F404721

General Info

Members Datasets Scaffolds Average Seq Length
318 226 636 69

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_0199782|Ga0451843_0199782_219_455
Length 78
Sequence MRPPRTEQTMANHVYSISEVVGTSPDGIEAAVGNAVTQAAKTVRNLDWFEVQSVRGQIADGAVAHWQVTVKLGFRLDD

Samples

Sample ID Description Type Environment
1 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
134 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
151 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
152 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2643221546 Microbacterium sp. Root53 Isolate Unclassified
224 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
225 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
226 2932398195 Dietzia sp. 2505 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 2.52
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 11.64
Rhizosphere 80.5
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451843_0199782 3300041509 Bacteria 1562
2 JGI24750J21931_1012852 3300002070 Unclassified 1114
3 rootH2_10229244 3300003320 Unclassified 1592
4 Ga0058862_12633376 3300004803 Bacteria 622
5 Ga0070658_11163539 3300005327 Bacteria 671
6 Ga0070683_100030285 3300005329 Bacteria 4910
7 Ga0070683_100098536 3300005329 Bacteria 2751
8 Ga0070683_100833843 3300005329 Bacteria 884
9 Ga0070670_100411035 3300005331 Bacteria 1196
10 Ga0070670_101306172 3300005331 Bacteria 664
11 Ga0070677_10735252 3300005333 Unclassified 558
12 Ga0068869_100331897 3300005334 Bacteria 1236
13 Ga0070666_11516173 3300005335 Bacteria 502
14 Ga0070680_100739577 3300005336 Bacteria 847
15 Ga0070682_100170556 3300005337 Bacteria 1512
16 Ga0068868_100042625 3300005338 Bacteria 3543
17 Ga0068868_100120609 3300005338 Bacteria 2138
18 Ga0070660_101115811 3300005339 Bacteria 668
19 Ga0070687_101373445 3300005343 Bacteria 527
20 Ga0070692_10280644 3300005345 Bacteria 1009
21 Ga0070668_100033606 3300005347 Bacteria 3906
22 Ga0070675_100421692 3300005354 Bacteria 1193
23 Ga0070675_102090933 3300005354 Unclassified 522
24 Ga0070671_100604007 3300005355 Bacteria 948
25 Ga0070674_100350074 3300005356 Bacteria 1193
26 Ga0070659_101116639 3300005366 Bacteria 695
27 Ga0070667_100007589 3300005367 Bacteria 8995
28 Ga0070667_100221465 3300005367 Bacteria 1684
29 Ga0070667_100234930 3300005367 Bacteria 1636
30 Ga0070667_100535454 3300005367 Bacteria 1076
31 Ga0070709_10972353 3300005434 Bacteria 674
32 Ga0070714_100839916 3300005435 Bacteria 890
33 Ga0070713_101511522 3300005436 Bacteria 652
34 Ga0070701_10066859 3300005438 Bacteria 1911
35 Ga0070708_101204365 3300005445 Bacteria 708
36 Ga0070663_100244071 3300005455 Bacteria 1419
37 Ga0070678_100744025 3300005456 Bacteria 886
38 Ga0070681_10967470 3300005458 Bacteria 771
39 Ga0070681_11477511 3300005458 Bacteria 604
40 Ga0070706_100059094 3300005467 Bacteria 3538
41 Ga0070707_100029932 3300005468 Bacteria 5181
42 Ga0070698_100044609 3300005471 Bacteria 4539
43 Ga0070679_101222261 3300005530 Bacteria 697
44 Ga0070684_100068093 3300005535 Bacteria 3128
45 Ga0070684_100477808 3300005535 Bacteria 1153
46 Ga0070697_101657393 3300005536 Unclassified 572
47 Ga0070672_100574780 3300005543 Bacteria 980
48 Ga0070672_101558049 3300005543 Bacteria 592
49 Ga0070686_101674169 3300005544 Bacteria 539
50 Ga0070693_100344464 3300005547 Bacteria 1018
51 Ga0070693_100661286 3300005547 Bacteria 761
52 Ga0070693_101430584 3300005547 Bacteria 538
53 Ga0070693_101457336 3300005547 Bacteria 534
54 Ga0070665_100130010 3300005548 Bacteria 2520
55 Ga0070665_100460591 3300005548 Bacteria 1282
56 Ga0070665_100905102 3300005548 Bacteria 895
57 Ga0070704_100477416 3300005549 Bacteria 1078
58 Ga0070664_100391439 3300005564 Bacteria 1270
59 Ga0070664_100835983 3300005564 Bacteria 862
60 Ga0068857_100069312 3300005577 Bacteria 3140
61 Ga0068856_100597318 3300005614 Bacteria 1125
62 Ga0068852_100624021 3300005616 Bacteria 1084
63 Ga0068859_100025963 3300005617 Bacteria 5877
64 Ga0068859_100173173 3300005617 Bacteria 2240
65 Ga0068859_101821300 3300005617 Bacteria 672
66 Ga0068864_100661108 3300005618 Bacteria 1018
67 Ga0068864_102201386 3300005618 Bacteria 558
68 Ga0068861_100431567 3300005719 Bacteria 1176
69 Ga0068863_100902501 3300005841 Bacteria 884
70 Ga0068863_101555288 3300005841 Bacteria 670
71 Ga0068858_100498993 3300005842 Bacteria 1176
72 Ga0068860_100593149 3300005843 Bacteria 1113
73 Ga0068860_101329765 3300005843 Bacteria 740
74 Ga0068862_100009625 3300005844 Bacteria 7987
75 Ga0081455_10009436 3300005937 Bacteria 10038
76 Ga0081539_10051083 3300005985 Bacteria 2333
77 Ga0075365_10184675 3300006038 Unclassified 1458
78 Ga0075368_10278227 3300006042 Bacteria 719
79 Ga0075363_100581853 3300006048 Bacteria 670
80 Ga0075367_10457766 3300006178 Bacteria 809
81 Ga0075369_10075140 3300006186 Bacteria 1492
82 Ga0075370_10221289 3300006353 Bacteria 1119
83 Ga0075431_100802750 3300006847 Bacteria 914
84 Ga0068865_101872925 3300006881 Bacteria 543
85 Ga0097620_100025963 3300006931 Bacteria 5877
86 Ga0097620_100173178 3300006931 Bacteria 2240
87 Ga0097620_101821472 3300006931 Bacteria 672
88 Ga0111539_12343021 3300009094 Bacteria 619
89 Ga0105245_10750307 3300009098 Bacteria 1012
90 Ga0105247_10520275 3300009101 Bacteria 870
91 Ga0105247_10707337 3300009101 Bacteria 759
92 Ga0105243_10015021 3300009148 Bacteria 5862
93 Ga0105243_10706386 3300009148 Bacteria 983
94 Ga0105243_11516521 3300009148 Bacteria 694
95 Ga0105242_12676122 3300009176 Bacteria 548
96 Ga0105237_10712977 3300009545 Bacteria 1010
97 Ga0105238_10650659 3300009551 Bacteria 1064
98 Ga0105238_11160837 3300009551 Bacteria 796
99 Ga0105249_10003273 3300009553 Bacteria 14037
100 Ga0105239_10524676 3300010375 Bacteria 1347
101 Ga0157369_10002192 3300013105 Bacteria 23536
102 Ga0157369_10757321 3300013105 Bacteria 999
103 Ga0163162_10382248 3300013306 Bacteria 1541
104 Ga0163162_10630301 3300013306 Unclassified 1197
105 Ga0157375_10367613 3300013308 Unclassified 1604
106 Ga0163163_10204901 3300014325 Bacteria 2021
107 Ga0163163_10230737 3300014325 Bacteria 1900
108 Ga0163163_10391168 3300014325 Bacteria 1448
109 Ga0163163_10416474 3300014325 Bacteria 1402
110 Ga0157379_10089946 3300014968 Bacteria 2754
111 Ga0197907_10156581 3300020069 Bacteria 511
112 Ga0197907_10601145 3300020069 Bacteria 511
113 Ga0206356_10776589 3300020070 Bacteria 1230
114 Ga0206356_11062009 3300020070 Bacteria 660
115 Ga0206354_10791373 3300020081 Bacteria 1298
116 Ga0206354_11238165 3300020081 Bacteria 1442
117 Ga0206353_11531586 3300020082 Bacteria 1755
118 Ga0213871_10225838 3300021441 Bacteria 590
119 Ga0207642_10225171 3300025899 Bacteria 1050
120 Ga0207688_10325668 3300025901 Bacteria 943
121 Ga0207680_10047078 3300025903 Bacteria 2553
122 Ga0207680_10098976 3300025903 Bacteria 1870
123 Ga0207647_10366442 3300025904 Bacteria 815
124 Ga0207643_10711117 3300025908 Bacteria 649
125 Ga0207705_11283734 3300025909 Bacteria 560
126 Ga0207684_10630413 3300025910 Bacteria 914
127 Ga0207671_10345146 3300025914 Bacteria 1180
128 Ga0207660_10138832 3300025917 Bacteria 1857
129 Ga0207652_10192003 3300025921 Bacteria 1837
130 Ga0207652_10329568 3300025921 Bacteria 1378
131 Ga0207646_10133176 3300025922 Bacteria 2238
132 Ga0207681_11183745 3300025923 Unclassified 642
133 Ga0207694_10576443 3300025924 Bacteria 945
134 Ga0207650_10494157 3300025925 Archaea 1022
135 Ga0207659_10549413 3300025926 Bacteria 982
136 Ga0207700_11078521 3300025928 Bacteria 718
137 Ga0207664_10525475 3300025929 Bacteria 1061
138 Ga0207709_10006701 3300025935 Bacteria 6455
139 Ga0207709_11096748 3300025935 Bacteria 653
140 Ga0207689_10426079 3300025942 Bacteria 1107
141 Ga0207661_10104688 3300025944 Bacteria 2383
142 Ga0207661_10176212 3300025944 Bacteria 1864
143 Ga0207661_11174696 3300025944 Bacteria 706
144 Ga0207679_10178605 3300025945 Bacteria 1754
145 Ga0207679_11344566 3300025945 Bacteria 655
146 Ga0207712_10010266 3300025961 Bacteria 5941
147 Ga0207668_10086120 3300025972 Bacteria 2294
148 Ga0207658_10005493 3300025986 Bacteria 8690
149 Ga0207658_10037914 3300025986 Bacteria 3467
150 Ga0207677_10045730 3300026023 Bacteria 2925
151 Ga0207703_10077653 3300026035 Bacteria 2757
152 Ga0207678_10032831 3300026067 Bacteria 4524
153 Ga0207702_10278343 3300026078 Bacteria 1581
154 Ga0207648_11127063 3300026089 Bacteria 736
155 Ga0207674_10021872 3300026116 Bacteria 6881
156 Ga0207674_10870335 3300026116 Bacteria 869
157 Ga0207683_10402089 3300026121 Bacteria 1260
158 Ga0268266_10000537 3300028379 Bacteria 52878
159 Ga0268266_10067258 3300028379 Bacteria 3101
160 Ga0268265_10009733 3300028380 Bacteria 6487
161 Ga0268264_10232698 3300028381 Bacteria 1703
162 Ga0307408_102017876 3300031548 Bacteria 555
163 Ga0307409_102973600 3300031995 Bacteria 500
164 Ga0307416_100491011 3300032002 Bacteria 1290
165 Ga0307416_102956138 3300032002 Bacteria 569
166 Ga0307414_11370668 3300032004 Bacteria 657
167 Ga0307411_11520022 3300032005 Bacteria 616
168 Ga0307415_101721582 3300032126 Bacteria 605
169 Ga0395899_0140483 3300037312 Bacteria 1719
170 Ga0395900_0039945 3300037418 Bacteria 4836
171 Ga0395900_0230301 3300037418 Bacteria 1864
172 Ga0395900_0237246 3300037418 Bacteria 1831
173 Ga0395900_0751605 3300037418 Bacteria 905
174 Ga0395898_0023611 3300037466 Bacteria 6211
175 Ga0395898_0031460 3300037466 Bacteria 5301
176 Ga0395898_0152833 3300037466 Bacteria 2208
177 Ga0395898_0908699 3300037466 Bacteria 818
178 Ga0395905_0167440 3300037471 Bacteria 2065
179 Ga0395905_1521978 3300037471 Unclassified 573
180 Ga0395901_0033206 3300038443 Bacteria 5326
181 Ga0395901_0033278 3300038443 Bacteria 5320
182 Ga0395901_0349456 3300038443 Bacteria 1526
183 Ga0395901_0663238 3300038443 Unclassified 1045
184 Ga0395901_0666339 3300038443 Bacteria 1042
185 Ga0395901_0790153 3300038443 Bacteria 939
186 Ga0395901_0991744 3300038443 Unclassified 816
187 Ga0395901_1060861 3300038443 Bacteria 783
188 Ga0436360_1130407 3300039438 Bacteria 4157
189 Ga0436361_0272461 3300039447 Bacteria 534
190 Ga0436363_0607453 3300039450 Bacteria 811
191 Ga0436362_0430129 3300039453 Unclassified 555
192 Ga0439436_0000186 3300041404 Bacteria 14652
193 Ga0439438_000427 3300041405 Bacteria 19088
194 Ga0439447_016750 3300041407 Bacteria 2006
195 Ga0439466_0006671 3300041411 Bacteria 4379
196 Ga0439465_0056466 3300041413 Bacteria 1294
197 Ga0451789_1144981 3300041443 Bacteria 663
198 Ga0451797_0767992 3300041453 Unclassified 550
199 Ga0451797_1169391 3300041453 Bacteria 585
200 Ga0451795_0793840 3300041456 Bacteria 500
201 Ga0451802_0325383 3300041460 Bacteria 753
202 Ga0451833_1053373 3300041491 Bacteria 550
203 Ga0451837_0402276 3300041494 Bacteria 1371
204 Ga0451855_1206275 3300041511 Bacteria 734
205 Ga0451853_2065560 3300041512 Bacteria 1325
206 Ga0439431_0026964 3300041997 Bacteria 1410
207 Ga0439432_006135 3300042006 Bacteria 4304
208 Ga0439452_001817 3300042010 Bacteria 8285
209 Ga0450919_006705 3300042121 Bacteria 1358
210 Ga0439446_0009957 3300042156 Bacteria 2552
211 Ga0450909_009592 3300042185 Bacteria 1413
212 Ga0439434_0000205 3300042435 Bacteria 16332
213 Ga0450918_037909 3300042531 Bacteria 861
214 Ga0466972_0022014 3300044658 Bacteria 3174
215 Ga0453683_0324777 3300044673 Unclassified 986
216 Ga0466966_0787272 3300044684 Bacteria 573
217 Ga0466964_0228956 3300044706 Bacteria 906
218 Ga0466970_0054395 3300044765 Bacteria 2137
219 Ga0466970_0641760 3300044765 Bacteria 617
220 Ga0466960_0330429 3300044901 Bacteria 865
221 Ga0466959_0156155 3300045049 Unclassified 1606
222 Ga0451576_0592381 3300045051 Unclassified 1165
223 Ga0466967_0070215 3300045976 Bacteria 3133
224 Ga0466967_0522579 3300045976 Bacteria 1166
225 Ga0466967_0644618 3300045976 Bacteria 1047
226 Ga0466967_2473909 3300045976 Bacteria 514
227 Ga0495630_1367674 3300046517 Bacteria 533
228 Ga0495632_0249673 3300046519 Bacteria 796
229 Ga0495644_0205912 3300046523 Bacteria 759
230 Ga0495656_0251765 3300046615 Bacteria 892
231 Ga0495658_0784588 3300046683 Bacteria 610
232 Ga0495624_0327193 3300046690 Bacteria 923
233 Ga0495581_0476423 3300047315 Bacteria 726
234 Ga0496100_0036194 3300048903 Bacteria 3111
235 Ga0496100_0072971 3300048903 Bacteria 2296
236 Ga0496101_0010461 3300048904 Bacteria 6126
237 Ga0496101_0502542 3300048904 Bacteria 958
238 Ga0496102_0005118 3300048905 Bacteria 11113
239 Ga0496102_0067400 3300048905 Bacteria 3283
240 Ga0496102_0294655 3300048905 Unclassified 1529
241 Ga0496102_1341909 3300048905 Bacteria 634
242 Ga0496103_0003925 3300048906 Bacteria 9042
243 Ga0496104_0225286 3300048907 Bacteria 1787
244 Ga0496104_0493683 3300048907 Bacteria 1135
245 Ga0496105_0012515 3300048908 Bacteria 6717
246 Ga0496106_1594242 3300048909 Bacteria 500
247 Ga0496107_0075030 3300048910 Bacteria 2461
248 Ga0496108_0042799 3300048911 Bacteria 3782
249 Ga0496109_0375972 3300048912 Bacteria 1342
250 Ga0496109_1395761 3300048912 Bacteria 636
251 Ga0496109_1819134 3300048912 Bacteria 542
252 Ga0496110_1237752 3300048913 Bacteria 655
253 Ga0496111_0016200 3300048914 Bacteria 5135
254 Ga0496111_0223485 3300048914 Bacteria 1399
255 Ga0496111_0808150 3300048914 Bacteria 678
256 Ga0496112_0958388 3300048915 Bacteria 776
257 Ga0496113_0108867 3300048916 Bacteria 2154
258 Ga0496113_0672812 3300048916 Bacteria 827
259 Ga0496113_0967787 3300048916 Bacteria 671
260 Ga0496114_0021086 3300048917 Bacteria 5297
261 Ga0496114_0065241 3300048917 Bacteria 3050
262 Ga0496114_0148453 3300048917 Bacteria 2033
263 Ga0496114_1388150 3300048917 Bacteria 590
264 Ga0496115_0221020 3300048918 Bacteria 1563
265 Ga0496115_1362039 3300048918 Bacteria 526
266 Ga0496118_0291349 3300048921 Bacteria 902
267 Ga0496119_0005627 3300048922 Bacteria 11912
268 Ga0496120_0237004 3300048923 Bacteria 863
269 Ga0496121_0027269 3300048924 Bacteria 5349
270 Ga0496121_0269929 3300048924 Bacteria 1170
271 Ga0496124_0064489 3300048927 Bacteria 3057
272 Ga0496126_0193028 3300048929 Bacteria 1724
273 Ga0501031_0003658 3300049568 Bacteria 9898
274 Ga0501031_0664026 3300049568 Bacteria 670
275 Ga0501032_0005553 3300049569 Bacteria 9354
276 Ga0501033_0036787 3300049570 Bacteria 3666
277 Ga0501034_0005262 3300049571 Bacteria 14201
278 Ga0501034_0274458 3300049571 Bacteria 1626
279 Ga0501036_0004325 3300049572 Bacteria 11470
280 Ga0501036_1511133 3300049572 Bacteria 543
281 Ga0501037_0000534 3300049573 Bacteria 30335
282 Ga0501038_0008406 3300049574 Bacteria 9493
283 Ga0501039_0003939 3300049575 Bacteria 11158
284 Ga0501040_0248476 3300049576 Bacteria 1269
285 Ga0501041_0560890 3300049577 Bacteria 728
286 Ga0501043_0007661 3300049579 Bacteria 8556
287 Ga0501046_0007536 3300049580 Bacteria 9547
288 Ga0501046_0720646 3300049580 Bacteria 702
289 Ga0501047_0121028 3300049581 Bacteria 2499
290 Ga0501047_0189083 3300049581 Bacteria 1923
291 Ga0501048_0003561 3300049582 Bacteria 11850
292 Ga0501048_0152530 3300049582 Bacteria 1635
293 Ga0501067_0437164 3300049583 Bacteria 730
294 Ga0501068_0040661 3300049584 Bacteria 2792
295 Ga0501069_0451302 3300049585 Bacteria 764
296 Ga0501070_0011842 3300049586 Bacteria 7364
297 Ga0501070_1483608 3300049586 Bacteria 513
298 Ga0501071_0448911 3300049587 Bacteria 987
299 Ga0501074_0459230 3300049590 Bacteria 903
300 Ga0501075_0728688 3300049591 Bacteria 755
301 Ga0501076_0729337 3300049592 Bacteria 818
302 Ga0501079_0552228 3300049741 Bacteria 906
303 Ga0501080_0136597 3300049742 Bacteria 2269
304 Ga0501035_0012643 3300049822 Bacteria 7799
305 Ga0501044_0015510 3300049823 Bacteria 8206
306 Ga0501044_0131989 3300049823 Bacteria 2491
307 Ga0501045_0006886 3300049824 Bacteria 7879
308 nmdc:mga03n38_181180_c1 3300050490 Bacteria 1079
309 nmdc:mga0yw44_926097_c1 3300050492 Bacteria 591
310 Ga0501084_0301331 3300054114 Bacteria 1354
311 Ga0501082_0281585 3300060353 Bacteria 1447
312 Ga0501082_0425498 3300060353 Bacteria 1160
313 Ga0530510_0293546 3300061734 Bacteria 1216
314 Ga0530510_0627253 3300061734 Bacteria 818
315 2643752237 2643221546 Bacteria 2910897
316 2819428743 2818991318 Bacteria 5266538
317 2848553130 2848551377 Bacteria 3720646
318 2932399503 2932398195 Bacteria 3847976
319 Ga0451843_0199782
320 JGI24750J21931_1012852
321 rootH2_10229244
322 Ga0058862_12633376
323 Ga0070658_11163539
324 Ga0070683_100030285
325 Ga0070683_100098536
326 Ga0070683_100833843
327 Ga0070670_100411035
328 Ga0070670_101306172
329 Ga0070677_10735252
330 Ga0068869_100331897
331 Ga0070666_11516173
332 Ga0070680_100739577
333 Ga0070682_100170556
334 Ga0068868_100042625
335 Ga0068868_100120609
336 Ga0070660_101115811
337 Ga0070687_101373445
338 Ga0070692_10280644
339 Ga0070668_100033606
340 Ga0070675_100421692
341 Ga0070675_102090933
342 Ga0070671_100604007
343 Ga0070674_100350074
344 Ga0070659_101116639
345 Ga0070667_100007589
346 Ga0070667_100221465
347 Ga0070667_100234930
348 Ga0070667_100535454
349 Ga0070709_10972353
350 Ga0070714_100839916
351 Ga0070713_101511522
352 Ga0070701_10066859
353 Ga0070708_101204365
354 Ga0070663_100244071
355 Ga0070678_100744025
356 Ga0070681_10967470
357 Ga0070681_11477511
358 Ga0070706_100059094
359 Ga0070707_100029932
360 Ga0070698_100044609
361 Ga0070679_101222261
362 Ga0070684_100068093
363 Ga0070684_100477808
364 Ga0070697_101657393
365 Ga0070672_100574780
366 Ga0070672_101558049
367 Ga0070686_101674169
368 Ga0070693_100344464
369 Ga0070693_100661286
370 Ga0070693_101430584
371 Ga0070693_101457336
372 Ga0070665_100130010
373 Ga0070665_100460591
374 Ga0070665_100905102
375 Ga0070704_100477416
376 Ga0070664_100391439
377 Ga0070664_100835983
378 Ga0068857_100069312
379 Ga0068856_100597318
380 Ga0068852_100624021
381 Ga0068859_100025963
382 Ga0068859_100173173
383 Ga0068859_101821300
384 Ga0068864_100661108
385 Ga0068864_102201386
386 Ga0068861_100431567
387 Ga0068863_100902501
388 Ga0068863_101555288
389 Ga0068858_100498993
390 Ga0068860_100593149
391 Ga0068860_101329765
392 Ga0068862_100009625
393 Ga0081455_10009436
394 Ga0081539_10051083
395 Ga0075365_10184675
396 Ga0075368_10278227
397 Ga0075363_100581853
398 Ga0075367_10457766
399 Ga0075369_10075140
400 Ga0075370_10221289
401 Ga0075431_100802750
402 Ga0068865_101872925
403 Ga0097620_100025963
404 Ga0097620_100173178
405 Ga0097620_101821472
406 Ga0111539_12343021
407 Ga0105245_10750307
408 Ga0105247_10520275
409 Ga0105247_10707337
410 Ga0105243_10015021
411 Ga0105243_10706386
412 Ga0105243_11516521
413 Ga0105242_12676122
414 Ga0105237_10712977
415 Ga0105238_10650659
416 Ga0105238_11160837
417 Ga0105249_10003273
418 Ga0105239_10524676
419 Ga0157369_10002192
420 Ga0157369_10757321
421 Ga0163162_10382248
422 Ga0163162_10630301
423 Ga0157375_10367613
424 Ga0163163_10204901
425 Ga0163163_10230737
426 Ga0163163_10391168
427 Ga0163163_10416474
428 Ga0157379_10089946
429 Ga0197907_10156581
430 Ga0197907_10601145
431 Ga0206356_10776589
432 Ga0206356_11062009
433 Ga0206354_10791373
434 Ga0206354_11238165
435 Ga0206353_11531586
436 Ga0213871_10225838
437 Ga0207642_10225171
438 Ga0207688_10325668
439 Ga0207680_10047078
440 Ga0207680_10098976
441 Ga0207647_10366442
442 Ga0207643_10711117
443 Ga0207705_11283734
444 Ga0207684_10630413
445 Ga0207671_10345146
446 Ga0207660_10138832
447 Ga0207652_10192003
448 Ga0207652_10329568
449 Ga0207646_10133176
450 Ga0207681_11183745
451 Ga0207694_10576443
452 Ga0207650_10494157
453 Ga0207659_10549413
454 Ga0207700_11078521
455 Ga0207664_10525475
456 Ga0207709_10006701
457 Ga0207709_11096748
458 Ga0207689_10426079
459 Ga0207661_10104688
460 Ga0207661_10176212
461 Ga0207661_11174696
462 Ga0207679_10178605
463 Ga0207679_11344566
464 Ga0207712_10010266
465 Ga0207668_10086120
466 Ga0207658_10005493
467 Ga0207658_10037914
468 Ga0207677_10045730
469 Ga0207703_10077653
470 Ga0207678_10032831
471 Ga0207702_10278343
472 Ga0207648_11127063
473 Ga0207674_10021872
474 Ga0207674_10870335
475 Ga0207683_10402089
476 Ga0268266_10000537
477 Ga0268266_10067258
478 Ga0268265_10009733
479 Ga0268264_10232698
480 Ga0307408_102017876
481 Ga0307409_102973600
482 Ga0307416_100491011
483 Ga0307416_102956138
484 Ga0307414_11370668
485 Ga0307411_11520022
486 Ga0307415_101721582
487 Ga0395899_0140483
488 Ga0395900_0039945
489 Ga0395900_0230301
490 Ga0395900_0237246
491 Ga0395900_0751605
492 Ga0395898_0023611
493 Ga0395898_0031460
494 Ga0395898_0152833
495 Ga0395898_0908699
496 Ga0395905_0167440
497 Ga0395905_1521978
498 Ga0395901_0033206
499 Ga0395901_0033278
500 Ga0395901_0349456
501 Ga0395901_0663238
502 Ga0395901_0666339
503 Ga0395901_0790153
504 Ga0395901_0991744
505 Ga0395901_1060861
506 Ga0436360_1130407
507 Ga0436361_0272461
508 Ga0436363_0607453
509 Ga0436362_0430129
510 Ga0439436_0000186
511 Ga0439438_000427
512 Ga0439447_016750
513 Ga0439466_0006671
514 Ga0439465_0056466
515 Ga0451789_1144981
516 Ga0451797_0767992
517 Ga0451797_1169391
518 Ga0451795_0793840
519 Ga0451802_0325383
520 Ga0451833_1053373
521 Ga0451837_0402276
522 Ga0451855_1206275
523 Ga0451853_2065560
524 Ga0439431_0026964
525 Ga0439432_006135
526 Ga0439452_001817
527 Ga0450919_006705
528 Ga0439446_0009957
529 Ga0450909_009592
530 Ga0439434_0000205
531 Ga0450918_037909
532 Ga0466972_0022014
533 Ga0453683_0324777
534 Ga0466966_0787272
535 Ga0466964_0228956
536 Ga0466970_0054395
537 Ga0466970_0641760
538 Ga0466960_0330429
539 Ga0466959_0156155
540 Ga0451576_0592381
541 Ga0466967_0070215
542 Ga0466967_0522579
543 Ga0466967_0644618
544 Ga0466967_2473909
545 Ga0495630_1367674
546 Ga0495632_0249673
547 Ga0495644_0205912
548 Ga0495656_0251765
549 Ga0495658_0784588
550 Ga0495624_0327193
551 Ga0495581_0476423
552 Ga0496100_0036194
553 Ga0496100_0072971
554 Ga0496101_0010461
555 Ga0496101_0502542
556 Ga0496102_0005118
557 Ga0496102_0067400
558 Ga0496102_0294655
559 Ga0496102_1341909
560 Ga0496103_0003925
561 Ga0496104_0225286
562 Ga0496104_0493683
563 Ga0496105_0012515
564 Ga0496106_1594242
565 Ga0496107_0075030
566 Ga0496108_0042799
567 Ga0496109_0375972
568 Ga0496109_1395761
569 Ga0496109_1819134
570 Ga0496110_1237752
571 Ga0496111_0016200
572 Ga0496111_0223485
573 Ga0496111_0808150
574 Ga0496112_0958388
575 Ga0496113_0108867
576 Ga0496113_0672812
577 Ga0496113_0967787
578 Ga0496114_0021086
579 Ga0496114_0065241
580 Ga0496114_0148453
581 Ga0496114_1388150
582 Ga0496115_0221020
583 Ga0496115_1362039
584 Ga0496118_0291349
585 Ga0496119_0005627
586 Ga0496120_0237004
587 Ga0496121_0027269
588 Ga0496121_0269929
589 Ga0496124_0064489
590 Ga0496126_0193028
591 Ga0501031_0003658
592 Ga0501031_0664026
593 Ga0501032_0005553
594 Ga0501033_0036787
595 Ga0501034_0005262
596 Ga0501034_0274458
597 Ga0501036_0004325
598 Ga0501036_1511133
599 Ga0501037_0000534
600 Ga0501038_0008406
601 Ga0501039_0003939
602 Ga0501040_0248476
603 Ga0501041_0560890
604 Ga0501043_0007661
605 Ga0501046_0007536
606 Ga0501046_0720646
607 Ga0501047_0121028
608 Ga0501047_0189083
609 Ga0501048_0003561
610 Ga0501048_0152530
611 Ga0501067_0437164
612 Ga0501068_0040661
613 Ga0501069_0451302
614 Ga0501070_0011842
615 Ga0501070_1483608
616 Ga0501071_0448911
617 Ga0501074_0459230
618 Ga0501075_0728688
619 Ga0501076_0729337
620 Ga0501079_0552228
621 Ga0501080_0136597
622 Ga0501035_0012643
623 Ga0501044_0015510
624 Ga0501044_0131989
625 Ga0501045_0006886
626 nmdc:mga03n38_181180_c1
627 nmdc:mga0yw44_926097_c1
628 Ga0501084_0301331
629 Ga0501082_0281585
630 Ga0501082_0425498
631 Ga0530510_0293546
632 Ga0530510_0627253
633 2643752237
634 2819428743
635 2848553130
636 2932399503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07311

Dodecin

Dodecin

14

77

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cz8-assembly1.cif.gz_D crystal structure of tt0972 protein from thermus thermophilus 0.7246 20 57
2vyx-assembly1.cif.gz_F crystal structure of the t. thermophilus dodecin w38f mutant 0.7177 20 57
2v19-assembly1.cif.gz_D crystal structure of the t. thermophilus dodecin r45a mutant 0.7106 20 57
2ux9-assembly1.cif.gz_C crystal structure of the t. thermophilus dodecin r65a mutant 0.7098 20 57
6ri3-assembly1.cif.gz_A dodecin from streptomyces davaonensis 0.7073 21 57
ID Description Score Start End Superfamily
af_A0A0R0IXN8_164_279_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8849 26 54 3.30.390.80
af_A0A0P0XAU2_138_242_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8811 26 54 3.30.390.80
af_Q58FW4_193_288_3.30.390.80 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;DNA repair protein Rad52/59/22 0.8513 26 55 3.30.390.80
af_Q107I8_142_385_3.90.1200.10 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.7673 32 46 3.90.1200.10
af_Q9SY66_157_276_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7589 27 48 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A3L6QW34-F1-model_v4 Uncharacterized protein 0.9327 26 53
AF-A0A3B0SN53-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.7284 26 54 GO:0006508
GO:0008233
AF-A0A0K8QPU8-F1-model_v4 Dodecin domain-containing protein 0.7217 20 56
AF-A0A1F3L5I7-F1-model_v4 Uncharacterized protein 0.7213 23 52
AF-A0A4Q3EVX6-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.7206 26 54 GO:0006508
GO:0008233

Map