_10001183 3300028380 Bacteria 22847
147 Ga0268265_10013650 3300028380 Bacteria 5525
148 Ga0307515_10008032 3300028794 Bacteria 20684
149 Ga0265325_10039059 3300031241 Bacteria 2501
150 Ga0265339_10004696 3300031249 Bacteria 9271
151 Ga0265339_10341611 3300031249 Bacteria 707
152 Ga0316575_10070437 3300031665 Bacteria 1404
153 Ga0265314_10123150 3300031711 Bacteria 1629
154 Ga0265342_10000638 3300031712 Bacteria 36736
155 Ga0316576_10015187 3300031727 Bacteria 5162
156 Ga0316576_10092915 3300031727 Bacteria 2248
157 Ga0316578_10018935 3300031728 Bacteria 3781
158 Ga0307516_10000489 3300031730 Bacteria 52655
159 Ga0307516_10204204 3300031730 Bacteria 1694
160 Ga0307406_10188460 3300031901 Bacteria 1508
161 Ga0307415_100097884 3300032126 Bacteria 2143
162 Ga0373943_0224998 3300035170 Bacteria 1046
163 Ga0373935_0271039 3300035692 Bacteria 1193
164 Ga0373935_0936191 3300035692 Bacteria 642
165 Ga0373933_0139711 3300035724 Bacteria 1529
166 Ga0373947_0029357 3300035725 Bacteria 3227
167 Ga0373937_0000046 3300036401 Bacteria 107501
168 Ga0373937_0017953 3300036401 Bacteria 6312
169 Ga0373937_0235870 3300036401 Bacteria 1723
170 Ga0316582_0018261 3300036647 Bacteria 4078
171 Ga0316584_0042968 3300036712 Bacteria 3369
172 Ga0373925_0000017 3300037068 Bacteria 174289
173 Ga0395899_0000086 3300037312 Bacteria 157725
174 Ga0395899_0003234 3300037312 Bacteria 12924
175 Ga0395898_0013685 3300037466 Bacteria 8344
176 Ga0395905_0262111 3300037471 Bacteria 1614
177 Ga0395905_0440030 3300037471 Bacteria 1201
178 Ga0395901_0050332 3300038443 Bacteria 4329
179 Ga0395901_0058626 3300038443 Bacteria 4004
180 Ga0450920_026415 3300042122 Bacteria 1133
181 Ga0450923_027860 3300042125 Bacteria 1138
182 Ga0450894_010928 3300042131 Bacteria 1181
183 Ga0439458_0043420 3300042157 Unclassified 1096
184 Ga0450908_008766 3300042184 Bacteria 1890
185 Ga0439435_0076780 3300042436 Bacteria 997
186 Ga0439460_0063382 3300042461 Bacteria 1132
187 Ga0450918_013409 3300042531 Bacteria 1426
188 Ga0451577_0763594 3300042876 Archaea 874
189 Ga0466969_0000065 3300044656 Bacteria 54697
190 Ga0466966_0024246 3300044684 Bacteria 3969
191 Ga0466966_0026236 3300044684 Bacteria 3804
192 Ga0466961_0042294 3300044693 Bacteria 2920
193 Ga0466961_0147373 3300044693 Bacteria 1471
194 Ga0466963_0149981 3300044694 Bacteria 1618
195 Ga0466964_0013494 3300044706 Bacteria 3099
196 Ga0453684_0000583 3300044712 Bacteria 135940
197 Ga0466971_0092475 3300044719 Bacteria 1385
198 Ga0466970_0063806 3300044765 Bacteria 1975
199 Ga0466957_0104953 3300044842 Bacteria 1785
200 Ga0466957_0295699 3300044842 Bacteria 1087
201 Ga0466959_0041645 3300045049 Bacteria 3390
202 Ga0451576_0000137 3300045051 Bacteria 185212
203 Ga0451576_0127161 3300045051 Unclassified 2655
204 Ga0466958_0048035 3300045836 Bacteria 2577
205 Ga0466967_0062835 3300045976 Bacteria 3297
206 Ga0495617_046006 3300046452 Bacteria 1454
207 Ga0495629_0065401 3300046459 Bacteria 2538
208 Ga0495582_0005032 3300046473 Bacteria 7407
209 Ga0495582_0014201 3300046473 Bacteria 4381
210 Ga0495605_0012814 3300046474 Bacteria 4639
211 Ga0495584_0008375 3300046491 Bacteria 5354
212 Ga0495584_0027514 3300046491 Bacteria 2881
213 Ga0495584_0030025 3300046491 Bacteria 2755
214 Ga0495585_0013637 3300046492 Bacteria 4752
215 Ga0495585_0032844 3300046492 Bacteria 2939
216 Ga0495585_0101873 3300046492 Bacteria 1535
217 Ga0495594_0014715 3300046499 Bacteria 4105
218 Ga0495594_0020580 3300046499 Bacteria 3514
219 Ga0495596_0008944 3300046500 Bacteria 4425
220 Ga0495583_0029798 3300046506 Bacteria 2666
221 Ga0495606_0001127 3300046507 Bacteria 38097
222 Ga0495616_0061659 3300046513 Bacteria 1839
223 Ga0495631_0007346 3300046518 Bacteria 5610
224 Ga0495631_0046823 3300046518 Bacteria 1900
225 Ga0495643_0003843 3300046522 Bacteria 10820
226 Ga0495666_0008061 3300046526 Bacteria 5282
227 Ga0495642_0006459 3300046528 Bacteria 4498
228 Ga0495642_0011631 3300046528 Bacteria 3386
229 Ga0495642_0028621 3300046528 Bacteria 2220
230 Ga0495642_0142582 3300046528 Bacteria 1034
231 Ga0495654_0006538 3300046530 Bacteria 6609
232 Ga0495665_0019840 3300046531 Bacteria 3615
233 Ga0495640_0032626 3300046533 Bacteria 3709
234 Ga0495586_0006360 3300046535 Bacteria 6313
235 Ga0495609_0026553 3300046538 Bacteria 2651
236 Ga0495609_0068212 3300046538 Bacteria 1565
237 Ga0495597_0005044 3300046542 Bacteria 7067
238 Ga0495597_0023070 3300046542 Bacteria 2880
239 Ga0495597_0024423 3300046542 Bacteria 2790
240 Ga0495668_0009774 3300046616 Bacteria 5856
241 Ga0495611_0058166 3300046648 Bacteria 1753
242 Ga0495635_0003163 3300046663 Bacteria 11344
243 Ga0495661_0003759 3300046665 Bacteria 11109
244 Ga0495661_0009378 3300046665 Bacteria 6718
245 Ga0495661_0010373 3300046665 Bacteria 6358
246 Ga0495588_0015767 3300046674 Bacteria 3643
247 Ga0495588_0064470 3300046674 Bacteria 1900
248 Ga0495623_0058764 3300046679 Bacteria 2417
249 Ga0495646_0107222 3300046680 Bacteria 1594
250 Ga0495658_0000539 3300046683 Bacteria 20600
251 Ga0495669_0000032 3300046684 Bacteria 100472
252 Ga0495613_0013023 3300046689 Bacteria 6182
253 Ga0495670_0012586 3300046691 Bacteria 4161
254 Ga0495671_0009361 3300046692 Bacteria 5470
255 Ga0495649_0122863 3300046694 Bacteria 1372
256 Ga0495589_0016226 3300046794 Bacteria 3827
257 Ga0495581_0011257 3300047315 Bacteria 5173
258 Ga0495604_0168159 3300047317 Bacteria 1544
259 Ga0495604_0205092 3300047317 Bacteria 1365
260 Ga0495672_0005775 3300047320 Bacteria 9727
261 Ga0495672_0023862 3300047320 Bacteria 3951
262 Ga0495680_0007731 3300047322 Bacteria 9818
263 Ga0495687_007239 3300047443 Bacteria 6588
264 Ga0495675_0014344 3300047444 Bacteria 5006
265 Ga0495679_080889 3300047446 Bacteria 922
266 Ga0495681_0010512 3300047470 Bacteria 5599
267 Ga0495681_0021561 3300047470 Bacteria 3467
268 Ga0495684_0473495 3300047471 Bacteria 866
269 Ga0495593_0008301 3300047673 Bacteria 6043
270 Ga0495593_0009938 3300047673 Bacteria 5517
271 Ga0495614_0008936 3300048089 Bacteria 4444
272 Ga0495614_0032371 3300048089 Bacteria 2250
273 Ga0496107_0081319 3300048910 Bacteria 2363
274 Ga0496109_0447906 3300048912 Bacteria 1220
275 Ga0496110_0442964 3300048913 Bacteria 1184
276 Ga0496112_0508477 3300048915 Bacteria 1140
277 Ga0501034_0880997 3300049571 Bacteria 784
278 Ga0501037_0021391 3300049573 Bacteria 4779
279 Ga0501037_0437266 3300049573 Unclassified 894
280 Ga0501040_0134264 3300049576 Unclassified 1741
281 Ga0501047_0065934 3300049581 Bacteria 3490
282 Ga0501068_0006806 3300049584 Bacteria 6322
283 Ga0501069_0464477 3300049585 Bacteria 753
284 Ga0501070_0060253 3300049586 Bacteria 3146
285 Ga0501072_0197471 3300049588 Unclassified 1604
286 Ga0501073_0003500 3300049589 Bacteria 11798
287 Ga0501073_0004163 3300049589 Bacteria 10848
288 Ga0501073_0063214 3300049589 Bacteria 2582
289 Ga0501074_0000546 3300049590 Bacteria 23222
290 Ga0501077_0016623 3300049593 Bacteria 4637
291 Ga0501079_0120674 3300049741 Bacteria 2039
292 Ga0501080_0031626 3300049742 Unclassified 4931
293 Ga0501083_0018894 3300049744 Bacteria 4798
294 Ga0501083_0126569 3300049744 Unclassified 1675
295 Ga0501044_0078023 3300049823 Bacteria 3357
296 nmdc:mga0k408_168270_c1 3300050493 Bacteria 1306
297 nmdc:mga06z11_101990_c1 3300050494 Bacteria 1576
298 nmdc:mga04h51_126205_c1 3300050495 Bacteria 958
299 nmdc:mga09592_35164_c1 3300050508 Bacteria 4192
300 Ga0495601_0362889 3300053077 Unclassified 941
301 Ga0495619_0065345 3300053085 Bacteria 2427
302 Ga0501084_0065999 3300054114 Bacteria 3028
303 Ga0590071_005773 3300059421 Bacteria 2968
304 Ga0501082_0099859 3300060353 Bacteria 2509
305 Ga0466962_0025117 3300061719 Bacteria 2860
306 2657685022 2657244999 Bacteria 5946535
307 2676203540 2675902999 Bacteria 9438463
308 2774848116 2773857921 Bacteria 9435764
309 2792583588 2791355082 Bacteria 5973319
310 2804754857 2802429268 Bacteria 6094027
311 2858905448 2858902515 Bacteria 7086037
312 2880493958 2880489317 Bacteria 7096270
313 2880498382 2880495981 Bacteria 7340502
314 2885277040 2885270888 Bacteria 9831543
315 2929226968 2929226422 Bacteria 7248583
316 8003874532 8003870546 Bacteria 7396674
317 8033686827 8033684223 Bacteria 6906479
318 8049297974 8049293176 Bacteria 6128433
319 8054710091 8054704163 Bacteria 7247792
320 Ga0068855_100128093
321 Ga0070658_10003236
322 Ga0070658_10003312
323 Ga0070676_10094306
324 Ga0070683_100323221
325 Ga0070670_100063631
326 Ga0070670_100066986
327 Ga0068869_100037691
328 Ga0070666_10181029
329 Ga0070666_10209589
330 Ga0070680_100009958
331 Ga0068868_100094250
332 Ga0070660_100031203
333 Ga0070660_100062455
334 Ga0070660_100122283
335 Ga0070691_10150058
336 Ga0070661_100040500
337 Ga0070668_100005475
338 Ga0070675_100571884
339 Ga0070671_100007927
340 Ga0070671_100223476
341 Ga0070673_100027976
342 Ga0070673_100040004
343 Ga0070688_100044561
344 Ga0070667_100020810
345 Ga0070667_100052928
346 Ga0070713_100686365
347 Ga0070700_100041903
348 Ga0070708_100612716
349 Ga0070663_100064988
350 Ga0070662_100091559
351 Ga0070662_100627588
352 Ga0070662_100752994
353 Ga0070681_10033783
354 Ga0068867_100789373
355 Ga0070707_100630482
356 Ga0070679_100010641
357 Ga0070679_100018909
358 Ga0070672_100012251
359 Ga0070672_100046024
360 Ga0070672_100564264
361 Ga0070665_100238232
362 Ga0068855_100029996
363 Ga0068855_100169197
364 Ga0070664_100598755
365 Ga0068857_100001155
366 Ga0068857_100010840
367 Ga0068857_100174657
368 Ga0068854_100057987
369 Ga0068854_100418765
370 Ga0068856_100001750
371 Ga0068856_100343715
372 Ga0068856_100879110
373 Ga0070702_100109047
374 Ga0070702_100197653
375 Ga0068859_100000014
376 Ga0068864_100069397
377 Ga0068864_100101157
378 Ga0068864_100133014
379 Ga0068863_100263329
380 Ga0068862_100000026
381 Ga0068862_100005143
382 Ga0068862_100134630
383 Ga0081538_10039082
384 Ga0070717_10232004
385 Ga0068871_100653440
386 Ga0075433_10269456
387 Ga0075429_100032558
388 Ga0097620_100000014
389 Ga0105240_10024042
390 Ga0105240_10038420
391 Ga0105240_10129369
392 Ga0111539_10590312
393 Ga0105245_10084597
394 Ga0114129_10098343
395 Ga0105243_10035964
396 Ga0105248_10067486
397 Ga0105248_10393333
398 Ga0105238_10276355
399 Ga0105249_10002150
400 Ga0105239_10836131
401 Ga0157373_10304188
402 Ga0157371_10079017
403 Ga0157370_10036086
404 Ga0157370_10069010
405 Ga0157369_10006459
406 Ga0157369_10020065
407 Ga0157369_10444741
408 Ga0163162_10284715
409 Ga0163163_10003733
410 Ga0163163_10079049
411 Ga0163163_10103483
412 Ga0157380_10012020
413 Ga0157379_10019088
414 Ga0157379_11211496
415 Ga0182007_10122057
416 Ga0206350_11440281
417 Ga0209148_1001077
418 Ga0209455_1001066
419 Ga0207680_10031942
420 Ga0207645_10098987
421 Ga0207643_10037712
422 Ga0207705_10018074
423 Ga0207705_10455937
424 Ga0207707_10073541
425 Ga0207695_10032180
426 Ga0207657_10019971
427 Ga0207657_10024626
428 Ga0207657_10145185
429 Ga0207649_10305786
430 Ga0207652_10012328
431 Ga0207652_10190569
432 Ga0207646_10252079
433 Ga0207681_10078492
434 Ga0207694_10146875
435 Ga0207650_10119037
436 Ga0207650_10339545
437 Ga0207690_10004768
438 Ga0207706_10144678
439 Ga0207709_10022015
440 Ga0207691_10015758
441 Ga0207691_10061531
442 Ga0207711_10267748
443 Ga0207679_10015139
444 Ga0207667_10043648
445 Ga0207667_10188269
446 Ga0207667_10488732
447 Ga0207667_10570385
448 Ga0207651_10017742
449 Ga0207651_10032298
450 Ga0207712_10005866
451 Ga0207712_10018592
452 Ga0207640_10068874
453 Ga0207658_10015998
454 Ga0207658_10046366
455 Ga0207677_10260975
456 Ga0207678_10031832
457 Ga0207708_10075778
458 Ga0207702_10005335
459 Ga0207702_10787446
460 Ga0207641_10059537
461 Ga0207676_10017677
462 Ga0207674_10000223
463 Ga0207674_10065857
464 Ga0207428_10025872
465 Ga0268265_10001183
466 Ga0268265_10013650
467 Ga0307515_10008032
468 Ga0265325_10039059
469 Ga0265339_10004696
470 Ga0265339_10341611
471 Ga0316575_10070437
472 Ga0265314_10123150
473 Ga0265342_10000638
474 Ga0316576_10015187
475 Ga0316576_10092915
476 Ga0316578_10018935
477 Ga0307516_10000489
478 Ga0307516_10204204
479 Ga0307406_10188460
480 Ga0307415_100097884
481 Ga0373943_0224998
482 Ga0373935_0271039
483 Ga0373935_0936191
484 Ga0373933_0139711
485 Ga0373947_0029357
486 Ga0373937_0000046
487 Ga0373937_0017953
488 Ga0373937_0235870
489 Ga0316582_0018261
490 Ga0316584_0042968
491 Ga0373925_0000017
492 Ga0395899_0000086
493 Ga0395899_0003234
494 Ga0395898_0013685
495 Ga0395905_0262111
496 Ga0395905_0440030
497 Ga0395901_0050332
498 Ga0395901_0058626
499 Ga0450920_026415
500 Ga0450923_027860
501 Ga0450894_010928
502 Ga0439458_0043420
503 Ga0450908_008766
504 Ga0439435_0076780
505 Ga0439460_0063382
506 Ga0450918_013409
507 Ga0451577_0763594
508 Ga0466969_0000065
509 Ga0466966_0024246
510 Ga0466966_0026236
511 Ga0466961_0042294
512 Ga0466961_0147373
513 Ga0466963_0149981
514 Ga0466964_0013494
515 Ga0453684_0000583
516 Ga0466971_0092475
517 Ga0466970_0063806
518 Ga0466957_0104953
519 Ga0466957_0295699
520 Ga0466959_0041645
521 Ga0451576_0000137
522 Ga0451576_0127161
523 Ga0466958_0048035
524 Ga0466967_0062835
525 Ga0495617_046006
526 Ga0495629_0065401
527 Ga0495582_0005032
528 Ga0495582_0014201
529 Ga0495605_0012814
530 Ga0495584_0008375
531 Ga0495584_0027514
532 Ga0495584_0030025
533 Ga0495585_0013637
534 Ga0495585_0032844
535 Ga0495585_0101873
536 Ga0495594_0014715
537 Ga0495594_0020580
538 Ga0495596_0008944
539 Ga0495583_0029798
540 Ga0495606_0001127
541 Ga0495616_0061659
542 Ga0495631_0007346
543 Ga0495631_0046823
544 Ga0495643_0003843
545 Ga0495666_0008061
546 Ga0495642_0006459
547 Ga0495642_0011631
548 Ga0495642_0028621
549 Ga0495642_0142582
550 Ga0495654_0006538
551 Ga0495665_0019840
552 Ga0495640_0032626
553 Ga0495586_0006360
554 Ga0495609_0026553
555 Ga0495609_0068212
556 Ga0495597_0005044
557 Ga0495597_0023070
558 Ga0495597_0024423
559 Ga0495668_0009774
560 Ga0495611_0058166
561 Ga0495635_0003163
562 Ga0495661_0003759
563 Ga0495661_0009378
564 Ga0495661_0010373
565 Ga0495588_0015767
566 Ga0495588_0064470
567 Ga0495623_0058764
568 Ga0495646_0107222
569 Ga0495658_0000539
570 Ga0495669_0000032
571 Ga0495613_0013023
572 Ga0495670_0012586
573 Ga0495671_0009361
574 Ga0495649_0122863
575 Ga0495589_0016226
576 Ga0495581_0011257
577 Ga0495604_0168159
578 Ga0495604_0205092
579 Ga0495672_0005775
580 Ga0495672_0023862
581 Ga0495680_0007731
582 Ga0495687_007239
583 Ga0495675_0014344
584 Ga0495679_080889
585 Ga0495681_0010512
586 Ga0495681_0021561
587 Ga0495684_0473495
588 Ga0495593_0008301
589 Ga0495593_0009938
590 Ga0495614_0008936
591 Ga0495614_0032371
592 Ga0496107_0081319
593 Ga0496109_0447906
594 Ga0496110_0442964
595 Ga0496112_0508477
596 Ga0501034_0880997
597 Ga0501037_0021391
598 Ga0501037_0437266
599 Ga0501040_0134264
600 Ga0501047_0065934
601 Ga0501068_0006806
602 Ga0501069_0464477
603 Ga0501070_0060253
604 Ga0501072_0197471
605 Ga0501073_0003500
606 Ga0501073_0004163
607 Ga0501073_0063214
608 Ga0501074_0000546
609 Ga0501077_0016623
610 Ga0501079_0120674
611 Ga0501080_0031626
612 Ga0501083_0018894
613 Ga0501083_0126569
614 Ga0501044_0078023
615 nmdc:mga0k408_168270_c1
616 nmdc:mga06z11_101990_c1
617 nmdc:mga04h51_126205_c1
618 nmdc:mga09592_35164_c1
619 Ga0495601_0362889
620 Ga0495619_0065345
621 Ga0501084_0065999
622 Ga0590071_005773
623 Ga0501082_0099859
624 Ga0466962_0025117
625 2657685022
626 2676203540
627 2774848116
628 2792583588
629 2804754857
630 2858905448
631 2880493958
632 2880498382
633 2885277040
634 2929226968
635 8003874532
636 8033686827
637 8049297974
638 8054710091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

56

235

0.77

PF01738

DLH

Dienelactone hydrolase family

46

242

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.9554 10 217
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.9166 10 217
7v8x-assembly1.cif.gz_A crystal structure of psest3 complexed with phenylmethylsulfonyl fluoride (pmsf) 0.8375 8 215
7xrh-assembly1.cif.gz_A feruloyl esterase from lactobacillus acidophilus 0.836 11 212
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.836 13 215
ID Description Score Start End Superfamily
2o2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9458 10 217 3.40.50.1820
2o2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9157 10 217 3.40.50.1820
af_Q55AW8_119_343_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9132 3 210 3.40.50.1820
af_K7L0K3_2_222_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8581 85 220 3.40.50.1820
af_Q55AW8_119_343_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8508 3 210 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A259Q2N1-F1-model_v4 Hydrolase 0.9981 121 216 GO:0016787
AF-A0A7V3FKP0-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.996 40 217 GO:0016787
AF-A0A530L6Q0-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9956 111 207 GO:0016787
AF-F8XV65-F1-model_v4 deleted 0.9947 24 136
AF-A0A533YWY5-F1-model_v4 Alpha/beta hydrolase 0.9947 132 216 GO:0016787

Map