F404623

General Info

Members Datasets Scaffolds Average Seq Length
318 218 636 244

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10016501|Ga0213875_100165015
Length 286
Sequence VEGHRADSRGVFESGLPAAEAAARGLPTLREIRRPPGHPSGLTPRRDVPLGSRPLLTALGIDIDAELLTLALTHRSYAYESGGLEPNERLEFLGDAVLGVVVTDHLFRTHPELPEGQLAKLRASVVNMHALAGVARGLGARGLGEYLLVGRGEELTGGRNKSSILADTVEALIGAVYLQHGMDIARSVVHRLFDPLLVMAPLLGAGLDWKTSLQELTASRELGVPEYRITEDGPDHLKEFTATAVIAGVDRGTGQGRTKKEAEQRAAEAAWRSLSELASGSAPPGG

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
196 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
197 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
198 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
199 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
200 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
201 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
202 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
203 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
204 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
205 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
206 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
207 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
208 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
209 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
210 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
211 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
212 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
213 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
214 2922554459 Rhodococcus sp. 66b Isolate Unclassified
215 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
216 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
217 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
218 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.19
Metatranscriptomes 1.26
Isolates 7.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.09
Nodule 0
Rhizoplane 8.49
Rhizosphere 75.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10016501 3300021388 Bacteria 3579
2 rootH2_10240016 3300003320 Bacteria 1730
3 Ga0055540_1014300 3300003792 Bacteria 2370
4 Ga0070658_10234258 3300005327 Bacteria 1555
5 Ga0070658_10458393 3300005327 Bacteria 1099
6 Ga0070658_10533077 3300005327 Bacteria 1015
7 Ga0070676_10097434 3300005328 Bacteria 1811
8 Ga0070683_100713490 3300005329 Bacteria 960
9 Ga0070666_10152442 3300005335 Bacteria 1613
10 Ga0070682_100090451 3300005337 Bacteria 2001
11 Ga0070682_100157660 3300005337 Bacteria 1564
12 Ga0070682_100396407 3300005337 Bacteria 1043
13 Ga0068868_100219042 3300005338 Bacteria 1593
14 Ga0070689_100098755 3300005340 Bacteria 2309
15 Ga0070691_10155633 3300005341 Bacteria 1175
16 Ga0070661_100375721 3300005344 Bacteria 1119
17 Ga0070668_100002199 3300005347 Bacteria 14319
18 Ga0070669_100076681 3300005353 Bacteria 2482
19 Ga0070675_100243008 3300005354 Bacteria 1573
20 Ga0070671_100005830 3300005355 Bacteria 9814
21 Ga0070688_100173367 3300005365 Bacteria 1490
22 Ga0070667_100015369 3300005367 Bacteria 6328
23 Ga0070709_10524711 3300005434 Bacteria 903
24 Ga0070714_100020748 3300005435 Bacteria 5370
25 Ga0070713_100722839 3300005436 Bacteria 952
26 Ga0070701_10255147 3300005438 Bacteria 1060
27 Ga0070700_100244692 3300005441 Bacteria 1283
28 Ga0070663_100019917 3300005455 Bacteria 4431
29 Ga0070663_100087036 3300005455 Bacteria 2308
30 Ga0070678_100240739 3300005456 Bacteria 1513
31 Ga0070678_100308912 3300005456 Bacteria 1346
32 Ga0070685_10134647 3300005466 Bacteria 1549
33 Ga0070685_10136550 3300005466 Bacteria 1539
34 Ga0070679_100031016 3300005530 Bacteria 5282
35 Ga0070684_100109609 3300005535 Bacteria 2474
36 Ga0070684_100371784 3300005535 Bacteria 1316
37 Ga0070693_100147118 3300005547 Bacteria 1489
38 Ga0070665_100009871 3300005548 Bacteria 9651
39 Ga0070665_100020697 3300005548 Bacteria 6609
40 Ga0070665_100032894 3300005548 Bacteria 5217
41 Ga0070665_100394020 3300005548 Bacteria 1392
42 Ga0070665_100822396 3300005548 Bacteria 942
43 Ga0068855_100109726 3300005563 Bacteria 3168
44 Ga0068855_100276444 3300005563 Bacteria 1866
45 Ga0070664_100188965 3300005564 Bacteria 1834
46 Ga0068857_100338550 3300005577 Bacteria 1392
47 Ga0068854_100104659 3300005578 Bacteria 2126
48 Ga0068854_100159826 3300005578 Bacteria 1744
49 Ga0068856_100973901 3300005614 Bacteria 867
50 Ga0070702_100066635 3300005615 Bacteria 2112
51 Ga0068852_100107465 3300005616 Bacteria 2531
52 Ga0068852_100269902 3300005616 Bacteria 1637
53 Ga0068859_100076635 3300005617 Bacteria 3385
54 Ga0068864_100047654 3300005618 Bacteria 3682
55 Ga0068864_100148981 3300005618 Bacteria 2118
56 Ga0068864_100590932 3300005618 Bacteria 1076
57 Ga0068866_10350415 3300005718 Bacteria 938
58 Ga0068861_100132609 3300005719 Bacteria 2024
59 Ga0068851_10078952 3300005834 Bacteria 1715
60 Ga0068870_10038578 3300005840 Bacteria 2467
61 Ga0068863_100010066 3300005841 Bacteria 9202
62 Ga0068863_100022910 3300005841 Bacteria 5969
63 Ga0068863_100373128 3300005841 Bacteria 1392
64 Ga0068860_100039150 3300005843 Bacteria 4535
65 Ga0068862_100026295 3300005844 Bacteria 4891
66 Ga0068862_100308870 3300005844 Bacteria 1457
67 Ga0081455_10004130 3300005937 Bacteria 16420
68 Ga0075365_10305472 3300006038 Bacteria 1120
69 Ga0075363_100018712 3300006048 Bacteria 3455
70 Ga0075362_10010735 3300006177 Bacteria 3586
71 Ga0075433_10420883 3300006852 Bacteria 1178
72 Ga0097620_100076636 3300006931 Bacteria 3385
73 Ga0099795_10020203 3300007788 Bacteria 2166
74 Ga0111539_10089620 3300009094 Bacteria 3615
75 Ga0105245_10016732 3300009098 Bacteria 6403
76 Ga0105245_10736091 3300009098 Bacteria 1021
77 Ga0105247_10334980 3300009101 Bacteria 1060
78 Ga0105243_10003587 3300009148 Bacteria 12523
79 Ga0105243_10172885 3300009148 Bacteria 1873
80 Ga0105243_10707011 3300009148 Bacteria 983
81 Ga0105242_10153734 3300009176 Bacteria 2008
82 Ga0105237_10100764 3300009545 Bacteria 2880
83 Ga0105237_10191460 3300009545 Bacteria 2045
84 Ga0105238_10390615 3300009551 Bacteria 1384
85 Ga0105239_10038473 3300010375 Bacteria 5242
86 Ga0105239_10757556 3300010375 Bacteria 1111
87 Ga0105239_10920861 3300010375 Bacteria 1004
88 Ga0105246_10380252 3300011119 Bacteria 1166
89 Ga0157369_10238329 3300013105 Bacteria 1900
90 Ga0157369_10358166 3300013105 Bacteria 1515
91 Ga0157369_11043539 3300013105 Bacteria 836
92 Ga0157378_10208382 3300013297 Bacteria 1852
93 Ga0157378_10660488 3300013297 Bacteria 1062
94 Ga0163162_10542705 3300013306 Bacteria 1291
95 Ga0157372_10663631 3300013307 Bacteria 1214
96 Ga0157375_10212848 3300013308 Bacteria 2091
97 Ga0163163_10509212 3300014325 Bacteria 1266
98 Ga0157380_10020745 3300014326 Bacteria 4917
99 Ga0157379_10004889 3300014968 Bacteria 11503
100 Ga0206354_10801667 3300020081 Bacteria 1913
101 Ga0206354_11182381 3300020081 Bacteria 3762
102 Ga0213876_10007211 3300021384 Bacteria 6060
103 Ga0213876_10017768 3300021384 Bacteria 3753
104 Ga0213875_10000073 3300021388 Bacteria 119027
105 Ga0209051_1005317 3300025303 Bacteria 7578
106 Ga0209051_1039533 3300025303 Bacteria 1701
107 Ga0207692_10058206 3300025898 Bacteria 1990
108 Ga0207642_10083610 3300025899 Bacteria 1557
109 Ga0207710_10078997 3300025900 Bacteria 1523
110 Ga0207688_10007962 3300025901 Bacteria 5765
111 Ga0207688_10021632 3300025901 Bacteria 3517
112 Ga0207647_10073738 3300025904 Bacteria 2056
113 Ga0207645_10105214 3300025907 Bacteria 1823
114 Ga0207662_10024497 3300025918 Bacteria 3471
115 Ga0207657_10063755 3300025919 Bacteria 3148
116 Ga0207657_10226595 3300025919 Bacteria 1496
117 Ga0207657_10529858 3300025919 Bacteria 922
118 Ga0207649_10096194 3300025920 Bacteria 1950
119 Ga0207652_10256086 3300025921 Bacteria 1579
120 Ga0207681_10099429 3300025923 Bacteria 2095
121 Ga0207687_10046632 3300025927 Bacteria 3001
122 Ga0207664_10188596 3300025929 Bacteria 1774
123 Ga0207664_10296787 3300025929 Bacteria 1421
124 Ga0207664_10308165 3300025929 Bacteria 1395
125 Ga0207644_10014487 3300025931 Bacteria 5273
126 Ga0207644_10036229 3300025931 Bacteria 3462
127 Ga0207644_10228802 3300025931 Bacteria 1477
128 Ga0207706_10064177 3300025933 Bacteria 3233
129 Ga0207706_10141761 3300025933 Bacteria 2115
130 Ga0207709_10041738 3300025935 Bacteria 2755
131 Ga0207709_10356279 3300025935 Bacteria 1106
132 Ga0207670_10174447 3300025936 Bacteria 1614
133 Ga0207669_10021871 3300025937 Bacteria 3386
134 Ga0207704_10458264 3300025938 Bacteria 1019
135 Ga0207711_10263126 3300025941 Bacteria 1586
136 Ga0207711_10600461 3300025941 Bacteria 1027
137 Ga0207661_10149785 3300025944 Bacteria 2016
138 Ga0207661_10208258 3300025944 Bacteria 1722
139 Ga0207667_10513448 3300025949 Bacteria 1214
140 Ga0207668_10000508 3300025972 Bacteria 24387
141 Ga0207668_10051412 3300025972 Bacteria 2846
142 Ga0207668_10297229 3300025972 Bacteria 1331
143 Ga0207668_10676594 3300025972 Bacteria 905
144 Ga0207640_10078730 3300025981 Bacteria 2245
145 Ga0207640_10115444 3300025981 Bacteria 1912
146 Ga0207658_10010832 3300025986 Bacteria 6204
147 Ga0207658_10025989 3300025986 Bacteria 4102
148 Ga0207677_10116515 3300026023 Bacteria 2000
149 Ga0207703_10050082 3300026035 Bacteria 3379
150 Ga0207703_10183014 3300026035 Bacteria 1850
151 Ga0207678_10041138 3300026067 Bacteria 4007
152 Ga0207678_10126401 3300026067 Bacteria 2181
153 Ga0207678_10151691 3300026067 Bacteria 1979
154 Ga0207678_10208637 3300026067 Bacteria 1671
155 Ga0207678_10352852 3300026067 Bacteria 1268
156 Ga0207708_10115019 3300026075 Bacteria 2092
157 Ga0207708_10228387 3300026075 Bacteria 1494
158 Ga0207702_10263120 3300026078 Bacteria 1625
159 Ga0207702_10701546 3300026078 Bacteria 997
160 Ga0207641_10007218 3300026088 Bacteria 9261
161 Ga0207641_10062522 3300026088 Bacteria 3177
162 Ga0207676_10260079 3300026095 Bacteria 1567
163 Ga0207676_10282412 3300026095 Bacteria 1508
164 Ga0207676_10335165 3300026095 Bacteria 1393
165 Ga0207676_10461749 3300026095 Bacteria 1199
166 Ga0207683_10246991 3300026121 Bacteria 1628
167 Ga0207698_10036652 3300026142 Bacteria 3602
168 Ga0207698_10129288 3300026142 Bacteria 2155
169 Ga0207698_10301577 3300026142 Bacteria 1491
170 Ga0268266_10007692 3300028379 Bacteria 9676
171 Ga0268266_10068026 3300028379 Bacteria 3083
172 Ga0268266_10115857 3300028379 Bacteria 2379
173 Ga0268265_10014576 3300028380 Bacteria 5358
174 Ga0268265_10030366 3300028380 Bacteria 3891
175 Ga0268264_10029176 3300028381 Bacteria 4518
176 Ga0268264_10490510 3300028381 Bacteria 1196
177 Ga0307515_10071122 3300028794 Bacteria 4720
178 Ga0307406_10605674 3300031901 Bacteria 904
179 Ga0307407_10119053 3300031903 Bacteria 1671
180 Ga0307416_100134397 3300032002 Bacteria 2234
181 Ga0307507_10083705 3300033179 Bacteria 2787
182 Ga0373935_0017154 3300035692 Bacteria 4388
183 Ga0373937_0443107 3300036401 Bacteria 1233
184 Ga0395899_0094242 3300037312 Bacteria 2167
185 Ga0436364_0290389 3300037853 Bacteria 159315
186 Ga0436364_1518276 3300037853 Bacteria 17402
187 Ga0395901_0039371 3300038443 Bacteria 4891
188 Ga0395901_0152608 3300038443 Bacteria 2427
189 Ga0436365_0302347 3300039437 Bacteria 26430
190 Ga0436365_0449497 3300039437 Bacteria 32186
191 Ga0436365_0716882 3300039437 Bacteria 3178
192 Ga0436365_1579019 3300039437 Bacteria 6588
193 Ga0436362_0345588 3300039453 Bacteria 54446
194 Ga0439466_0010822 3300041411 Bacteria 3387
195 Ga0439465_0002492 3300041413 Bacteria 6011
196 Ga0451793_0328309 3300041452 Bacteria 4342
197 Ga0451795_0849573 3300041456 Bacteria 1710
198 Ga0451853_0054582 3300041512 Bacteria 1364
199 Ga0451853_0250088 3300041512 Bacteria 1082
200 Ga0451853_1802465 3300041512 Bacteria 1306
201 Ga0439445_0003664 3300042004 Bacteria 3448
202 Ga0466972_0019888 3300044658 Bacteria 3356
203 Ga0466965_0005542 3300044683 Bacteria 5692
204 Ga0466966_0010380 3300044684 Bacteria 6184
205 Ga0466966_0042007 3300044684 Bacteria 2937
206 Ga0466966_0117953 3300044684 Bacteria 1632
207 Ga0466961_0127570 3300044693 Bacteria 1595
208 Ga0466963_0000150 3300044694 Bacteria 27879
209 Ga0466963_0252848 3300044694 Bacteria 1237
210 Ga0466964_0264974 3300044706 Bacteria 853
211 Ga0466971_0055625 3300044719 Bacteria 1784
212 Ga0466971_0075290 3300044719 Bacteria 1535
213 Ga0466968_0002314 3300044735 Bacteria 6965
214 Ga0466970_0007173 3300044765 Bacteria 5581
215 Ga0466970_0029004 3300044765 Bacteria 2911
216 Ga0466970_0119419 3300044765 Bacteria 1443
217 Ga0466957_0000576 3300044842 Bacteria 18522
218 Ga0466957_0101494 3300044842 Bacteria 1814
219 Ga0466960_0005877 3300044901 Bacteria 4891
220 Ga0466960_0274617 3300044901 Bacteria 943
221 Ga0466959_0004385 3300045049 Bacteria 9439
222 Ga0466958_0000322 3300045836 Bacteria 19046
223 Ga0466958_0078992 3300045836 Bacteria 2023
224 Ga0466967_0011978 3300045976 Bacteria 6608
225 Ga0466967_0014454 3300045976 Bacteria 6150
226 Ga0466967_0032629 3300045976 Bacteria 4399
227 Ga0466967_0078460 3300045976 Bacteria 2975
228 Ga0495620_0075892 3300046515 Bacteria 1367
229 Ga0495665_0037755 3300046531 Bacteria 2577
230 Ga0495668_0000573 3300046616 Bacteria 45058
231 Ga0496100_0030100 3300048903 Bacteria 3364
232 Ga0496100_0350551 3300048903 Bacteria 1115
233 Ga0496101_0003945 3300048904 Bacteria 9275
234 Ga0496102_0000042 3300048905 Bacteria 196538
235 Ga0496102_0001298 3300048905 Bacteria 22464
236 Ga0496103_0000441 3300048906 Bacteria 35759
237 Ga0496104_0243248 3300048907 Bacteria 1711
238 Ga0496105_0007258 3300048908 Bacteria 8559
239 Ga0496105_0038846 3300048908 Bacteria 3922
240 Ga0496106_0120107 3300048909 Bacteria 2054
241 Ga0496108_0002821 3300048911 Bacteria 13941
242 Ga0496108_0043277 3300048911 Bacteria 3762
243 Ga0496108_0142855 3300048911 Bacteria 2062
244 Ga0496108_0451919 3300048911 Bacteria 1122
245 Ga0496109_0012517 3300048912 Bacteria 7325
246 Ga0496109_0086561 3300048912 Bacteria 2894
247 Ga0496109_0243205 3300048912 Bacteria 1694
248 Ga0496109_0372666 3300048912 Bacteria 1348
249 Ga0496109_0946787 3300048912 Bacteria 799
250 Ga0496110_0148667 3300048913 Bacteria 2120
251 Ga0496110_0184539 3300048913 Bacteria 1894
252 Ga0496110_0234246 3300048913 Bacteria 1670
253 Ga0496111_0120503 3300048914 Bacteria 1938
254 Ga0496113_0014387 3300048916 Bacteria 5397
255 Ga0496114_0095270 3300048917 Bacteria 2533
256 Ga0496116_0000945 3300048919 Bacteria 35787
257 Ga0496117_0000339 3300048920 Bacteria 82597
258 Ga0496118_0000241 3300048921 Bacteria 96484
259 Ga0496119_0009027 3300048922 Bacteria 8645
260 Ga0496120_0032431 3300048923 Bacteria 3149
261 Ga0496121_0028028 3300048924 Bacteria 5254
262 Ga0496122_0092544 3300048925 Bacteria 2055
263 Ga0496123_0222543 3300048926 Bacteria 951
264 Ga0496124_0018472 3300048927 Bacteria 6528
265 Ga0496125_0065297 3300048928 Bacteria 2884
266 Ga0496126_0001023 3300048929 Bacteria 47541
267 Ga0501317_005053 3300049533 Bacteria 1399
268 Ga0501318_001119 3300049534 Bacteria 2006
269 Ga0501032_0024244 3300049569 Bacteria 4191
270 Ga0501033_0234328 3300049570 Bacteria 1303
271 Ga0501033_0307430 3300049570 Bacteria 1115
272 Ga0501034_0017132 3300049571 Bacteria 7434
273 Ga0501036_0386227 3300049572 Bacteria 1168
274 Ga0501037_0198598 3300049573 Bacteria 1418
275 Ga0501043_0172498 3300049579 Bacteria 1687
276 Ga0501047_0350935 3300049581 Bacteria 1312
277 Ga0501070_0142734 3300049586 Bacteria 1977
278 Ga0501072_0589821 3300049588 Bacteria 876
279 Ga0501076_0318843 3300049592 Bacteria 1275
280 Ga0501035_0000344 3300049822 Bacteria 53753
281 Ga0501044_0011255 3300049823 Bacteria 9699
282 Ga0501044_0116520 3300049823 Bacteria 2677
283 nmdc:mga03683_83965_c1 3300050489 Bacteria 1379
284 nmdc:mga03n38_34749_c1 3300050490 Bacteria 2155
285 nmdc:mga03n38_5390_c1 3300050490 Bacteria 4350
286 nmdc:mga00v17_44332_c1 3300050491 Bacteria 2682
287 nmdc:mga0yw44_14379_c1 3300050492 Bacteria 4202
288 nmdc:mga07m45_68546_c1 3300050496 Bacteria 2017
289 nmdc:mga09592_192920_c1 3300050508 Bacteria 1763
290 nmdc:mga0qj67_156437_c1 3300050509 Bacteria 1850
291 nmdc:mga08y16_660693_c1 3300050511 Bacteria 1048
292 nmdc:mga08x19_347327_c1 3300050514 Bacteria 1035
293 Ga0500559_0089310 3300053136 Bacteria 1409
294 Ga0466962_0101866 3300061719 Bacteria 1379
295 2523385875 2523231044 Bacteria 6434991
296 2566993099 2565956761 Bacteria 6601618
297 2623501999 2622736605 Bacteria 4992138
298 2644486478 2643221687 Bacteria 6500351
299 2738889938 2738541308 Bacteria 7020677
300 2739203245 2738543005 Bacteria 5278128
301 2739238683 2738543011 Bacteria 5731169
302 2739362219 2738543034 Bacteria 6084756
303 2753035276 2751185725 Bacteria 5740550
304 2753323793 2751185792 Bacteria 5739090
305 2816504681 2816332139 Bacteria 9138787
306 2870726734 2870721527 Bacteria 9689237
307 2889300954 2889300758 Bacteria 5690814
308 2902840105 2902837492 Bacteria 6697721
309 2904538907 2904535858 Bacteria 6308016
310 2904770127 2904765812 Bacteria 5369154
311 2904771024 2904770941 Bacteria 5580202
312 2919424449 2919420072 Bacteria 5390363
313 2919436842 2919432681 Bacteria 5390474
314 2922556795 2922554459 Bacteria 6683962
315 2939744475 2939743619 Bacteria 5762299
316 3001122207 3001119090 Bacteria 3449530
317 8054474328 8054472261 Bacteria 7464355
318 8057573219 8057568493 Bacteria 7221719
319 Ga0213875_10016501
320 rootH2_10240016
321 Ga0055540_1014300
322 Ga0070658_10234258
323 Ga0070658_10458393
324 Ga0070658_10533077
325 Ga0070676_10097434
326 Ga0070683_100713490
327 Ga0070666_10152442
328 Ga0070682_100090451
329 Ga0070682_100157660
330 Ga0070682_100396407
331 Ga0068868_100219042
332 Ga0070689_100098755
333 Ga0070691_10155633
334 Ga0070661_100375721
335 Ga0070668_100002199
336 Ga0070669_100076681
337 Ga0070675_100243008
338 Ga0070671_100005830
339 Ga0070688_100173367
340 Ga0070667_100015369
341 Ga0070709_10524711
342 Ga0070714_100020748
343 Ga0070713_100722839
344 Ga0070701_10255147
345 Ga0070700_100244692
346 Ga0070663_100019917
347 Ga0070663_100087036
348 Ga0070678_100240739
349 Ga0070678_100308912
350 Ga0070685_10134647
351 Ga0070685_10136550
352 Ga0070679_100031016
353 Ga0070684_100109609
354 Ga0070684_100371784
355 Ga0070693_100147118
356 Ga0070665_100009871
357 Ga0070665_100020697
358 Ga0070665_100032894
359 Ga0070665_100394020
360 Ga0070665_100822396
361 Ga0068855_100109726
362 Ga0068855_100276444
363 Ga0070664_100188965
364 Ga0068857_100338550
365 Ga0068854_100104659
366 Ga0068854_100159826
367 Ga0068856_100973901
368 Ga0070702_100066635
369 Ga0068852_100107465
370 Ga0068852_100269902
371 Ga0068859_100076635
372 Ga0068864_100047654
373 Ga0068864_100148981
374 Ga0068864_100590932
375 Ga0068866_10350415
376 Ga0068861_100132609
377 Ga0068851_10078952
378 Ga0068870_10038578
379 Ga0068863_100010066
380 Ga0068863_100022910
381 Ga0068863_100373128
382 Ga0068860_100039150
383 Ga0068862_100026295
384 Ga0068862_100308870
385 Ga0081455_10004130
386 Ga0075365_10305472
387 Ga0075363_100018712
388 Ga0075362_10010735
389 Ga0075433_10420883
390 Ga0097620_100076636
391 Ga0099795_10020203
392 Ga0111539_10089620
393 Ga0105245_10016732
394 Ga0105245_10736091
395 Ga0105247_10334980
396 Ga0105243_10003587
397 Ga0105243_10172885
398 Ga0105243_10707011
399 Ga0105242_10153734
400 Ga0105237_10100764
401 Ga0105237_10191460
402 Ga0105238_10390615
403 Ga0105239_10038473
404 Ga0105239_10757556
405 Ga0105239_10920861
406 Ga0105246_10380252
407 Ga0157369_10238329
408 Ga0157369_10358166
409 Ga0157369_11043539
410 Ga0157378_10208382
411 Ga0157378_10660488
412 Ga0163162_10542705
413 Ga0157372_10663631
414 Ga0157375_10212848
415 Ga0163163_10509212
416 Ga0157380_10020745
417 Ga0157379_10004889
418 Ga0206354_10801667
419 Ga0206354_11182381
420 Ga0213876_10007211
421 Ga0213876_10017768
422 Ga0213875_10000073
423 Ga0209051_1005317
424 Ga0209051_1039533
425 Ga0207692_10058206
426 Ga0207642_10083610
427 Ga0207710_10078997
428 Ga0207688_10007962
429 Ga0207688_10021632
430 Ga0207647_10073738
431 Ga0207645_10105214
432 Ga0207662_10024497
433 Ga0207657_10063755
434 Ga0207657_10226595
435 Ga0207657_10529858
436 Ga0207649_10096194
437 Ga0207652_10256086
438 Ga0207681_10099429
439 Ga0207687_10046632
440 Ga0207664_10188596
441 Ga0207664_10296787
442 Ga0207664_10308165
443 Ga0207644_10014487
444 Ga0207644_10036229
445 Ga0207644_10228802
446 Ga0207706_10064177
447 Ga0207706_10141761
448 Ga0207709_10041738
449 Ga0207709_10356279
450 Ga0207670_10174447
451 Ga0207669_10021871
452 Ga0207704_10458264
453 Ga0207711_10263126
454 Ga0207711_10600461
455 Ga0207661_10149785
456 Ga0207661_10208258
457 Ga0207667_10513448
458 Ga0207668_10000508
459 Ga0207668_10051412
460 Ga0207668_10297229
461 Ga0207668_10676594
462 Ga0207640_10078730
463 Ga0207640_10115444
464 Ga0207658_10010832
465 Ga0207658_10025989
466 Ga0207677_10116515
467 Ga0207703_10050082
468 Ga0207703_10183014
469 Ga0207678_10041138
470 Ga0207678_10126401
471 Ga0207678_10151691
472 Ga0207678_10208637
473 Ga0207678_10352852
474 Ga0207708_10115019
475 Ga0207708_10228387
476 Ga0207702_10263120
477 Ga0207702_10701546
478 Ga0207641_10007218
479 Ga0207641_10062522
480 Ga0207676_10260079
481 Ga0207676_10282412
482 Ga0207676_10335165
483 Ga0207676_10461749
484 Ga0207683_10246991
485 Ga0207698_10036652
486 Ga0207698_10129288
487 Ga0207698_10301577
488 Ga0268266_10007692
489 Ga0268266_10068026
490 Ga0268266_10115857
491 Ga0268265_10014576
492 Ga0268265_10030366
493 Ga0268264_10029176
494 Ga0268264_10490510
495 Ga0307515_10071122
496 Ga0307406_10605674
497 Ga0307407_10119053
498 Ga0307416_100134397
499 Ga0307507_10083705
500 Ga0373935_0017154
501 Ga0373937_0443107
502 Ga0395899_0094242
503 Ga0436364_0290389
504 Ga0436364_1518276
505 Ga0395901_0039371
506 Ga0395901_0152608
507 Ga0436365_0302347
508 Ga0436365_0449497
509 Ga0436365_0716882
510 Ga0436365_1579019
511 Ga0436362_0345588
512 Ga0439466_0010822
513 Ga0439465_0002492
514 Ga0451793_0328309
515 Ga0451795_0849573
516 Ga0451853_0054582
517 Ga0451853_0250088
518 Ga0451853_1802465
519 Ga0439445_0003664
520 Ga0466972_0019888
521 Ga0466965_0005542
522 Ga0466966_0010380
523 Ga0466966_0042007
524 Ga0466966_0117953
525 Ga0466961_0127570
526 Ga0466963_0000150
527 Ga0466963_0252848
528 Ga0466964_0264974
529 Ga0466971_0055625
530 Ga0466971_0075290
531 Ga0466968_0002314
532 Ga0466970_0007173
533 Ga0466970_0029004
534 Ga0466970_0119419
535 Ga0466957_0000576
536 Ga0466957_0101494
537 Ga0466960_0005877
538 Ga0466960_0274617
539 Ga0466959_0004385
540 Ga0466958_0000322
541 Ga0466958_0078992
542 Ga0466967_0011978
543 Ga0466967_0014454
544 Ga0466967_0032629
545 Ga0466967_0078460
546 Ga0495620_0075892
547 Ga0495665_0037755
548 Ga0495668_0000573
549 Ga0496100_0030100
550 Ga0496100_0350551
551 Ga0496101_0003945
552 Ga0496102_0000042
553 Ga0496102_0001298
554 Ga0496103_0000441
555 Ga0496104_0243248
556 Ga0496105_0007258
557 Ga0496105_0038846
558 Ga0496106_0120107
559 Ga0496108_0002821
560 Ga0496108_0043277
561 Ga0496108_0142855
562 Ga0496108_0451919
563 Ga0496109_0012517
564 Ga0496109_0086561
565 Ga0496109_0243205
566 Ga0496109_0372666
567 Ga0496109_0946787
568 Ga0496110_0148667
569 Ga0496110_0184539
570 Ga0496110_0234246
571 Ga0496111_0120503
572 Ga0496113_0014387
573 Ga0496114_0095270
574 Ga0496116_0000945
575 Ga0496117_0000339
576 Ga0496118_0000241
577 Ga0496119_0009027
578 Ga0496120_0032431
579 Ga0496121_0028028
580 Ga0496122_0092544
581 Ga0496123_0222543
582 Ga0496124_0018472
583 Ga0496125_0065297
584 Ga0496126_0001023
585 Ga0501317_005053
586 Ga0501318_001119
587 Ga0501032_0024244
588 Ga0501033_0234328
589 Ga0501033_0307430
590 Ga0501034_0017132
591 Ga0501036_0386227
592 Ga0501037_0198598
593 Ga0501043_0172498
594 Ga0501047_0350935
595 Ga0501070_0142734
596 Ga0501072_0589821
597 Ga0501076_0318843
598 Ga0501035_0000344
599 Ga0501044_0011255
600 Ga0501044_0116520
601 nmdc:mga03683_83965_c1
602 nmdc:mga03n38_34749_c1
603 nmdc:mga03n38_5390_c1
604 nmdc:mga00v17_44332_c1
605 nmdc:mga0yw44_14379_c1
606 nmdc:mga07m45_68546_c1
607 nmdc:mga09592_192920_c1
608 nmdc:mga0qj67_156437_c1
609 nmdc:mga08y16_660693_c1
610 nmdc:mga08x19_347327_c1
611 Ga0500559_0089310
612 Ga0466962_0101866
613 2523385875
614 2566993099
615 2623501999
616 2644486478
617 2738889938
618 2739203245
619 2739238683
620 2739362219
621 2753035276
622 2753323793
623 2816504681
624 2870726734
625 2889300954
626 2902840105
627 2904538907
628 2904770127
629 2904771024
630 2919424449
631 2919436842
632 2922556795
633 2939744475
634 3001122207
635 8054474328
636 8057573219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00636

Ribonuclease_3

Ribonuclease III domain

88

181

0.94

PF00035

dsrm

Double-stranded RNA binding motif

209

274

0.92

PF14622

Ribonucleas_3_3

Ribonuclease-III-like

64

196

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9984 3 149
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9581 3 144
2a11-assembly1.cif.gz_A-2 crystal structure of nuclease domain of ribonuclase iii from mycobacterium tuberculosis 0.9469 3 149
3n3w-assembly1.cif.gz_B 2.2 angstrom resolution crystal structure of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.946 1 144
3o2r-assembly2.cif.gz_D structural flexibility in region involved in dimer formation of nuclease domain of ribonuclase iii (rnc) from campylobacter jejuni 0.9061 3 144
ID Description Score Start End Superfamily
af_P9WH03_159_229_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9996 152 220 3.30.160.20
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9984 3 149 1.10.1520.10
af_P0A7Y0_4_147_1.10.1520.10 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9691 2 148 1.10.1520.10
af_P9WH03_159_229_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9579 152 220 3.30.160.20
2a11A00 Mainly Alpha;Orthogonal Bundle;Ribonuclease iii, N-terminal Endonuclease Domain; Chain A;Ribonuclease III domain 0.9469 3 149 1.10.1520.10
ID Description Score Start End GO Terms
AF-A0A0K8Q528-F1-model_v4 Ribonuclease 3 0.9972 2 141 GO:0003723
GO:0004525
GO:0005737
GO:0030422
AF-A0A6L6EC33-F1-model_v4 deleted 0.9903 17 137
AF-A0A358D5I6-F1-model_v4 Ribonuclease III 0.9862 2 135 GO:0003723
GO:0004525
GO:0005737
GO:0030422
AF-A0A286TD84-F1-model_v4 Rnc protein 0.9739 2 149 GO:0004525
GO:0006396
AF-S4HZQ5-F1-model_v4 deleted 0.9717 2 126

Map