F404669

General Info

Members Datasets Scaffolds Average Seq Length
318 192 636 80

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10038027|Ga0307511_100380273
Length 74
Sequence MSDEEMKAELEGVSMKVSEKGGVSIYGLGRFPVTLYKEQWEKLLDMADDIRAFINENTGKLKIKGDEKTEAGPE

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
135 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 95.6
Stem 0
Stem Tuber 0
Unclassified 31.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10038027 3300030521 Bacteria 4143
2 Ga0058859_11715825 3300004798 Unclassified 501
3 Ga0058860_12021696 3300004801 Bacteria 812
4 Ga0065712_10161845 3300005290 Bacteria 1297
5 Ga0065707_10370958 3300005295 Unclassified 890
6 Ga0065707_10577352 3300005295 Unclassified 704
7 Ga0065707_11035498 3300005295 Bacteria 530
8 Ga0070690_100410324 3300005330 Bacteria 997
9 Ga0070670_100328861 3300005331 Bacteria 1340
10 Ga0068869_100258156 3300005334 Bacteria 1394
11 Ga0070666_10280552 3300005335 Bacteria 1184
12 Ga0070666_10369859 3300005335 Bacteria 1028
13 Ga0070680_100524896 3300005336 Bacteria 1014
14 Ga0068868_100555124 3300005338 Bacteria 1013
15 Ga0068868_102408611 3300005338 Unclassified 503
16 Ga0070660_100157313 3300005339 Bacteria 1830
17 Ga0070689_101241362 3300005340 Bacteria 670
18 Ga0070691_10409035 3300005341 Unclassified 766
19 Ga0070687_100559822 3300005343 Bacteria 779
20 Ga0070692_10039074 3300005345 Bacteria 2422
21 Ga0070669_101341742 3300005353 Bacteria 620
22 Ga0070675_100036495 3300005354 Bacteria 4000
23 Ga0070671_101380957 3300005355 Bacteria 622
24 Ga0070674_100315894 3300005356 Unclassified 1251
25 Ga0070674_100835299 3300005356 Bacteria 798
26 Ga0070674_101633594 3300005356 Unclassified 582
27 Ga0070673_100147345 3300005364 Bacteria 1991
28 Ga0070673_100617273 3300005364 Unclassified 990
29 Ga0070701_10547972 3300005438 Bacteria 758
30 Ga0070705_100484022 3300005440 Bacteria 936
31 Ga0070708_100031572 3300005445 Bacteria 4586
32 Ga0070708_100963026 3300005445 Bacteria 800
33 Ga0070708_102084934 3300005445 Bacteria 524
34 Ga0070663_100156643 3300005455 Bacteria 1750
35 Ga0070662_100142049 3300005457 Bacteria 1861
36 Ga0070681_10003050 3300005458 Bacteria 15528
37 Ga0070681_10007358 3300005458 Bacteria 10759
38 Ga0068867_100317027 3300005459 Unclassified 1290
39 Ga0068867_101033603 3300005459 Bacteria 747
40 Ga0070685_10307025 3300005466 Bacteria 1071
41 Ga0070706_101973782 3300005467 Unclassified 529
42 Ga0070698_100828356 3300005471 Unclassified 870
43 Ga0070699_100489255 3300005518 Bacteria 1117
44 Ga0070679_100108495 3300005530 Unclassified 2762
45 Ga0070679_100260220 3300005530 Bacteria 1690
46 Ga0070679_100601828 3300005530 Bacteria 1042
47 Ga0070697_100827392 3300005536 Bacteria 820
48 Ga0070697_101806273 3300005536 Bacteria 547
49 Ga0068853_100082239 3300005539 Bacteria 2820
50 Ga0070672_101474903 3300005543 Bacteria 609
51 Ga0070686_100152252 3300005544 Unclassified 1621
52 Ga0070686_100574776 3300005544 Bacteria 885
53 Ga0070695_101208256 3300005545 Bacteria 622
54 Ga0070695_101852265 3300005545 Bacteria 507
55 Ga0070696_100644371 3300005546 Bacteria 858
56 Ga0070693_100001424 3300005547 Bacteria 10797
57 Ga0070665_100060172 3300005548 Unclassified 3807
58 Ga0070704_100026534 3300005549 Bacteria 3829
59 Ga0070704_100969240 3300005549 Unclassified 768
60 Ga0068855_100026273 3300005563 Bacteria 6965
61 Ga0068855_100761410 3300005563 Unclassified 1032
62 Ga0068855_101192216 3300005563 Unclassified 792
63 Ga0070664_100603582 3300005564 Unclassified 1018
64 Ga0068854_102248912 3300005578 Bacteria 505
65 Ga0068859_100146321 3300005617 Bacteria 2438
66 Ga0068859_102043109 3300005617 Bacteria 633
67 Ga0068866_10267441 3300005718 Unclassified 1053
68 Ga0068861_102032616 3300005719 Unclassified 574
69 Ga0068861_102319368 3300005719 Unclassified 539
70 Ga0068870_10989367 3300005840 Bacteria 599
71 Ga0068863_100536613 3300005841 Bacteria 1154
72 Ga0068863_102297139 3300005841 Unclassified 549
73 Ga0068858_100487550 3300005842 Unclassified 1190
74 Ga0068860_100531018 3300005843 Bacteria 1177
75 Ga0068860_102282922 3300005843 Unclassified 562
76 Ga0068860_102781106 3300005843 Unclassified 507
77 Ga0068862_101913875 3300005844 Bacteria 603
78 Ga0081455_10052948 3300005937 Bacteria 3470
79 Ga0070717_10852844 3300006028 Unclassified 829
80 Ga0097621_100002481 3300006237 Bacteria 12637
81 Ga0097621_101320718 3300006237 Unclassified 681
82 Ga0068871_100002693 3300006358 Bacteria 12118
83 Ga0068871_100026670 3300006358 Unclassified 4511
84 Ga0068871_100824959 3300006358 Unclassified 856
85 Ga0068871_101313180 3300006358 Unclassified 681
86 Ga0068871_102299411 3300006358 Unclassified 514
87 Ga0075428_100096816 3300006844 Unclassified 3217
88 Ga0075428_102507545 3300006844 Bacteria 528
89 Ga0075430_100088686 3300006846 Bacteria 2588
90 Ga0075430_100383141 3300006846 Bacteria 1160
91 Ga0075431_100047947 3300006847 Bacteria 4406
92 Ga0075431_100089763 3300006847 Bacteria 3172
93 Ga0075431_100211106 3300006847 Bacteria 1983
94 Ga0075431_100487294 3300006847 Unclassified 1225
95 Ga0075431_100517068 3300006847 Unclassified 1183
96 Ga0075433_10017430 3300006852 Bacteria 5947
97 Ga0075433_10497588 3300006852 Bacteria 1073
98 Ga0075433_10594543 3300006852 Bacteria 972
99 Ga0075434_100005905 3300006871 Bacteria 11194
100 Ga0075434_100030452 3300006871 Bacteria 5313
101 Ga0075434_100041522 3300006871 Bacteria 4557
102 Ga0075434_100124468 3300006871 Bacteria 2595
103 Ga0068865_100118630 3300006881 Bacteria 1963
104 Ga0068865_101017445 3300006881 Unclassified 726
105 Ga0068865_101550528 3300006881 Bacteria 595
106 Ga0075436_100011394 3300006914 Bacteria 6104
107 Ga0075436_100233157 3300006914 Unclassified 1308
108 Ga0075436_100483419 3300006914 Bacteria 904
109 Ga0097620_100146320 3300006931 Bacteria 2438
110 Ga0097620_100151578 3300006931 Bacteria 2394
111 Ga0097620_102043092 3300006931 Bacteria 633
112 Ga0075435_100000028 3300007076 Bacteria 82360
113 Ga0075435_100023308 3300007076 Bacteria 4785
114 Ga0075435_100233737 3300007076 Bacteria 1562
115 Ga0075435_100685003 3300007076 Bacteria 891
116 Ga0105240_10093314 3300009093 Bacteria 3674
117 Ga0105240_10233414 3300009093 Bacteria 2136
118 Ga0111539_10000622 3300009094 Bacteria 45985
119 Ga0111539_10334063 3300009094 Unclassified 1764
120 Ga0105245_10062779 3300009098 Unclassified 3352
121 Ga0105245_11336038 3300009098 Unclassified 766
122 Ga0114129_10063259 3300009147 Bacteria 5168
123 Ga0114129_10329570 3300009147 Unclassified 2027
124 Ga0114129_10466267 3300009147 Bacteria 1655
125 Ga0105243_10357287 3300009148 Bacteria 1343
126 Ga0105242_10045058 3300009176 Bacteria 3574
127 Ga0105242_10134193 3300009176 Unclassified 2141
128 Ga0105248_10166625 3300009177 Bacteria 2483
129 Ga0105248_10648440 3300009177 Bacteria 1191
130 Ga0105248_11021343 3300009177 Unclassified 934
131 Ga0105248_11879620 3300009177 Bacteria 679
132 Ga0105238_10281178 3300009551 Bacteria 1645
133 Ga0105238_10316912 3300009551 Unclassified 1545
134 Ga0105249_10057404 3300009553 Bacteria 3566
135 Ga0105249_13252337 3300009553 Unclassified 522
136 Ga0157373_10887136 3300013100 Unclassified 661
137 Ga0157370_11323323 3300013104 Bacteria 649
138 Ga0157369_10137556 3300013105 Bacteria 2585
139 Ga0157369_11259210 3300013105 Unclassified 754
140 Ga0157374_11386381 3300013296 Unclassified 726
141 Ga0157378_10718583 3300013297 Unclassified 1020
142 Ga0157378_10842115 3300013297 Unclassified 945
143 Ga0157378_12439697 3300013297 Bacteria 575
144 Ga0163162_10174955 3300013306 Bacteria 2272
145 Ga0163162_11706842 3300013306 Unclassified 719
146 Ga0157372_10893217 3300013307 Bacteria 1031
147 Ga0157372_13335761 3300013307 Unclassified 511
148 Ga0157375_10034531 3300013308 Bacteria 4819
149 Ga0157375_10712856 3300013308 Bacteria 1156
150 Ga0163163_10629968 3300014325 Unclassified 1136
151 Ga0157379_11233655 3300014968 Bacteria 720
152 Ga0157376_10001945 3300014969 Bacteria 13803
153 Ga0157376_10266689 3300014969 Bacteria 1607
154 Ga0157376_11030015 3300014969 Bacteria 847
155 Ga0163161_10229346 3300017792 Bacteria 1441
156 Ga0163161_10444760 3300017792 Bacteria 1047
157 Ga0163161_11501699 3300017792 Bacteria 591
158 Ga0207642_10069390 3300025899 Unclassified 1671
159 Ga0207642_10499230 3300025899 Unclassified 745
160 Ga0207680_10251647 3300025903 Bacteria 1220
161 Ga0207680_10252641 3300025903 Bacteria 1218
162 Ga0207680_10902333 3300025903 Unclassified 633
163 Ga0207705_10015344 3300025909 Bacteria 5496
164 Ga0207654_10014262 3300025911 Bacteria 4103
165 Ga0207707_10038628 3300025912 Unclassified 4171
166 Ga0207695_10022702 3300025913 Bacteria 7112
167 Ga0207695_10290331 3300025913 Bacteria 1528
168 Ga0207663_10616170 3300025916 Unclassified 854
169 Ga0207663_11434261 3300025916 Unclassified 556
170 Ga0207657_10121964 3300025919 Bacteria 2144
171 Ga0207652_10069904 3300025921 Bacteria 3048
172 Ga0207652_10630728 3300025921 Bacteria 959
173 Ga0207681_10379009 3300025923 Bacteria 1138
174 Ga0207681_10988007 3300025923 Bacteria 706
175 Ga0207694_10215591 3300025924 Bacteria 1565
176 Ga0207694_10824860 3300025924 Bacteria 784
177 Ga0207659_10001061 3300025926 Bacteria 16292
178 Ga0207659_10547512 3300025926 Unclassified 983
179 Ga0207687_10199148 3300025927 Unclassified 1564
180 Ga0207644_11465776 3300025931 Bacteria 573
181 Ga0207686_10073712 3300025934 Unclassified 2203
182 Ga0207686_10794449 3300025934 Bacteria 758
183 Ga0207709_10188011 3300025935 Unclassified 1464
184 Ga0207670_10107459 3300025936 Bacteria 2003
185 Ga0207669_11923468 3300025937 Unclassified 506
186 Ga0207704_10032406 3300025938 Bacteria 2957
187 Ga0207704_10565583 3300025938 Bacteria 926
188 Ga0207665_10549758 3300025939 Unclassified 897
189 Ga0207665_11283919 3300025939 Unclassified 584
190 Ga0207711_10074388 3300025941 Bacteria 2954
191 Ga0207711_10433868 3300025941 Bacteria 1223
192 Ga0207667_10020275 3300025949 Bacteria 7399
193 Ga0207651_10269513 3300025960 Unclassified 1402
194 Ga0207712_10884684 3300025961 Unclassified 789
195 Ga0207712_11586284 3300025961 Unclassified 587
196 Ga0207668_11156342 3300025972 Unclassified 695
197 Ga0207640_10547547 3300025981 Bacteria 972
198 Ga0207677_10538897 3300026023 Bacteria 1015
199 Ga0207677_11493602 3300026023 Unclassified 624
200 Ga0207703_10622570 3300026035 Bacteria 1022
201 Ga0207639_10887000 3300026041 Bacteria 833
202 Ga0207678_10010561 3300026067 Bacteria 8112
203 Ga0207678_10119273 3300026067 Bacteria 2251
204 Ga0207641_10280240 3300026088 Bacteria 1568
205 Ga0207648_10194862 3300026089 Bacteria 1796
206 Ga0207648_10465830 3300026089 Unclassified 1152
207 Ga0207648_10479679 3300026089 Bacteria 1136
208 Ga0207674_10053869 3300026116 Bacteria 4098
209 Ga0207674_11747867 3300026116 Bacteria 590
210 Ga0207675_100886014 3300026118 Bacteria 908
211 Ga0207683_10235774 3300026121 Unclassified 1669
212 Ga0209968_1100891 3300027526 Unclassified 526
213 Ga0209983_1112173 3300027665 Unclassified 620
214 Ga0207428_10000069 3300027907 Bacteria 149507
215 Ga0207428_10084425 3300027907 Bacteria 2475
216 Ga0268266_10198050 3300028379 Unclassified 1837
217 Ga0268265_10492858 3300028380 Bacteria 1153
218 Ga0268264_10442264 3300028381 Bacteria 1258
219 Ga0373950_0044078 3300034818 Bacteria 861
220 Ga0373940_0003052 3300035088 Unclassified 3358
221 Ga0373951_0137581 3300035091 Unclassified 676
222 Ga0373932_0011365 3300035112 Unclassified 2174
223 Ga0373932_0021127 3300035112 Bacteria 1716
224 Ga0373939_0020977 3300035114 Unclassified 1782
225 Ga0373957_0110617 3300035120 Bacteria 1106
226 Ga0373960_0315924 3300035121 Bacteria 584
227 Ga0373955_0529745 3300035172 Unclassified 720
228 Ga0373961_0129847 3300035241 Unclassified 843
229 Ga0373931_0281464 3300035691 Unclassified 1021
230 Ga0373931_0496761 3300035691 Bacteria 786
231 Ga0373937_0024268 3300036401 Bacteria 5467
232 Ga0373937_0236685 3300036401 Bacteria 1720
233 Ga0373937_1777682 3300036401 Bacteria 563
234 Ga0451577_0047842 3300042876 Bacteria 3822
235 Ga0453684_0025405 3300044712 Bacteria 8602
236 Ga0453684_1712934 3300044712 Bacteria 642
237 Ga0451576_0105541 3300045051 Bacteria 2931
238 Ga0451576_0113911 3300045051 Unclassified 2815
239 Ga0451576_0274141 3300045051 Bacteria 1764
240 Ga0451576_0567262 3300045051 Bacteria 1193
241 Ga0451576_1096677 3300045051 Bacteria 833
242 Ga0495594_0402719 3300046499 Unclassified 778
243 Ga0495628_0310721 3300046516 Bacteria 1165
244 Ga0495640_0604628 3300046533 Unclassified 662
245 Ga0495586_0256275 3300046535 Unclassified 999
246 Ga0495634_0257701 3300046642 Bacteria 1065
247 Ga0495635_1010605 3300046663 Bacteria 529
248 Ga0495669_0103483 3300046684 Bacteria 1324
249 Ga0495670_0260189 3300046691 Bacteria 926
250 Ga0495589_0131184 3300046794 Bacteria 1203
251 Ga0495581_0498696 3300047315 Unclassified 708
252 Ga0495674_1424387 3300047319 Unclassified 516
253 Ga0495680_0495523 3300047322 Bacteria 830
254 Ga0496100_1448849 3300048903 Unclassified 542
255 Ga0496101_0704798 3300048904 Unclassified 797
256 Ga0496102_0092221 3300048905 Bacteria 2805
257 Ga0496104_0170065 3300048907 Bacteria 2090
258 Ga0496104_0570259 3300048907 Bacteria 1042
259 Ga0496105_0569596 3300048908 Bacteria 882
260 Ga0496106_0884406 3300048909 Unclassified 706
261 Ga0496108_0164722 3300048911 Unclassified 1917
262 Ga0496109_0269191 3300048912 Unclassified 1605
263 Ga0496112_0098571 3300048915 Bacteria 2892
264 Ga0496112_0338690 3300048915 Bacteria 1448
265 Ga0501036_0944891 3300049572 Bacteria 707
266 Ga0501037_0582180 3300049573 Bacteria 753
267 Ga0501037_0920830 3300049573 Bacteria 572
268 Ga0501040_0103690 3300049576 Bacteria 1986
269 Ga0501041_0501579 3300049577 Bacteria 772
270 Ga0501041_0532959 3300049577 Bacteria 748
271 Ga0501046_0097406 3300049580 Bacteria 2259
272 Ga0501046_0434035 3300049580 Bacteria 946
273 Ga0501048_0877848 3300049582 Bacteria 645
274 Ga0501067_0434036 3300049583 Bacteria 733
275 Ga0501068_0932243 3300049584 Bacteria 572
276 Ga0501069_0045901 3300049585 Bacteria 2422
277 Ga0501074_0651948 3300049590 Bacteria 744
278 Ga0501075_0442335 3300049591 Bacteria 991
279 Ga0501075_1115440 3300049591 Bacteria 599
280 Ga0501076_0072889 3300049592 Bacteria 2749
281 Ga0501077_0182724 3300049593 Bacteria 1333
282 Ga0501079_0635829 3300049741 Bacteria 840
283 Ga0501080_1495527 3300049742 Bacteria 574
284 Ga0501081_0180530 3300049743 Unclassified 1527
285 Ga0501081_1138739 3300049743 Bacteria 591
286 Ga0501081_1396221 3300049743 Bacteria 531
287 Ga0501263_005924 3300049760 Archaea 1395
288 Ga0501045_0678517 3300049824 Bacteria 761
289 nmdc:mga05p37_1033236_c1 3300050507 Bacteria 869
290 nmdc:mga05p37_659662_c1 3300050507 Bacteria 1170
291 nmdc:mga05p37_72497_c1 3300050507 Bacteria 4238
292 nmdc:mga09592_371176_c1 3300050508 Unclassified 1238
293 nmdc:mga0qj67_220991_c1 3300050509 Bacteria 1538
294 nmdc:mga0qj67_291851_c1 3300050509 Unclassified 1322
295 nmdc:mga06r32_498544_c1 3300050510 Bacteria 1195
296 nmdc:mga06r32_508917_c1 3300050510 Unclassified 1181
297 nmdc:mga06r32_533085_c1 3300050510 Unclassified 1149
298 nmdc:mga06r32_80026_c1 3300050510 Bacteria 3179
299 nmdc:mga06r32_81655_c1 3300050510 Bacteria 3148
300 nmdc:mga08y16_75961_c1 3300050511 Bacteria 3502
301 nmdc:mga0n895_155_c1 3300050512 Bacteria 42337
302 nmdc:mga0n895_31974_c1 3300050512 Bacteria 5045
303 nmdc:mga0rr50_1275921_c1 3300050513 Unclassified 623
304 nmdc:mga0rr50_82119_c1 3300050513 Bacteria 2489
305 nmdc:mga0rr50_865200_c1 3300050513 Bacteria 771
306 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
307 nmdc:mga0rr50_96398_c1 3300050513 Bacteria 2314
308 nmdc:mga08x19_1056_c1 3300050514 Bacteria 17215
309 nmdc:mga08x19_166169_c1 3300050514 Bacteria 1500
310 nmdc:mga08x19_90939_c1 3300050514 Bacteria 2014
311 nmdc:mga0a205_1115588_c1 3300050515 Bacteria 636
312 nmdc:mga0a205_1124002_c1 3300050515 Bacteria 633
313 nmdc:mga0a205_11409_c1 3300050515 Bacteria 8178
314 nmdc:mga0a205_212096_c1 3300050515 Bacteria 1824
315 nmdc:mga0a205_34390_c1 3300050515 Bacteria 4862
316 nmdc:mga0a205_441825_c1 3300050515 Bacteria 1161
317 Ga0501084_1233685 3300054114 Bacteria 627
318 Ga0530510_0608017 3300061734 Bacteria 832
319 Ga0307511_10038027
320 Ga0058859_11715825
321 Ga0058860_12021696
322 Ga0065712_10161845
323 Ga0065707_10370958
324 Ga0065707_10577352
325 Ga0065707_11035498
326 Ga0070690_100410324
327 Ga0070670_100328861
328 Ga0068869_100258156
329 Ga0070666_10280552
330 Ga0070666_10369859
331 Ga0070680_100524896
332 Ga0068868_100555124
333 Ga0068868_102408611
334 Ga0070660_100157313
335 Ga0070689_101241362
336 Ga0070691_10409035
337 Ga0070687_100559822
338 Ga0070692_10039074
339 Ga0070669_101341742
340 Ga0070675_100036495
341 Ga0070671_101380957
342 Ga0070674_100315894
343 Ga0070674_100835299
344 Ga0070674_101633594
345 Ga0070673_100147345
346 Ga0070673_100617273
347 Ga0070701_10547972
348 Ga0070705_100484022
349 Ga0070708_100031572
350 Ga0070708_100963026
351 Ga0070708_102084934
352 Ga0070663_100156643
353 Ga0070662_100142049
354 Ga0070681_10003050
355 Ga0070681_10007358
356 Ga0068867_100317027
357 Ga0068867_101033603
358 Ga0070685_10307025
359 Ga0070706_101973782
360 Ga0070698_100828356
361 Ga0070699_100489255
362 Ga0070679_100108495
363 Ga0070679_100260220
364 Ga0070679_100601828
365 Ga0070697_100827392
366 Ga0070697_101806273
367 Ga0068853_100082239
368 Ga0070672_101474903
369 Ga0070686_100152252
370 Ga0070686_100574776
371 Ga0070695_101208256
372 Ga0070695_101852265
373 Ga0070696_100644371
374 Ga0070693_100001424
375 Ga0070665_100060172
376 Ga0070704_100026534
377 Ga0070704_100969240
378 Ga0068855_100026273
379 Ga0068855_100761410
380 Ga0068855_101192216
381 Ga0070664_100603582
382 Ga0068854_102248912
383 Ga0068859_100146321
384 Ga0068859_102043109
385 Ga0068866_10267441
386 Ga0068861_102032616
387 Ga0068861_102319368
388 Ga0068870_10989367
389 Ga0068863_100536613
390 Ga0068863_102297139
391 Ga0068858_100487550
392 Ga0068860_100531018
393 Ga0068860_102282922
394 Ga0068860_102781106
395 Ga0068862_101913875
396 Ga0081455_10052948
397 Ga0070717_10852844
398 Ga0097621_100002481
399 Ga0097621_101320718
400 Ga0068871_100002693
401 Ga0068871_100026670
402 Ga0068871_100824959
403 Ga0068871_101313180
404 Ga0068871_102299411
405 Ga0075428_100096816
406 Ga0075428_102507545
407 Ga0075430_100088686
408 Ga0075430_100383141
409 Ga0075431_100047947
410 Ga0075431_100089763
411 Ga0075431_100211106
412 Ga0075431_100487294
413 Ga0075431_100517068
414 Ga0075433_10017430
415 Ga0075433_10497588
416 Ga0075433_10594543
417 Ga0075434_100005905
418 Ga0075434_100030452
419 Ga0075434_100041522
420 Ga0075434_100124468
421 Ga0068865_100118630
422 Ga0068865_101017445
423 Ga0068865_101550528
424 Ga0075436_100011394
425 Ga0075436_100233157
426 Ga0075436_100483419
427 Ga0097620_100146320
428 Ga0097620_100151578
429 Ga0097620_102043092
430 Ga0075435_100000028
431 Ga0075435_100023308
432 Ga0075435_100233737
433 Ga0075435_100685003
434 Ga0105240_10093314
435 Ga0105240_10233414
436 Ga0111539_10000622
437 Ga0111539_10334063
438 Ga0105245_10062779
439 Ga0105245_11336038
440 Ga0114129_10063259
441 Ga0114129_10329570
442 Ga0114129_10466267
443 Ga0105243_10357287
444 Ga0105242_10045058
445 Ga0105242_10134193
446 Ga0105248_10166625
447 Ga0105248_10648440
448 Ga0105248_11021343
449 Ga0105248_11879620
450 Ga0105238_10281178
451 Ga0105238_10316912
452 Ga0105249_10057404
453 Ga0105249_13252337
454 Ga0157373_10887136
455 Ga0157370_11323323
456 Ga0157369_10137556
457 Ga0157369_11259210
458 Ga0157374_11386381
459 Ga0157378_10718583
460 Ga0157378_10842115
461 Ga0157378_12439697
462 Ga0163162_10174955
463 Ga0163162_11706842
464 Ga0157372_10893217
465 Ga0157372_13335761
466 Ga0157375_10034531
467 Ga0157375_10712856
468 Ga0163163_10629968
469 Ga0157379_11233655
470 Ga0157376_10001945
471 Ga0157376_10266689
472 Ga0157376_11030015
473 Ga0163161_10229346
474 Ga0163161_10444760
475 Ga0163161_11501699
476 Ga0207642_10069390
477 Ga0207642_10499230
478 Ga0207680_10251647
479 Ga0207680_10252641
480 Ga0207680_10902333
481 Ga0207705_10015344
482 Ga0207654_10014262
483 Ga0207707_10038628
484 Ga0207695_10022702
485 Ga0207695_10290331
486 Ga0207663_10616170
487 Ga0207663_11434261
488 Ga0207657_10121964
489 Ga0207652_10069904
490 Ga0207652_10630728
491 Ga0207681_10379009
492 Ga0207681_10988007
493 Ga0207694_10215591
494 Ga0207694_10824860
495 Ga0207659_10001061
496 Ga0207659_10547512
497 Ga0207687_10199148
498 Ga0207644_11465776
499 Ga0207686_10073712
500 Ga0207686_10794449
501 Ga0207709_10188011
502 Ga0207670_10107459
503 Ga0207669_11923468
504 Ga0207704_10032406
505 Ga0207704_10565583
506 Ga0207665_10549758
507 Ga0207665_11283919
508 Ga0207711_10074388
509 Ga0207711_10433868
510 Ga0207667_10020275
511 Ga0207651_10269513
512 Ga0207712_10884684
513 Ga0207712_11586284
514 Ga0207668_11156342
515 Ga0207640_10547547
516 Ga0207677_10538897
517 Ga0207677_11493602
518 Ga0207703_10622570
519 Ga0207639_10887000
520 Ga0207678_10010561
521 Ga0207678_10119273
522 Ga0207641_10280240
523 Ga0207648_10194862
524 Ga0207648_10465830
525 Ga0207648_10479679
526 Ga0207674_10053869
527 Ga0207674_11747867
528 Ga0207675_100886014
529 Ga0207683_10235774
530 Ga0209968_1100891
531 Ga0209983_1112173
532 Ga0207428_10000069
533 Ga0207428_10084425
534 Ga0268266_10198050
535 Ga0268265_10492858
536 Ga0268264_10442264
537 Ga0373950_0044078
538 Ga0373940_0003052
539 Ga0373951_0137581
540 Ga0373932_0011365
541 Ga0373932_0021127
542 Ga0373939_0020977
543 Ga0373957_0110617
544 Ga0373960_0315924
545 Ga0373955_0529745
546 Ga0373961_0129847
547 Ga0373931_0281464
548 Ga0373931_0496761
549 Ga0373937_0024268
550 Ga0373937_0236685
551 Ga0373937_1777682
552 Ga0451577_0047842
553 Ga0453684_0025405
554 Ga0453684_1712934
555 Ga0451576_0105541
556 Ga0451576_0113911
557 Ga0451576_0274141
558 Ga0451576_0567262
559 Ga0451576_1096677
560 Ga0495594_0402719
561 Ga0495628_0310721
562 Ga0495640_0604628
563 Ga0495586_0256275
564 Ga0495634_0257701
565 Ga0495635_1010605
566 Ga0495669_0103483
567 Ga0495670_0260189
568 Ga0495589_0131184
569 Ga0495581_0498696
570 Ga0495674_1424387
571 Ga0495680_0495523
572 Ga0496100_1448849
573 Ga0496101_0704798
574 Ga0496102_0092221
575 Ga0496104_0170065
576 Ga0496104_0570259
577 Ga0496105_0569596
578 Ga0496106_0884406
579 Ga0496108_0164722
580 Ga0496109_0269191
581 Ga0496112_0098571
582 Ga0496112_0338690
583 Ga0501036_0944891
584 Ga0501037_0582180
585 Ga0501037_0920830
586 Ga0501040_0103690
587 Ga0501041_0501579
588 Ga0501041_0532959
589 Ga0501046_0097406
590 Ga0501046_0434035
591 Ga0501048_0877848
592 Ga0501067_0434036
593 Ga0501068_0932243
594 Ga0501069_0045901
595 Ga0501074_0651948
596 Ga0501075_0442335
597 Ga0501075_1115440
598 Ga0501076_0072889
599 Ga0501077_0182724
600 Ga0501079_0635829
601 Ga0501080_1495527
602 Ga0501081_0180530
603 Ga0501081_1138739
604 Ga0501081_1396221
605 Ga0501263_005924
606 Ga0501045_0678517
607 nmdc:mga05p37_1033236_c1
608 nmdc:mga05p37_659662_c1
609 nmdc:mga05p37_72497_c1
610 nmdc:mga09592_371176_c1
611 nmdc:mga0qj67_220991_c1
612 nmdc:mga0qj67_291851_c1
613 nmdc:mga06r32_498544_c1
614 nmdc:mga06r32_508917_c1
615 nmdc:mga06r32_533085_c1
616 nmdc:mga06r32_80026_c1
617 nmdc:mga06r32_81655_c1
618 nmdc:mga08y16_75961_c1
619 nmdc:mga0n895_155_c1
620 nmdc:mga0n895_31974_c1
621 nmdc:mga0rr50_1275921_c1
622 nmdc:mga0rr50_82119_c1
623 nmdc:mga0rr50_865200_c1
624 nmdc:mga0rr50_8_c1
625 nmdc:mga0rr50_96398_c1
626 nmdc:mga08x19_1056_c1
627 nmdc:mga08x19_166169_c1
628 nmdc:mga08x19_90939_c1
629 nmdc:mga0a205_1115588_c1
630 nmdc:mga0a205_1124002_c1
631 nmdc:mga0a205_11409_c1
632 nmdc:mga0a205_212096_c1
633 nmdc:mga0a205_34390_c1
634 nmdc:mga0a205_441825_c1
635 Ga0501084_1233685
636 Ga0530510_0608017

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u1o-assembly1.cif.gz_A 2.3 angstrom resolution crystal structure of glutathione reductase from vibrio parahaemolyticus in complex with fad. 0.7126 30 50
7zai-assembly1.cif.gz_E cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna, mrna and aif1a. 0.708 26 54
4hb9-assembly1.cif.gz_A crystal structure of a putative fad containing monooxygenase from photorhabdus luminescens subsp. laumondii tto1 (target psi-012791) 0.7042 28 50
3jyy-assembly1.cif.gz_A semet linb complexed with ppi 0.7032 29 51
5vdn-assembly1.cif.gz_B 1.55 angstrom resolution crystal structure of glutathione reductase from yersinia pestis in complex with fad 0.7008 30 50
ID Description Score Start End Superfamily
af_G5EEF1_33_167_2.80.10.50 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.7663 28 43 2.80.10.50
af_Q8NCM8_1509_1665_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.73 26 52 1.20.58.1120
af_Q94K76_25_167_2.90.10.10 Mainly Beta;Orthogonal Prism;Agglutinin, subunit A;Bulb-type lectin domain 0.7235 28 49 2.90.10.10
af_Q4DXX6_1_299_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7142 26 52 2.130.10.10
af_Q9XWF9_804_861_3.10.450.750 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7088 26 51 3.10.450.750
ID Description Score Start End GO Terms
AF-A0A3N5IAS0-F1-model_v4 Uncharacterized protein 0.9557 26 81
AF-A0A847GXX1-F1-model_v4 Uncharacterized protein 0.9197 21 81
AF-A0A4Q7YZV2-F1-model_v4 Uncharacterized protein 0.9127 1 81
AF-A0A4Q7YZV2-F1-model_v4 Uncharacterized protein 0.9023 1 81
AF-A0A847GXX1-F1-model_v4 Uncharacterized protein 0.8661 21 81

Map