F404687

General Info

Members Datasets Scaffolds Average Seq Length
318 148 316 315

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10014626|Ga0316593_100146261
Length 368
Sequence MSQTGPQGRKQAFHCVSSIPATVITRKKSVVSYRHPVQNSHLPKQSKRIIGMSTHRVCILGGSGFVGQHLTARLSAQGIACRIVTRHPQRYRHMQVNPGLELVRAELFDLRSLAEQFSGCDAVINLIGILNERGKQQTFRRLHVELVDLIVDACRSAQVPRLLHMSALHANEASGSSHYLRSKGEGENRAHTHGGATMRVTSFRPSIIFGPGDSFFNRFAVLLRYSPPIFPLACAEARFAPVYVEDVTKAFARALDDKTTYGKHYDLCGPKDYSLKELVEYTARVSGLRRLVVALGDLPSRLQASVLGLMPGKPFTLDNYLSLQIDSVCTHNGLTELGIEPQGIETIVPLYLGKAGYRARYDGYRRLA

Samples

Sample ID Description Type Environment
1 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
2 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
58 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
59 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
60 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
61 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
62 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
63 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
68 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
82 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
83 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
84 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
85 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
142 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.97
Metatranscriptomes 4.4
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.81
Nodule 0
Rhizoplane 0.94
Rhizosphere 82.7
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000999 3300002705 Bacteria 13352
2 JGI25156J39149_1003954 3300002705 Bacteria 4682
3 JGI25406J46586_10019987 3300003203 Bacteria 2719
4 Ga0055533_1003558 3300003756 Bacteria 3088
5 Ga0055525_1000043 3300003759 Bacteria 268656
6 Ga0055527_1000028 3300003760 Bacteria 172877
7 Ga0055527_1000068 3300003760 Bacteria 87357
8 Ga0055535_1000081 3300003761 Bacteria 107148
9 Ga0055535_1000090 3300003761 Bacteria 102120
10 Ga0055542_1000053 3300003762 Bacteria 172877
11 Ga0055542_1000113 3300003762 Bacteria 107148
12 Ga0055529_1000104 3300003763 Bacteria 126692
13 Ga0055529_1000281 3300003763 Bacteria 60403
14 Ga0070670_100358536 3300005331 Unclassified 1282
15 Ga0070682_100302384 3300005337 Bacteria 1174
16 Ga0070709_10037595 3300005434 Bacteria 2957
17 Ga0070713_100019652 3300005436 Bacteria 5164
18 Ga0070710_10029520 3300005437 Bacteria 2943
19 Ga0070711_100035364 3300005439 Bacteria 3339
20 Ga0070711_100133782 3300005439 Bacteria 1850
21 Ga0070662_100366592 3300005457 Bacteria 1183
22 Ga0068855_100049769 3300005563 Bacteria 4941
23 Ga0068854_100018989 3300005578 Bacteria 4624
24 Ga0068856_100002737 3300005614 Bacteria 18051
25 Ga0068856_100012047 3300005614 Bacteria 8377
26 Ga0068856_100029405 3300005614 Bacteria 5368
27 Ga0068870_10222656 3300005840 Bacteria 1156
28 Ga0068862_100090709 3300005844 Bacteria 2661
29 Ga0081455_10000495 3300005937 Bacteria 51110
30 Ga0081539_10000011 3300005985 Bacteria 461887
31 Ga0070717_10016600 3300006028 Bacteria 5712
32 Ga0070712_100022132 3300006175 Bacteria 4183
33 Ga0075428_100136451 3300006844 Bacteria 2667
34 Ga0075430_100003759 3300006846 Bacteria 12760
35 Ga0075430_100064571 3300006846 Unclassified 3075
36 Ga0075431_100010233 3300006847 Bacteria 9430
37 Ga0075429_100007311 3300006880 Bacteria 9586
38 Ga0105240_10031276 3300009093 Bacteria 6905
39 Ga0111539_10346441 3300009094 Bacteria 1729
40 Ga0105238_10138869 3300009551 Bacteria 2408
41 Ga0105249_10044234 3300009553 Bacteria 4049
42 Ga0157370_10002180 3300013104 Bacteria 23888
43 Ga0157370_10003277 3300013104 Bacteria 19077
44 Ga0157369_10002481 3300013105 Bacteria 22116
45 Ga0157375_10448461 3300013308 Unclassified 1456
46 Ga0157376_10422964 3300014969 Bacteria 1293
47 Ga0209674_100059 3300025226 Bacteria 282517
48 Ga0209672_100004 3300025228 Bacteria 1467504
49 Ga0209672_100008 3300025228 Bacteria 946876
50 Ga0209563_100036 3300025230 Bacteria 448275
51 Ga0209258_100003 3300025242 Bacteria 1467504
52 Ga0209258_100004 3300025242 Bacteria 1376422
53 Ga0209258_100008 3300025242 Bacteria 1009355
54 Ga0209148_1000016 3300025254 Bacteria 804369
55 Ga0209148_1000200 3300025254 Bacteria 107200
56 Ga0209455_1000004 3300025272 Bacteria 1467504
57 Ga0209455_1000007 3300025272 Bacteria 1157983
58 Ga0209455_1000103 3300025272 Bacteria 201664
59 Ga0207693_10015977 3300025915 Bacteria 6009
60 Ga0207663_10022276 3300025916 Bacteria 3620
61 Ga0207681_10179671 3300025923 Bacteria 1611
62 Ga0207700_10057238 3300025928 Bacteria 2939
63 Ga0207664_10000283 3300025929 Bacteria 38577
64 Ga0207664_10032854 3300025929 Bacteria 3981
65 Ga0207706_10427808 3300025933 Bacteria 1147
66 Ga0207665_10034547 3300025939 Bacteria 3355
67 Ga0207691_10140291 3300025940 Bacteria 2130
68 Ga0207702_10001944 3300026078 Bacteria 20145
69 Ga0207702_10266861 3300026078 Bacteria 1613
70 Ga0207675_100223219 3300026118 Unclassified 1816
71 Ga0207428_10244963 3300027907 Bacteria 1338
72 Ga0268265_10108496 3300028380 Bacteria 2260
73 Ga0268265_10271069 3300028380 Unclassified 1514
74 Ga0265327_10002337 3300031251 Bacteria 20229
75 Ga0265327_10010463 3300031251 Bacteria 6519
76 Ga0307408_100028836 3300031548 Bacteria 3839
77 Ga0316575_10000866 3300031665 Bacteria 9296
78 Ga0316575_10009518 3300031665 Bacteria 3558
79 Ga0316575_10017951 3300031665 Bacteria 2693
80 Ga0316575_10032250 3300031665 Bacteria 2052
81 Ga0316575_10054995 3300031665 Bacteria 1585
82 Ga0316575_10082385 3300031665 Bacteria 1298
83 Ga0316579_10001545 3300031691 Bacteria 8397
84 Ga0316579_10008062 3300031691 Bacteria 4375
85 Ga0316579_10008245 3300031691 Bacteria 4338
86 Ga0316579_10008964 3300031691 Bacteria 4194
87 Ga0316579_10071583 3300031691 Bacteria 1643
88 Ga0316576_10007200 3300031727 Bacteria 6981
89 Ga0316576_10008564 3300031727 Bacteria 6538
90 Ga0316576_10021847 3300031727 Bacteria 4433
91 Ga0316576_10023698 3300031727 Bacteria 4279
92 Ga0316576_10118184 3300031727 Bacteria 1990
93 Ga0316576_10124736 3300031727 Bacteria 1934
94 Ga0316576_10162950 3300031727 Bacteria 1682
95 Ga0316576_10224776 3300031727 Bacteria 1412
96 Ga0316578_10002901 3300031728 Bacteria 7687
97 Ga0316578_10005721 3300031728 Bacteria 6061
98 Ga0316578_10012164 3300031728 Bacteria 4531
99 Ga0316578_10015308 3300031728 Bacteria 4121
100 Ga0316578_10016237 3300031728 Bacteria 4024
101 Ga0316578_10022964 3300031728 Bacteria 3486
102 Ga0316578_10052747 3300031728 Bacteria 2383
103 Ga0316577_10007008 3300031733 Bacteria 5994
104 Ga0316577_10007654 3300031733 Bacteria 5763
105 Ga0316577_10021663 3300031733 Bacteria 3566
106 Ga0316577_10025827 3300031733 Bacteria 3267
107 Ga0316577_10078785 3300031733 Bacteria 1840
108 Ga0316577_10139876 3300031733 Bacteria 1364
109 Ga0307416_100035382 3300032002 Bacteria 3813
110 Ga0307411_10104575 3300032005 Unclassified 2011
111 Ga0316583_10000883 3300032133 Bacteria 9586
112 Ga0316583_10003624 3300032133 Bacteria 5454
113 Ga0316583_10004275 3300032133 Bacteria 5091
114 Ga0316583_10059001 3300032133 Bacteria 1346
115 Ga0316585_10001860 3300032137 Bacteria 5636
116 Ga0316585_10031860 3300032137 Bacteria 1659
117 Ga0316585_10045189 3300032137 Bacteria 1408
118 Ga0316580_10003256 3300032139 Bacteria 4586
119 Ga0316580_10005255 3300032139 Bacteria 3774
120 Ga0316580_10008959 3300032139 Bacteria 3005
121 Ga0316580_10030355 3300032139 Bacteria 1673
122 Ga0316593_10000727 3300032168 Bacteria 6464
123 Ga0316593_10004327 3300032168 Bacteria 3637
124 Ga0316593_10014626 3300032168 Bacteria 2345
125 Ga0316593_10015218 3300032168 Unclassified 2310
126 Ga0316593_10020930 3300032168 Bacteria 2040
127 Ga0316593_10029053 3300032168 Unclassified 1786
128 Ga0316593_10046370 3300032168 Unclassified 1459
129 Ga0316592_1005099 3300033524 Bacteria 2478
130 Ga0316592_1009474 3300033524 Bacteria 1950
131 Ga0316588_1002460 3300033528 Bacteria 3232
132 Ga0316596_1010887 3300033541 Unclassified 2212
133 Ga0316596_1013238 3300033541 Bacteria 2035
134 Ga0316596_1026411 3300033541 Unclassified 1497
135 Ga0316596_1047391 3300033541 Bacteria 1136
136 Ga0316574_0002568 3300035398 Bacteria 9141
137 Ga0316574_0007338 3300035398 Bacteria 6039
138 Ga0316574_0197337 3300035398 Bacteria 1293
139 Ga0316574_0296890 3300035398 Unclassified 1028
140 Ga0316582_0006660 3300036647 Bacteria 6091
141 Ga0316582_0023448 3300036647 Bacteria 3679
142 Ga0316582_0031170 3300036647 Bacteria 3256
143 Ga0316582_0032205 3300036647 Bacteria 3211
144 Ga0316582_0089068 3300036647 Bacteria 2028
145 Ga0316582_0091903 3300036647 Bacteria 1999
146 Ga0316582_0092553 3300036647 Bacteria 1992
147 Ga0316582_0186152 3300036647 Bacteria 1413
148 Ga0316582_0206877 3300036647 Unclassified 1340
149 Ga0316584_0001818 3300036712 Bacteria 13182
150 Ga0316584_0008191 3300036712 Bacteria 7189
151 Ga0316584_0022066 3300036712 Bacteria 4639
152 Ga0316584_0031395 3300036712 Bacteria 3927
153 Ga0316584_0055010 3300036712 Bacteria 2980
154 Ga0316584_0078236 3300036712 Unclassified 2477
155 Ga0316584_0157526 3300036712 Unclassified 1688
156 Ga0316584_0171409 3300036712 Bacteria 1609
157 Ga0316584_0195908 3300036712 Unclassified 1492
158 Ga0316584_0211967 3300036712 Bacteria 1425
159 Ga0316584_0281187 3300036712 Bacteria 1209
160 Ga0395899_0000047 3300037312 Bacteria 233482
161 Ga0395900_0000011 3300037418 Bacteria 421926
162 Ga0395900_0174786 3300037418 Bacteria 2185
163 Ga0395898_0000029 3300037466 Bacteria 370667
164 Ga0395898_0009040 3300037466 Bacteria 10490
165 Ga0395898_0011084 3300037466 Bacteria 9387
166 Ga0395898_0292838 3300037466 Bacteria 1553
167 Ga0316581_0000684 3300037588 Bacteria 6890
168 Ga0316581_0004392 3300037588 Bacteria 3595
169 Ga0316581_0019412 3300037588 Bacteria 1982
170 Ga0316581_0031421 3300037588 Bacteria 1601
171 Ga0400484_35159 3300038725 Bacteria 20918
172 Ga0400490_54791 3300038726 Bacteria 24709
173 Ga0400490_57583 3300038726 Bacteria 17256
174 Ga0400491_00128 3300038727 Unclassified 2563
175 Ga0400491_01502 3300038727 Bacteria 2915
176 Ga0400491_02217 3300038727 Bacteria 5434
177 Ga0400488_58174 3300038741 Unclassified 2191
178 Ga0400483_004890 3300039062 Bacteria 8172
179 Ga0400483_028597 3300039062 Unclassified 3707
180 Ga0400483_033023 3300039062 Bacteria 2402
181 Ga0400483_090881 3300039062 Bacteria 5419
182 Ga0400483_142389 3300039062 Bacteria 2646
183 Ga0400483_145622 3300039062 Unclassified 4750
184 Ga0400483_166558 3300039062 Bacteria 2766
185 Ga0400483_172511 3300039062 Bacteria 6087
186 Ga0400483_215515 3300039062 Bacteria 2814
187 Ga0400483_234219 3300039062 Bacteria 2391
188 Ga0400487_36853 3300039110 Bacteria 10633
189 Ga0436360_0896834 3300039438 Bacteria 7592
190 Ga0436363_1441123 3300039450 Bacteria 7970
191 Ga0436363_1720026 3300039450 Unclassified 1941
192 Ga0450896_010718 3300042133 Bacteria 1287
193 Ga0451577_0067689 3300042876 Bacteria 3185
194 Ga0451577_0224755 3300042876 Bacteria 1697
195 Ga0451577_0251794 3300042876 Bacteria 1599
196 Ga0466969_0016730 3300044656 Bacteria 3834
197 Ga0466969_0016744 3300044656 Bacteria 3833
198 Ga0466969_0065002 3300044656 Bacteria 1765
199 Ga0466972_0048666 3300044658 Bacteria 2048
200 Ga0466975_0174147 3300044661 Bacteria 1479
201 Ga0466966_0051046 3300044684 Bacteria 2629
202 Ga0466966_0090971 3300044684 Bacteria 1894
203 Ga0466963_0198212 3300044694 Bacteria 1404
204 Ga0453684_0011721 3300044712 Bacteria 14617
205 Ga0453684_0505094 3300044712 Bacteria 1338
206 Ga0466971_0056605 3300044719 Bacteria 1769
207 Ga0466959_0000006 3300045049 Bacteria 192678
208 Ga0451576_0021359 3300045051 Bacteria 7035
209 Ga0451576_0032332 3300045051 Bacteria 5573
210 Ga0466958_0021287 3300045836 Bacteria 3788
211 Ga0495643_0158799 3300046522 Unclassified 1114
212 Ga0495687_023142 3300047443 Bacteria 2972
213 Ga0496100_0218973 3300048903 Bacteria 1396
214 Ga0496100_0232945 3300048903 Bacteria 1356
215 Ga0496102_0085544 3300048905 Bacteria 2912
216 Ga0501031_0076648 3300049568 Unclassified 2178
217 Ga0501031_0079862 3300049568 Bacteria 2132
218 Ga0501032_0044169 3300049569 Bacteria 3017
219 Ga0501032_0244727 3300049569 Bacteria 1165
220 Ga0501033_0009136 3300049570 Bacteria 7643
221 Ga0501033_0041792 3300049570 Bacteria 3419
222 Ga0501033_0090466 3300049570 Bacteria 2239
223 Ga0501034_0044884 3300049571 Bacteria 4467
224 Ga0501036_0006347 3300049572 Bacteria 9593
225 Ga0501036_0012711 3300049572 Bacteria 6984
226 Ga0501036_0045833 3300049572 Bacteria 3703
227 Ga0501036_0091997 3300049572 Bacteria 2562
228 Ga0501037_0002167 3300049573 Bacteria 14202
229 Ga0501037_0014370 3300049573 Bacteria 5829
230 Ga0501037_0143222 3300049573 Bacteria 1710
231 Ga0501038_0023149 3300049574 Bacteria 5557
232 Ga0501038_0128284 3300049574 Bacteria 2085
233 Ga0501038_0134520 3300049574 Unclassified 2026
234 Ga0501039_0000531 3300049575 Bacteria 27592
235 Ga0501039_0015538 3300049575 Bacteria 5827
236 Ga0501039_0046747 3300049575 Bacteria 3344
237 Ga0501039_0060790 3300049575 Bacteria 2925
238 Ga0501040_0014219 3300049576 Bacteria 5241
239 Ga0501040_0216084 3300049576 Bacteria 1363
240 Ga0501041_0004344 3300049577 Bacteria 8198
241 Ga0501042_0002275 3300049578 Bacteria 11726
242 Ga0501042_0051829 3300049578 Unclassified 2927
243 Ga0501043_0027520 3300049579 Bacteria 4462
244 Ga0501046_0011654 3300049580 Bacteria 7515
245 Ga0501046_0025141 3300049580 Bacteria 4877
246 Ga0501046_0144108 3300049580 Bacteria 1800
247 Ga0501046_0164122 3300049580 Bacteria 1669
248 Ga0501047_0045367 3300049581 Bacteria 4250
249 Ga0501048_0002542 3300049582 Bacteria 13961
250 Ga0501048_0008818 3300049582 Bacteria 7596
251 Ga0501048_0033707 3300049582 Bacteria 3698
252 Ga0501048_0062571 3300049582 Bacteria 2634
253 Ga0501068_0044830 3300049584 Bacteria 2664
254 Ga0501068_0051379 3300049584 Bacteria 2493
255 Ga0501069_0027594 3300049585 Bacteria 3111
256 Ga0501071_0017606 3300049587 Bacteria 4932
257 Ga0501071_0023213 3300049587 Bacteria 4331
258 Ga0501072_0002276 3300049588 Bacteria 14352
259 Ga0501072_0004758 3300049588 Bacteria 10335
260 Ga0501072_0015732 3300049588 Bacteria 5798
261 Ga0501073_0080197 3300049589 Bacteria 2271
262 Ga0501074_0105326 3300049590 Bacteria 2019
263 Ga0501075_0001714 3300049591 Bacteria 14406
264 Ga0501075_0102634 3300049591 Bacteria 2172
265 Ga0501076_0000644 3300049592 Bacteria 22335
266 Ga0501076_0006258 3300049592 Bacteria 8622
267 Ga0501076_0007355 3300049592 Bacteria 8012
268 Ga0501076_0100256 3300049592 Bacteria 2333
269 Ga0501076_0426806 3300049592 Unclassified 1091
270 Ga0501077_0006848 3300049593 Bacteria 7012
271 Ga0501077_0027981 3300049593 Bacteria 3582
272 Ga0501077_0045136 3300049593 Bacteria 2799
273 Ga0501079_0002351 3300049741 Bacteria 13727
274 Ga0501079_0005596 3300049741 Bacteria 9375
275 Ga0501079_0128617 3300049741 Bacteria 1971
276 Ga0501079_0154277 3300049741 Bacteria 1790
277 Ga0501080_0005800 3300049742 Bacteria 11051
278 Ga0501080_0018719 3300049742 Bacteria 6410
279 Ga0501080_0022443 3300049742 Bacteria 5847
280 Ga0501080_0245247 3300049742 Bacteria 1634
281 Ga0501080_0488927 3300049742 Unclassified 1101
282 Ga0501081_0002983 3300049743 Bacteria 10742
283 Ga0501083_0028060 3300049744 Bacteria 3881
284 Ga0501083_0079844 3300049744 Bacteria 2169
285 Ga0501035_0158548 3300049822 Bacteria 1960
286 Ga0501035_0197253 3300049822 Bacteria 1728
287 Ga0501044_0019194 3300049823 Bacteria 7318
288 Ga0501045_0001495 3300049824 Bacteria 15569
289 Ga0501045_0012641 3300049824 Bacteria 5943
290 Ga0501045_0208202 3300049824 Bacteria 1457
291 nmdc:mga09592_341578_c1 3300050508 Bacteria 1296
292 nmdc:mga09592_6375_c1 3300050508 Bacteria 9611
293 nmdc:mga0qj67_25911_c1 3300050509 Bacteria 4536
294 nmdc:mga0qj67_54824_c1 3300050509 Bacteria 3157
295 nmdc:mga06r32_63622_c1 3300050510 Bacteria 3557
296 nmdc:mga08y16_289830_c1 3300050511 Bacteria 1688
297 nmdc:mga0n895_489470_c1 3300050512 Bacteria 1240
298 nmdc:mga08x19_106900_c1 3300050514 Bacteria 1862
299 Ga0500641_0035456 3300053096 Unclassified 1991
300 Ga0500617_020407 3300053124 Bacteria 2906
301 Ga0500588_0013784 3300053146 Bacteria 2034
302 Ga0500616_0000121 3300053153 Bacteria 141754
303 Ga0500616_0014119 3300053153 Bacteria 4602
304 Ga0500622_0000011 3300053156 Bacteria 386096
305 Ga0501084_0008658 3300054114 Bacteria 8409
306 Ga0501084_0053517 3300054114 Bacteria 3376
307 Ga0501084_0113718 3300054114 Bacteria 2275
308 Ga0501084_0223237 3300054114 Bacteria 1590
309 Ga0501084_0260919 3300054114 Bacteria 1463
310 Ga0501082_0003755 3300060353 Bacteria 13271
311 Ga0501082_0024123 3300060353 Bacteria 5247
312 Ga0501082_0040662 3300060353 Bacteria 4009
313 Ga0501082_0127066 3300060353 Bacteria 2211
314 Ga0530510_0001303 3300061734 Bacteria 16669
315 Ga0530510_0007591 3300061734 Bacteria 7555
316 Ga0530510_0146401 3300061734 Bacteria 1742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0296890 Ga0316574_0296890_184_1008 264
2 3300039062 Ga0400483_090881 Ga0400483_090881_3370_4203 267
3 3300039062 Ga0400483_215515 Ga0400483_215515_539_1372 267
4 3300039062 Ga0400483_172511 Ga0400483_172511_4555_5382 268
5 3300049590 Ga0501074_0105326 Ga0501074_0105326_216_1169 277
6 3300038741 Ga0400488_58174 Ga0400488_58174_938_1798 279
7 3300005840 Ga0068870_10222656 Ga0068870_102226562 283
8 3300025923 Ga0207681_10179671 Ga0207681_101796712 283
9 3300025940 Ga0207691_10140291 Ga0207691_101402912 283
10 3300013308 Ga0157375_10448461 Ga0157375_104484612 284
11 3300044712 Ga0453684_0505094 Ga0453684_0505094_116_1039 287
12 3300039438 Ga0436360_0896834 Ga0436360_0896834_4465_5391 289
13 3300042876 Ga0451577_0251794 Ga0451577_0251794_542_1453 291
14 3300031727 Ga0316576_10007200 Ga0316576_100072003 293
15 3300031728 Ga0316578_10002901 Ga0316578_100029012 293
16 3300031728 Ga0316578_10022964 Ga0316578_100229642 293
17 3300036712 Ga0316584_0211967 Ga0316584_0211967_482_1387 293
18 iso_pu_bacteria 2739367655 2739613598 293
19 iso_pu_bacteria 2881927736 2881927943 293
20 3300005439 Ga0070711_100035364 Ga0070711_1000353642 294
21 3300025916 Ga0207663_10022276 Ga0207663_100222762 294
22 3300025928 Ga0207700_10057238 Ga0207700_100572382 294
23 3300031665 Ga0316575_10017951 Ga0316575_100179512 294
24 3300031727 Ga0316576_10224776 Ga0316576_102247762 294
25 3300032133 Ga0316583_10059001 Ga0316583_100590012 294
26 3300032168 Ga0316593_10000727 Ga0316593_100007276 294
27 3300036712 Ga0316584_0171409 Ga0316584_0171409_183_1088 294
28 3300031548 Ga0307408_100028836 Ga0307408_1000288363 295
29 3300031727 Ga0316576_10118184 Ga0316576_101181842 295
30 3300032168 Ga0316593_10004327 Ga0316593_100043274 295
31 3300032168 Ga0316593_10029053 Ga0316593_100290532 295
32 3300036712 Ga0316584_0078236 Ga0316584_0078236_33_950 295
33 3300038727 Ga0400491_01502 Ga0400491_01502_979_1887 295
34 3300038727 Ga0400491_02217 Ga0400491_02217_2384_3292 295
35 3300045051 Ga0451576_0021359 Ga0451576_0021359_1542_2465 295
36 3300049592 Ga0501076_0426806 Ga0501076_0426806_30_941 295
37 3300049742 Ga0501080_0488927 Ga0501080_0488927_153_1064 295
38 3300031691 Ga0316579_10008245 Ga0316579_100082454 296
39 3300031728 Ga0316578_10005721 Ga0316578_100057215 296
40 3300031733 Ga0316577_10021663 Ga0316577_100216631 296
41 3300032137 Ga0316585_10045189 Ga0316585_100451892 296
42 3300032139 Ga0316580_10008959 Ga0316580_100089591 296
43 3300033541 Ga0316596_1013238 Ga0316596_10132382 296
44 3300035398 Ga0316574_0197337 Ga0316574_0197337_330_1241 296
45 3300036647 Ga0316582_0031170 Ga0316582_0031170_2232_3143 296
46 3300005331 Ga0070670_100358536 Ga0070670_1003585361 297
47 3300026118 Ga0207675_100223219 Ga0207675_1002232192 297
48 3300031665 Ga0316575_10054995 Ga0316575_100549952 297
49 3300031691 Ga0316579_10008062 Ga0316579_100080623 297
50 3300031727 Ga0316576_10021847 Ga0316576_100218474 297
51 3300031727 Ga0316576_10124736 Ga0316576_101247362 297
52 3300031728 Ga0316578_10016237 Ga0316578_100162372 297
53 3300031728 Ga0316578_10052747 Ga0316578_100527472 297
54 3300031733 Ga0316577_10007008 Ga0316577_100070082 297
55 3300031733 Ga0316577_10007654 Ga0316577_100076542 297
56 3300032139 Ga0316580_10003256 Ga0316580_100032562 297
57 3300032168 Ga0316593_10020930 Ga0316593_100209302 297
58 3300033524 Ga0316592_1005099 Ga0316592_10050991 297
59 3300033524 Ga0316592_1009474 Ga0316592_10094742 297
60 3300033528 Ga0316588_1002460 Ga0316588_10024603 297
61 3300033541 Ga0316596_1026411 Ga0316596_10264111 297
62 3300035398 Ga0316574_0007338 Ga0316574_0007338_2331_3245 297
63 3300036647 Ga0316582_0032205 Ga0316582_0032205_1560_2474 297
64 3300036647 Ga0316582_0092553 Ga0316582_0092553_14_928 297
65 3300036712 Ga0316584_0001818 Ga0316584_0001818_10099_11013 297
66 3300006175 Ga0070712_100022132 Ga0070712_1000221322 298
67 3300025915 Ga0207693_10015977 Ga0207693_100159772 298
68 3300025939 Ga0207665_10034547 Ga0207665_100345472 298
69 3300048903 Ga0496100_0232945 Ga0496100_0232945_261_1181 298
70 3300050514 nmdc:mga08x19_106900_c1 nmdc:mga08x19_106900_c1_822_1742 298
71 3300039450 Ga0436363_1720026 Ga0436363_1720026_565_1530 299
72 3300006844 Ga0075428_100136451 Ga0075428_1001364512 301
73 3300006846 Ga0075430_100064571 Ga0075430_1000645712 301
74 3300042133 Ga0450896_010718 Ga0450896_010718_145_1074 301
75 3300050508 nmdc:mga09592_341578_c1 nmdc:mga09592_341578_c1_154_1083 301
76 3300050509 nmdc:mga0qj67_25911_c1 nmdc:mga0qj67_25911_c1_3206_4135 301
77 3300053153 Ga0500616_0014119 Ga0500616_0014119_2148_3098 301
78 3300028380 Ga0268265_10271069 Ga0268265_102710692 302
79 3300044656 Ga0466969_0065002 Ga0466969_0065002_240_1184 303
80 3300049588 Ga0501072_0015732 Ga0501072_0015732_4790_5731 305
81 3300005434 Ga0070709_10037595 Ga0070709_100375952 306
82 3300005436 Ga0070713_100019652 Ga0070713_1000196524 306
83 3300005614 Ga0068856_100029405 Ga0068856_1000294052 306
84 3300006028 Ga0070717_10016600 Ga0070717_100166003 306
85 3300025929 Ga0207664_10032854 Ga0207664_100328543 306
86 3300026078 Ga0207702_10266861 Ga0207702_102668612 306
87 3300031691 Ga0316579_10008964 Ga0316579_100089642 306
88 3300032137 Ga0316585_10031860 Ga0316585_100318602 306
89 3300036647 Ga0316582_0023448 Ga0316582_0023448_1646_2587 306
90 3300036712 Ga0316584_0008191 Ga0316584_0008191_3696_4637 306
91 3300037588 Ga0316581_0000684 Ga0316581_0000684_4612_5556 306
92 3300039450 Ga0436363_1441123 Ga0436363_1441123_2449_3393 306
93 3300048903 Ga0496100_0218973 Ga0496100_0218973_410_1354 306
94 3300048905 Ga0496102_0085544 Ga0496102_0085544_1463_2407 306
95 3300049742 Ga0501080_0245247 Ga0501080_0245247_333_1286 307
96 3300031251 Ga0265327_10010463 Ga0265327_100104634 308
97 3300031665 Ga0316575_10032250 Ga0316575_100322502 308
98 3300039062 Ga0400483_033023 Ga0400483_033023_1183_2127 308
99 3300053096 Ga0500641_0035456 Ga0500641_0035456_424_1368 308
100 3300053124 Ga0500617_020407 Ga0500617_020407_1036_1980 308
101 3300053146 Ga0500588_0013784 Ga0500588_0013784_1035_1979 308
102 3300037418 Ga0395900_0174786 Ga0395900_0174786_29_973 309
103 3300037466 Ga0395898_0292838 Ga0395898_0292838_340_1284 309
104 3300038726 Ga0400490_54791 Ga0400490_54791_6579_7529 309
105 3300039062 Ga0400483_004890 Ga0400483_004890_977_1936 309
106 3300039062 Ga0400483_028597 Ga0400483_028597_1637_2596 309
107 3300039062 Ga0400483_142389 Ga0400483_142389_1566_2525 309
108 3300039062 Ga0400483_145622 Ga0400483_145622_601_1560 309
109 3300039062 Ga0400483_166558 Ga0400483_166558_355_1314 309
110 3300005439 Ga0070711_100133782 Ga0070711_1001337821 310
111 3300005614 Ga0068856_100012047 Ga0068856_1000120474 310
112 3300005937 Ga0081455_10000495 Ga0081455_100004956 310
113 3300025929 Ga0207664_10000283 Ga0207664_100002834 310
114 3300032168 Ga0316593_10014626 Ga0316593_100146261 310
115 3300032168 Ga0316593_10015218 Ga0316593_100152183 310
116 3300033541 Ga0316596_1010887 Ga0316596_10108871 310
117 3300033541 Ga0316596_1047391 Ga0316596_10473911 310
118 3300036712 Ga0316584_0281187 Ga0316584_0281187_150_1103 310
119 3300038727 Ga0400491_00128 Ga0400491_00128_1009_1992 310
120 3300039062 Ga0400483_234219 Ga0400483_234219_385_1386 310
121 3300049824 Ga0501045_0208202 Ga0501045_0208202_302_1240 310
122 3300050512 nmdc:mga0n895_489470_c1 nmdc:mga0n895_489470_c1_133_1080 310
123 3300053156 Ga0500622_0000011 Ga0500622_0000011_219715_220662 310
124 3300005437 Ga0070710_10029520 Ga0070710_100295202 311
125 3300005457 Ga0070662_100366592 Ga0070662_1003665922 311
126 3300005563 Ga0068855_100049769 Ga0068855_1000497692 311
127 3300009093 Ga0105240_10031276 Ga0105240_100312766 311
128 3300009094 Ga0111539_10346441 Ga0111539_103464411 311
129 3300013104 Ga0157370_10003277 Ga0157370_1000327712 311
130 3300013105 Ga0157369_10002481 Ga0157369_1000248114 311
131 3300014969 Ga0157376_10422964 Ga0157376_104229642 311
132 3300025933 Ga0207706_10427808 Ga0207706_104278082 311
133 3300027907 Ga0207428_10244963 Ga0207428_102449632 311
134 3300031251 Ga0265327_10002337 Ga0265327_1000233714 311
135 3300031665 Ga0316575_10009518 Ga0316575_100095182 311
136 3300032005 Ga0307411_10104575 Ga0307411_101045752 311
137 3300037466 Ga0395898_0009040 Ga0395898_0009040_857_1849 311
138 3300037466 Ga0395898_0011084 Ga0395898_0011084_1270_2223 311
139 3300038725 Ga0400484_35159 Ga0400484_35159_4520_5476 311
140 3300038726 Ga0400490_57583 Ga0400490_57583_9279_10235 311
141 3300042876 Ga0451577_0224755 Ga0451577_0224755_628_1587 311
142 3300044694 Ga0466963_0198212 Ga0466963_0198212_51_1001 311
143 3300044712 Ga0453684_0011721 Ga0453684_0011721_10633_11592 311
144 3300049568 Ga0501031_0079862 Ga0501031_0079862_148_1110 311
145 3300049569 Ga0501032_0244727 Ga0501032_0244727_100_1074 311
146 3300049570 Ga0501033_0009136 Ga0501033_0009136_2504_3478 311
147 3300049570 Ga0501033_0090466 Ga0501033_0090466_387_1349 311
148 3300049571 Ga0501034_0044884 Ga0501034_0044884_1716_2690 311
149 3300049572 Ga0501036_0012711 Ga0501036_0012711_1649_2611 311
150 3300049572 Ga0501036_0091997 Ga0501036_0091997_213_1187 311
151 3300049573 Ga0501037_0014370 Ga0501037_0014370_384_1358 311
152 3300049574 Ga0501038_0128284 Ga0501038_0128284_1000_1974 311
153 3300049575 Ga0501039_0046747 Ga0501039_0046747_858_1820 311
154 3300049576 Ga0501040_0014219 Ga0501040_0014219_1409_2371 311
155 3300049577 Ga0501041_0004344 Ga0501041_0004344_1649_2611 311
156 3300049579 Ga0501043_0027520 Ga0501043_0027520_1545_2519 311
157 3300049580 Ga0501046_0164122 Ga0501046_0164122_462_1424 311
158 3300049581 Ga0501047_0045367 Ga0501047_0045367_1750_2724 311
159 3300049582 Ga0501048_0002542 Ga0501048_0002542_10099_11061 311
160 3300049582 Ga0501048_0062571 Ga0501048_0062571_1226_2200 311
161 3300049584 Ga0501068_0044830 Ga0501068_0044830_1581_2555 311
162 3300049587 Ga0501071_0017606 Ga0501071_0017606_1645_2607 311
163 3300049588 Ga0501072_0002276 Ga0501072_0002276_186_1148 311
164 3300049589 Ga0501073_0080197 Ga0501073_0080197_113_1087 311
165 3300049591 Ga0501075_0001714 Ga0501075_0001714_7552_8514 311
166 3300049592 Ga0501076_0000644 Ga0501076_0000644_5824_6786 311
167 3300049592 Ga0501076_0006258 Ga0501076_0006258_5235_6197 311
168 3300049593 Ga0501077_0045136 Ga0501077_0045136_1440_2402 311
169 3300049741 Ga0501079_0005596 Ga0501079_0005596_507_1469 311
170 3300049741 Ga0501079_0154277 Ga0501079_0154277_313_1287 311
171 3300049742 Ga0501080_0018719 Ga0501080_0018719_1641_2603 311
172 3300049742 Ga0501080_0022443 Ga0501080_0022443_3750_4724 311
173 3300049744 Ga0501083_0079844 Ga0501083_0079844_428_1402 311
174 3300049822 Ga0501035_0197253 Ga0501035_0197253_474_1448 311
175 3300049823 Ga0501044_0019194 Ga0501044_0019194_4987_5961 311
176 3300050511 nmdc:mga08y16_289830_c1 nmdc:mga08y16_289830_c1_652_1605 311
177 3300053153 Ga0500616_0000121 Ga0500616_0000121_8763_9716 311
178 3300054114 Ga0501084_0008658 Ga0501084_0008658_5664_6626 311
179 3300054114 Ga0501084_0113718 Ga0501084_0113718_1191_2153 311
180 3300054114 Ga0501084_0260919 Ga0501084_0260919_71_1045 311
181 3300060353 Ga0501082_0024123 Ga0501082_0024123_243_1205 311
182 3300060353 Ga0501082_0127066 Ga0501082_0127066_896_1870 311
183 3300061734 Ga0530510_0001303 Ga0530510_0001303_9529_10491 311
184 3300003203 JGI25406J46586_10019987 JGI25406J46586_100199872 312
185 3300005337 Ga0070682_100302384 Ga0070682_1003023842 312
186 3300005578 Ga0068854_100018989 Ga0068854_1000189892 312
187 3300005844 Ga0068862_100090709 Ga0068862_1000907093 312
188 3300005985 Ga0081539_10000011 Ga0081539_1000001142 312
189 3300009551 Ga0105238_10138869 Ga0105238_101388692 312
190 3300013104 Ga0157370_10002180 Ga0157370_100021809 312
191 3300028380 Ga0268265_10108496 Ga0268265_101084962 312
192 3300031691 Ga0316579_10001545 Ga0316579_100015454 312
193 3300031728 Ga0316578_10015308 Ga0316578_100153083 312
194 3300032133 Ga0316583_10000883 Ga0316583_100008839 312
195 3300036647 Ga0316582_0006660 Ga0316582_0006660_1839_2819 312
196 3300036712 Ga0316584_0022066 Ga0316584_0022066_1569_2549 312
197 3300036712 Ga0316584_0195908 Ga0316584_0195908_256_1203 312
198 3300037588 Ga0316581_0004392 Ga0316581_0004392_1993_2973 312
199 3300039110 Ga0400487_36853 Ga0400487_36853_3337_4308 312
200 3300044658 Ga0466972_0048666 Ga0466972_0048666_707_1663 312
201 3300006846 Ga0075430_100003759 Ga0075430_1000037598 313
202 3300006847 Ga0075431_100010233 Ga0075431_1000102333 313
203 3300006880 Ga0075429_100007311 Ga0075429_1000073117 313
204 3300009553 Ga0105249_10044234 Ga0105249_100442342 313
205 3300031665 Ga0316575_10082385 Ga0316575_100823851 313
206 3300031727 Ga0316576_10008564 Ga0316576_100085643 313
207 3300031727 Ga0316576_10023698 Ga0316576_100236983 313
208 3300031733 Ga0316577_10025827 Ga0316577_100258272 313
209 3300032002 Ga0307416_100035382 Ga0307416_1000353822 313
210 3300032133 Ga0316583_10004275 Ga0316583_100042753 313
211 3300032139 Ga0316580_10030355 Ga0316580_100303552 313
212 3300036647 Ga0316582_0089068 Ga0316582_0089068_398_1363 313
213 3300036647 Ga0316582_0186152 Ga0316582_0186152_338_1303 313
214 3300036712 Ga0316584_0031395 Ga0316584_0031395_2447_3412 313
215 3300037588 Ga0316581_0019412 Ga0316581_0019412_870_1835 313
216 3300037588 Ga0316581_0031421 Ga0316581_0031421_38_1003 313
217 3300045051 Ga0451576_0032332 Ga0451576_0032332_2637_3602 313
218 3300049568 Ga0501031_0076648 Ga0501031_0076648_1145_2110 313
219 3300049569 Ga0501032_0044169 Ga0501032_0044169_1803_2768 313
220 3300049570 Ga0501033_0041792 Ga0501033_0041792_2171_3136 313
221 3300049572 Ga0501036_0006347 Ga0501036_0006347_5535_6500 313
222 3300049572 Ga0501036_0045833 Ga0501036_0045833_2409_3374 313
223 3300049573 Ga0501037_0143222 Ga0501037_0143222_103_1068 313
224 3300049574 Ga0501038_0023149 Ga0501038_0023149_2028_2993 313
225 3300049574 Ga0501038_0134520 Ga0501038_0134520_808_1773 313
226 3300049575 Ga0501039_0000531 Ga0501039_0000531_7054_8019 313
227 3300049575 Ga0501039_0060790 Ga0501039_0060790_1639_2604 313
228 3300049576 Ga0501040_0216084 Ga0501040_0216084_307_1272 313
229 3300049578 Ga0501042_0002275 Ga0501042_0002275_5506_6471 313
230 3300049578 Ga0501042_0051829 Ga0501042_0051829_1334_2299 313
231 3300049580 Ga0501046_0011654 Ga0501046_0011654_4735_5700 313
232 3300049580 Ga0501046_0144108 Ga0501046_0144108_443_1408 313
233 3300049582 Ga0501048_0008818 Ga0501048_0008818_3265_4230 313
234 3300049582 Ga0501048_0033707 Ga0501048_0033707_2143_3108 313
235 3300049584 Ga0501068_0051379 Ga0501068_0051379_917_1882 313
236 3300049587 Ga0501071_0023213 Ga0501071_0023213_2426_3391 313
237 3300049588 Ga0501072_0004758 Ga0501072_0004758_4180_5145 313
238 3300049592 Ga0501076_0007355 Ga0501076_0007355_1502_2467 313
239 3300049592 Ga0501076_0100256 Ga0501076_0100256_1107_2072 313
240 3300049593 Ga0501077_0006848 Ga0501077_0006848_5563_6528 313
241 3300049593 Ga0501077_0027981 Ga0501077_0027981_104_1069 313
242 3300049741 Ga0501079_0002351 Ga0501079_0002351_5951_6916 313
243 3300049741 Ga0501079_0128617 Ga0501079_0128617_749_1714 313
244 3300049742 Ga0501080_0005800 Ga0501080_0005800_827_1792 313
245 3300049743 Ga0501081_0002983 Ga0501081_0002983_9346_10311 313
246 3300049744 Ga0501083_0028060 Ga0501083_0028060_2318_3283 313
247 3300049822 Ga0501035_0158548 Ga0501035_0158548_615_1580 313
248 3300049824 Ga0501045_0001495 Ga0501045_0001495_3253_4218 313
249 3300049824 Ga0501045_0012641 Ga0501045_0012641_2610_3575 313
250 3300050508 nmdc:mga09592_6375_c1 nmdc:mga09592_6375_c1_294_1241 313
251 3300050509 nmdc:mga0qj67_54824_c1 nmdc:mga0qj67_54824_c1_1325_2272 313
252 3300050510 nmdc:mga06r32_63622_c1 nmdc:mga06r32_63622_c1_981_1928 313
253 3300054114 Ga0501084_0053517 Ga0501084_0053517_48_1013 313
254 3300054114 Ga0501084_0223237 Ga0501084_0223237_235_1200 313
255 3300060353 Ga0501082_0003755 Ga0501082_0003755_6660_7625 313
256 3300060353 Ga0501082_0040662 Ga0501082_0040662_664_1629 313
257 3300061734 Ga0530510_0007591 Ga0530510_0007591_3343_4308 313
258 3300061734 Ga0530510_0146401 Ga0530510_0146401_681_1646 313
259 3300031665 Ga0316575_10000866 Ga0316575_100008665 314
260 3300031691 Ga0316579_10071583 Ga0316579_100715831 314
261 3300031727 Ga0316576_10162950 Ga0316576_101629502 314
262 3300031728 Ga0316578_10012164 Ga0316578_100121644 314
263 3300031733 Ga0316577_10078785 Ga0316577_100787851 314
264 3300031733 Ga0316577_10139876 Ga0316577_101398762 314
265 3300032133 Ga0316583_10003624 Ga0316583_100036243 314
266 3300032137 Ga0316585_10001860 Ga0316585_100018602 314
267 3300032139 Ga0316580_10005255 Ga0316580_100052553 314
268 3300032168 Ga0316593_10046370 Ga0316593_100463702 314
269 3300035398 Ga0316574_0002568 Ga0316574_0002568_6149_7105 314
270 3300036647 Ga0316582_0091903 Ga0316582_0091903_476_1432 314
271 3300036647 Ga0316582_0206877 Ga0316582_0206877_48_1019 314
272 3300036712 Ga0316584_0055010 Ga0316584_0055010_306_1277 314
273 3300036712 Ga0316584_0157526 Ga0316584_0157526_387_1358 314
274 3300042876 Ga0451577_0067689 Ga0451577_0067689_1397_2377 314
275 3300046522 Ga0495643_0158799 Ga0495643_0158799_127_1101 314
276 3300047443 Ga0495687_023142 Ga0495687_023142_1163_2158 314
277 3300049573 Ga0501037_0002167 Ga0501037_0002167_2740_3708 314
278 3300049575 Ga0501039_0015538 Ga0501039_0015538_4589_5557 314
279 3300049580 Ga0501046_0025141 Ga0501046_0025141_1800_2768 314
280 3300049585 Ga0501069_0027594 Ga0501069_0027594_758_1726 314
281 3300049591 Ga0501075_0102634 Ga0501075_0102634_951_1919 314
282 3300002705 JGI25156J39149_1000999 JGI25156J39149_10009996 316
283 3300002705 JGI25156J39149_1003954 JGI25156J39149_10039544 316
284 3300003756 Ga0055533_1003558 Ga0055533_10035582 316
285 3300003759 Ga0055525_1000043 Ga0055525_100004394 316
286 3300003760 Ga0055527_1000028 Ga0055527_1000028140 316
287 3300003760 Ga0055527_1000068 Ga0055527_100006825 316
288 3300003761 Ga0055535_1000081 Ga0055535_100008125 316
289 3300003761 Ga0055535_1000090 Ga0055535_100009025 316
290 3300003762 Ga0055542_1000053 Ga0055542_1000053140 316
291 3300003762 Ga0055542_1000113 Ga0055542_100011370 316
292 3300003763 Ga0055529_1000104 Ga0055529_100010492 316
293 3300003763 Ga0055529_1000281 Ga0055529_100028125 316
294 3300005614 Ga0068856_100002737 Ga0068856_10000273717 316
295 3300025226 Ga0209674_100059 Ga0209674_100059135 316
296 3300025228 Ga0209672_100004 Ga0209672_100004673 316
297 3300025228 Ga0209672_100008 Ga0209672_100008577 316
298 3300025230 Ga0209563_100036 Ga0209563_100036222 316
299 3300025242 Ga0209258_100003 Ga0209258_100003673 316
300 3300025242 Ga0209258_100004 Ga0209258_100004613 316
301 3300025242 Ga0209258_100008 Ga0209258_100008238 316
302 3300025254 Ga0209148_1000016 Ga0209148_1000016673 316
303 3300025254 Ga0209148_1000200 Ga0209148_100020070 316
304 3300025272 Ga0209455_1000004 Ga0209455_1000004673 316
305 3300025272 Ga0209455_1000007 Ga0209455_1000007358 316
306 3300025272 Ga0209455_1000103 Ga0209455_1000103164 316
307 3300026078 Ga0207702_10001944 Ga0207702_1000194414 316
308 3300037312 Ga0395899_0000047 Ga0395899_0000047_232273_233223 316
309 3300037418 Ga0395900_0000011 Ga0395900_0000011_335038_335988 316
310 3300037466 Ga0395898_0000029 Ga0395898_0000029_91546_92496 316
311 3300044656 Ga0466969_0016730 Ga0466969_0016730_1049_1999 316
312 3300044656 Ga0466969_0016744 Ga0466969_0016744_1048_1998 316
313 3300044661 Ga0466975_0174147 Ga0466975_0174147_335_1285 316
314 3300044684 Ga0466966_0051046 Ga0466966_0051046_525_1475 316
315 3300044684 Ga0466966_0090971 Ga0466966_0090971_427_1377 316
316 3300044719 Ga0466971_0056605 Ga0466971_0056605_283_1233 316
317 3300045049 Ga0466959_0000006 Ga0466959_0000006_70152_71102 316
318 3300045836 Ga0466958_0021287 Ga0466958_0021287_1962_2912 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

57

268

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

58

185

0.86

PF05368

NmrA

NmrA-like family

57

294

0.84

PF13460

NAD_binding_10

NAD(P)H-binding

61

196

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

171

273

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w35-assembly1.cif.gz_J deactive state ci from dq-nadh dataset, subclass 3 0.9344 4 291
8e73-assembly1.cif.gz_A9 vigna radiata supercomplex i+iii2 (full bridge) 0.934 4 289
7ard-assembly1.cif.gz_P cryo-em structure of polytomella complex-i (complete composition) 0.9203 4 289
7a24-assembly1.cif.gz_T assembly intermediate of the plant mitochondrial complex i 0.9191 2 290
5xtb-assembly1.cif.gz_J cryo-em structure of human respiratory complex i matrix arm 0.9174 4 290
ID Description Score Start End Superfamily
af_Q9SK66_71_329_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9441 7 248 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9412 4 167 3.40.50.720
af_Q559Z0_43_331_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9404 8 281 3.40.50.720
af_Q9DC69_47_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9365 4 204 3.40.50.720
af_Q9N3H3_46_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.932 4 206 3.40.50.720
ID Description Score Start End GO Terms
AF-H8KZJ8-F1-model_v4 Putative nucleoside-diphosphate sugar epimerase 0.986 1 287 GO:0044877
GO:1901006
AF-A0A0J7JZJ0-F1-model_v4 2 3-cyclic nucleotide 2-phosphodiesterase 0.9842 111 269 GO:0001680
GO:0003723
GO:0005524
GO:0016779
GO:0046872
AF-A0A328SYB6-F1-model_v4 Epimerase 0.9803 1 303 GO:0044877
GO:1901006
AF-A0A0U1PC24-F1-model_v4 Epimerase 0.9716 1 308 GO:0044877
GO:1901006
AF-A0A0S8FM08-F1-model_v4 NAD(P)-binding domain-containing protein 0.9696 2 290 GO:0044877
GO:1901006

Feature Viewer

pLDDT pTM Quality
88.51 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map