F404609

General Info

Members Datasets Scaffolds Average Seq Length
318 172 636 118

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_13322739|Ga0157380_133227391
Length 138
Sequence MIAAVARAATTADVFNAVAEPRRREILEVLVGGERPVNDLVDVLGLAQPQVSKHLRVLREVGAVDVREDGRQRLYRLNGESLRPMHEWLKQFEQSWSERFEALDDVLETLEQEQRHAGGNEGDGEADDAVRDRDPDHP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
85 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
98 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
101 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
125 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
126 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.52
Nodule 0
Rhizoplane 6.29
Rhizosphere 90.25
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_13322739 3300014326 Bacteria 514
2 JGI25406J46586_10089377 3300003203 Bacteria 931
3 Ga0070658_11362816 3300005327 Bacteria 616
4 Ga0070683_100251320 3300005329 Bacteria 1681
5 Ga0070670_101323543 3300005331 Bacteria 660
6 Ga0070682_101621903 3300005337 Bacteria 560
7 Ga0070687_100131558 3300005343 Bacteria 1445
8 Ga0070669_100406706 3300005353 Bacteria 1115
9 Ga0070669_101328975 3300005353 Bacteria 623
10 Ga0070674_101794367 3300005356 Bacteria 556
11 Ga0070659_100507803 3300005366 Bacteria 1028
12 Ga0070709_10021991 3300005434 Bacteria 3724
13 Ga0070714_100085685 3300005435 Bacteria 2752
14 Ga0070714_100144694 3300005435 Bacteria 2137
15 Ga0070713_100058787 3300005436 Bacteria 3208
16 Ga0070713_100091794 3300005436 Bacteria 2613
17 Ga0070713_101028531 3300005436 Bacteria 795
18 Ga0070710_10046139 3300005437 Bacteria 2425
19 Ga0070710_10665889 3300005437 Bacteria 731
20 Ga0070711_100151230 3300005439 Bacteria 1750
21 Ga0070711_100871089 3300005439 Bacteria 767
22 Ga0070700_100338107 3300005441 Bacteria 1112
23 Ga0070663_101965948 3300005455 Bacteria 526
24 Ga0070678_100344960 3300005456 Bacteria 1279
25 Ga0070699_101061038 3300005518 Unclassified 743
26 Ga0070695_100284209 3300005545 Bacteria 1217
27 Ga0070693_100820033 3300005547 Bacteria 691
28 Ga0070693_101473629 3300005547 Bacteria 531
29 Ga0070665_100016276 3300005548 Bacteria 7462
30 Ga0070664_100158510 3300005564 Bacteria 2001
31 Ga0068857_100409402 3300005577 Bacteria 1263
32 Ga0068854_101897013 3300005578 Bacteria 548
33 Ga0070702_101057707 3300005615 Bacteria 646
34 Ga0068859_102604138 3300005617 Bacteria 556
35 Ga0068864_100184733 3300005618 Bacteria 1908
36 Ga0081455_10046674 3300005937 Bacteria 3756
37 Ga0081455_10070915 3300005937 Bacteria 2891
38 Ga0081455_10188434 3300005937 Bacteria 1556
39 Ga0081538_10004757 3300005981 Bacteria 12418
40 Ga0081538_10018563 3300005981 Bacteria 5215
41 Ga0081538_10037748 3300005981 Bacteria 3127
42 Ga0081538_10356932 3300005981 Bacteria 529
43 Ga0081540_1031890 3300005983 Bacteria 2886
44 Ga0081540_1093987 3300005983 Bacteria 1311
45 Ga0081539_10001821 3300005985 Bacteria 33639
46 Ga0081539_10004534 3300005985 Bacteria 15241
47 Ga0070717_10091005 3300006028 Bacteria 2575
48 Ga0075365_10106444 3300006038 Bacteria 1925
49 Ga0075364_10030389 3300006051 Bacteria 3467
50 Ga0075364_10629326 3300006051 Bacteria 733
51 Ga0075432_10013109 3300006058 Bacteria 2817
52 Ga0075432_10074702 3300006058 Bacteria 1221
53 Ga0070715_10000140 3300006163 Bacteria 16895
54 Ga0070716_100001358 3300006173 Bacteria 10851
55 Ga0075362_10048052 3300006177 Bacteria 1903
56 Ga0068871_100935028 3300006358 Bacteria 805
57 Ga0075428_100018653 3300006844 Bacteria 7669
58 Ga0075428_100207727 3300006844 Bacteria 2116
59 Ga0075428_100627624 3300006844 Bacteria 1147
60 Ga0075430_100013658 3300006846 Bacteria 6925
61 Ga0075430_100047069 3300006846 Bacteria 3641
62 Ga0075431_100001828 3300006847 Bacteria 20111
63 Ga0075431_100174757 3300006847 Bacteria 2206
64 Ga0075429_100016078 3300006880 Bacteria 6482
65 Ga0075429_100029581 3300006880 Bacteria 4757
66 Ga0097620_102604571 3300006931 Bacteria 556
67 Ga0111539_10022713 3300009094 Bacteria 7705
68 Ga0111539_10053097 3300009094 Bacteria 4824
69 Ga0111539_10103921 3300009094 Bacteria 3333
70 Ga0111539_10246416 3300009094 Bacteria 2080
71 Ga0105245_10728668 3300009098 Bacteria 1026
72 Ga0105245_11664902 3300009098 Bacteria 690
73 Ga0105245_11718394 3300009098 Bacteria 680
74 Ga0105247_10979841 3300009101 Bacteria 659
75 Ga0114129_10339947 3300009147 Bacteria 1991
76 Ga0114129_10436365 3300009147 Bacteria 1720
77 Ga0114129_10768071 3300009147 Bacteria 1232
78 Ga0105242_10451654 3300009176 Bacteria 1212
79 Ga0105242_11181387 3300009176 Bacteria 783
80 Ga0105239_10630710 3300010375 Bacteria 1223
81 Ga0163162_11181026 3300013306 Bacteria 868
82 Ga0157375_13244802 3300013308 Bacteria 542
83 Ga0163163_11607360 3300014325 Bacteria 711
84 Ga0163163_11701684 3300014325 Bacteria 691
85 Ga0157380_12019121 3300014326 Bacteria 639
86 Ga0157377_10281047 3300014745 Bacteria 1091
87 Ga0157379_11011473 3300014968 Bacteria 793
88 Ga0163161_11342279 3300017792 Bacteria 623
89 Ga0207692_10005549 3300025898 Bacteria 5062
90 Ga0207692_10312948 3300025898 Bacteria 959
91 Ga0207688_10046286 3300025901 Bacteria 2429
92 Ga0207685_10044640 3300025905 Bacteria 1677
93 Ga0207699_10015411 3300025906 Bacteria 3969
94 Ga0207643_10402554 3300025908 Bacteria 865
95 Ga0207693_10001823 3300025915 Bacteria 18689
96 Ga0207663_10047967 3300025916 Bacteria 2640
97 Ga0207663_10663700 3300025916 Bacteria 824
98 Ga0207662_10200938 3300025918 Bacteria 1290
99 Ga0207649_10725272 3300025920 Bacteria 772
100 Ga0207659_10448408 3300025926 Bacteria 1086
101 Ga0207687_10300688 3300025927 Bacteria 1292
102 Ga0207687_11615144 3300025927 Bacteria 556
103 Ga0207700_10001790 3300025928 Bacteria 12199
104 Ga0207700_10089800 3300025928 Bacteria 2423
105 Ga0207664_10001545 3300025929 Bacteria 15084
106 Ga0207686_10276898 3300025934 Bacteria 1237
107 Ga0207709_10252297 3300025935 Bacteria 1289
108 Ga0207665_10000820 3300025939 Bacteria 21046
109 Ga0207689_11649867 3300025942 Bacteria 532
110 Ga0207661_10256636 3300025944 Bacteria 1556
111 Ga0207661_10683855 3300025944 Bacteria 943
112 Ga0207679_10034438 3300025945 Bacteria 3573
113 Ga0207677_10276509 3300026023 Bacteria 1376
114 Ga0207677_11071186 3300026023 Bacteria 734
115 Ga0207677_11436105 3300026023 Bacteria 636
116 Ga0207702_10427726 3300026078 Bacteria 1281
117 Ga0207676_10725148 3300026095 Bacteria 965
118 Ga0207683_10025240 3300026121 Bacteria 5125
119 Ga0207698_12124466 3300026142 Bacteria 575
120 Ga0207428_10003848 3300027907 Bacteria 14396
121 Ga0207428_10013175 3300027907 Bacteria 7239
122 Ga0207428_10104716 3300027907 Bacteria 2183
123 Ga0268266_10012931 3300028379 Bacteria 7198
124 Ga0268266_10859527 3300028379 Bacteria 877
125 Ga0265334_10176940 3300028573 Bacteria 746
126 Ga0326468_10016205 3300031889 Bacteria 834
127 Ga0307406_10235201 3300031901 Bacteria 1371
128 Ga0307406_11566630 3300031901 Bacteria 581
129 Ga0307409_100191056 3300031995 Bacteria 1823
130 Ga0307409_102008204 3300031995 Bacteria 608
131 Ga0307416_100143683 3300032002 Bacteria 2174
132 Ga0307416_102896296 3300032002 Bacteria 574
133 Ga0307415_100586791 3300032126 Bacteria 989
134 Ga0395899_0015637 3300037312 Bacteria 5787
135 Ga0395899_0092453 3300037312 Bacteria 2191
136 Ga0395899_0161941 3300037312 Bacteria 1580
137 Ga0395900_0035185 3300037418 Bacteria 5159
138 Ga0395900_0039392 3300037418 Bacteria 4869
139 Ga0395900_0372939 3300037418 Bacteria 1396
140 Ga0395900_0388984 3300037418 Bacteria 1361
141 Ga0395898_0015283 3300037466 Bacteria 7876
142 Ga0395898_0029101 3300037466 Bacteria 5534
143 Ga0395898_0039219 3300037466 Bacteria 4689
144 Ga0395898_0297697 3300037466 Bacteria 1539
145 Ga0395905_0008903 3300037471 Bacteria 9860
146 Ga0395905_0335138 3300037471 Bacteria 1403
147 Ga0395901_0024817 3300038443 Bacteria 6153
148 Ga0395901_0114625 3300038443 Bacteria 2831
149 Ga0395901_0141289 3300038443 Bacteria 2530
150 Ga0436363_0383767 3300039450 Bacteria 892
151 Ga0436363_0651670 3300039450 Bacteria 630
152 Ga0439445_0219222 3300042004 Bacteria 564
153 Ga0439448_0100251 3300042005 Bacteria 984
154 Ga0439462_0099140 3300042015 Bacteria 802
155 Ga0439463_119106 3300042016 Bacteria 682
156 Ga0439434_0191352 3300042435 Bacteria 687
157 Ga0439460_0206164 3300042461 Bacteria 671
158 Ga0466969_0134334 3300044656 Bacteria 1146
159 Ga0466972_0376995 3300044658 Bacteria 664
160 Ga0466957_0656270 3300044842 Bacteria 738
161 Ga0466959_0492706 3300045049 Unclassified 829
162 Ga0466958_0073221 3300045836 Bacteria 2099
163 Ga0466958_0207152 3300045836 Bacteria 1249
164 Ga0466967_0315697 3300045976 Bacteria 1506
165 Ga0466967_0919067 3300045976 Bacteria 870
166 Ga0466967_1122197 3300045976 Bacteria 783
167 Ga0495608_0616805 3300046511 Unclassified 650
168 Ga0495643_0427836 3300046522 Bacteria 580
169 Ga0496100_0152006 3300048903 Bacteria 1652
170 Ga0496101_1326600 3300048904 Bacteria 562
171 Ga0496102_0012216 3300048905 Bacteria 7426
172 Ga0496102_0778144 3300048905 Bacteria 880
173 Ga0496103_0434542 3300048906 Bacteria 842
174 Ga0496104_0007238 3300048907 Bacteria 9793
175 Ga0496104_0317907 3300048907 Bacteria 1470
176 Ga0496105_0010961 3300048908 Bacteria 7142
177 Ga0496107_0314238 3300048910 Bacteria 1166
178 Ga0496108_0008555 3300048911 Bacteria 8300
179 Ga0496108_0428979 3300048911 Bacteria 1155
180 Ga0496108_1355705 3300048911 Bacteria 596
181 Ga0496109_1118445 3300048912 Bacteria 725
182 Ga0496110_0279876 3300048913 Bacteria 1519
183 Ga0496111_0972731 3300048914 Bacteria 609
184 Ga0496112_0003134 3300048915 Bacteria 13571
185 Ga0496112_0022451 3300048915 Bacteria 6014
186 Ga0496113_0016881 3300048916 Bacteria 5053
187 Ga0496114_0338010 3300048917 Archaea 1331
188 Ga0496115_0007053 3300048918 Bacteria 8254
189 Ga0496124_0118037 3300048927 Bacteria 2124
190 Ga0501031_0000263 3300049568 Bacteria 29643
191 Ga0501031_0117019 3300049568 Bacteria 1741
192 Ga0501032_0001481 3300049569 Bacteria 18719
193 Ga0501032_0248400 3300049569 Bacteria 1155
194 Ga0501033_0000208 3300049570 Bacteria 56046
195 Ga0501033_0025758 3300049570 Bacteria 4430
196 Ga0501034_0442356 3300049571 Bacteria 1218
197 Ga0501034_1698256 3300049571 Bacteria 504
198 Ga0501036_0000195 3300049572 Bacteria 40369
199 Ga0501036_0014871 3300049572 Bacteria 6493
200 Ga0501036_0213747 3300049572 Bacteria 1620
201 Ga0501036_0424466 3300049572 Bacteria 1108
202 Ga0501036_0565577 3300049572 Unclassified 944
203 Ga0501037_0000878 3300049573 Bacteria 22466
204 Ga0501037_0205709 3300049573 Bacteria 1389
205 Ga0501037_0800073 3300049573 Bacteria 622
206 Ga0501038_0001148 3300049574 Bacteria 23997
207 Ga0501038_0007906 3300049574 Bacteria 9804
208 Ga0501039_0000171 3300049575 Bacteria 45473
209 Ga0501039_0102335 3300049575 Bacteria 2236
210 Ga0501039_0369702 3300049575 Bacteria 1126
211 Ga0501039_0774745 3300049575 Bacteria 749
212 Ga0501039_1246813 3300049575 Bacteria 574
213 Ga0501039_1431588 3300049575 Unclassified 532
214 Ga0501040_0000094 3300049576 Bacteria 44554
215 Ga0501040_0320034 3300049576 Bacteria 1109
216 Ga0501040_0400139 3300049576 Bacteria 986
217 Ga0501040_0691686 3300049576 Bacteria 737
218 Ga0501041_0006403 3300049577 Bacteria 6890
219 Ga0501041_0230556 3300049577 Bacteria 1163
220 Ga0501041_0306163 3300049577 Bacteria 1001
221 Ga0501042_0000315 3300049578 Bacteria 24225
222 Ga0501042_1296004 3300049578 Bacteria 531
223 Ga0501043_0000295 3300049579 Bacteria 45082
224 Ga0501043_0374801 3300049579 Bacteria 1078
225 Ga0501046_0010625 3300049580 Bacteria 7898
226 Ga0501046_0012978 3300049580 Bacteria 7075
227 Ga0501046_0272775 3300049580 Bacteria 1240
228 Ga0501047_0001126 3300049581 Bacteria 26549
229 Ga0501048_0001207 3300049582 Bacteria 19578
230 Ga0501048_0010587 3300049582 Bacteria 6881
231 Ga0501048_0013351 3300049582 Bacteria 6096
232 Ga0501048_0056682 3300049582 Bacteria 2779
233 Ga0501048_0909901 3300049582 Bacteria 633
234 Ga0501048_1009673 3300049582 Bacteria 598
235 Ga0501067_0026109 3300049583 Bacteria 3237
236 Ga0501068_0000052 3300049584 Bacteria 45484
237 Ga0501068_0062440 3300049584 Bacteria 2265
238 Ga0501069_0006120 3300049585 Bacteria 6282
239 Ga0501069_0072085 3300049585 Bacteria 1936
240 Ga0501070_0007329 3300049586 Bacteria 9365
241 Ga0501070_0030937 3300049586 Bacteria 4483
242 Ga0501070_0595895 3300049586 Bacteria 881
243 Ga0501071_0001321 3300049587 Bacteria 14134
244 Ga0501071_0051052 3300049587 Bacteria 2979
245 Ga0501071_0112442 3300049587 Bacteria 2014
246 Ga0501071_0568709 3300049587 Bacteria 871
247 Ga0501072_0000942 3300049588 Bacteria 21417
248 Ga0501072_0313163 3300049588 Bacteria 1247
249 Ga0501073_0001135 3300049589 Bacteria 19358
250 Ga0501073_0013849 3300049589 Bacteria 5864
251 Ga0501073_0359240 3300049589 Bacteria 1006
252 Ga0501074_0000118 3300049590 Bacteria 40043
253 Ga0501074_0021310 3300049590 Bacteria 4706
254 Ga0501074_0034636 3300049590 Bacteria 3660
255 Ga0501074_0382318 3300049590 Bacteria 999
256 Ga0501074_0482017 3300049590 Bacteria 879
257 Ga0501075_0000109 3300049591 Bacteria 38985
258 Ga0501075_0230449 3300049591 Bacteria 1412
259 Ga0501075_0316087 3300049591 Bacteria 1190
260 Ga0501076_0001616 3300049592 Bacteria 15195
261 Ga0501076_0209955 3300049592 Bacteria 1591
262 Ga0501076_0267969 3300049592 Bacteria 1398
263 Ga0501076_0457338 3300049592 Bacteria 1051
264 Ga0501076_0528966 3300049592 Bacteria 972
265 Ga0501077_0007186 3300049593 Bacteria 6866
266 Ga0501077_1053614 3300049593 Unclassified 523
267 Ga0501079_0000099 3300049741 Bacteria 43513
268 Ga0501079_0611653 3300049741 Bacteria 857
269 Ga0501079_0740119 3300049741 Unclassified 774
270 Ga0501080_0000768 3300049742 Bacteria 26067
271 Ga0501080_0019823 3300049742 Bacteria 6226
272 Ga0501081_0000839 3300049743 Bacteria 18170
273 Ga0501081_0156540 3300049743 Bacteria 1640
274 Ga0501081_0186675 3300049743 Bacteria 1500
275 Ga0501081_0631544 3300049743 Bacteria 802
276 Ga0501081_1209344 3300049743 Bacteria 572
277 Ga0501083_0000227 3300049744 Bacteria 36195
278 Ga0501083_0020854 3300049744 Bacteria 4555
279 Ga0501083_0045121 3300049744 Bacteria 2982
280 Ga0501035_0001709 3300049822 Bacteria 22177
281 Ga0501044_0000984 3300049823 Bacteria 34240
282 Ga0501044_0007437 3300049823 Bacteria 12045
283 Ga0501044_0867698 3300049823 Bacteria 779
284 Ga0501045_0009252 3300049824 Bacteria 6890
285 Ga0501045_0140166 3300049824 Bacteria 1798
286 Ga0501045_0178403 3300049824 Bacteria 1582
287 Ga0501045_0587325 3300049824 Bacteria 825
288 nmdc:mga03683_266835_c1 3300050489 Bacteria 798
289 nmdc:mga00v17_121425_c1 3300050491 Bacteria 1664
290 nmdc:mga0yw44_52923_c1 3300050492 Bacteria 2463
291 nmdc:mga0yw44_84958_c1 3300050492 Bacteria 1577
292 nmdc:mga05p37_608902_c1 3300050507 Bacteria 1232
293 nmdc:mga09592_12562_c1 3300050508 Bacteria 6900
294 nmdc:mga09592_67112_c1 3300050508 Bacteria 3042
295 nmdc:mga0qj67_39719_c1 3300050509 Bacteria 3697
296 nmdc:mga0qj67_8890_c1 3300050509 Bacteria 7452
297 nmdc:mga06r32_17560_c1 3300050510 Bacteria 6533
298 nmdc:mga06r32_22448_c1 3300050510 Bacteria 5835
299 nmdc:mga06r32_428005_c1 3300050510 Bacteria 1304
300 nmdc:mga08y16_26033_c1 3300050511 Bacteria 6170
301 nmdc:mga08y16_71787_c1 3300050511 Bacteria 3608
302 nmdc:mga08y16_82903_c1 3300050511 Bacteria 3343
303 Ga0501084_0010624 3300054114 Bacteria 7617
304 Ga0501084_0364084 3300054114 Bacteria 1222
305 Ga0501084_0438989 3300054114 Bacteria 1103
306 Ga0590071_009882 3300059421 Bacteria 2237
307 Ga0590077_033627 3300059426 Bacteria 1125
308 Ga0501082_0000563 3300060353 Bacteria 32925
309 Ga0501082_0123879 3300060353 Bacteria 2241
310 Ga0501082_0257680 3300060353 Bacteria 1517
311 Ga0501082_0403760 3300060353 Bacteria 1192
312 Ga0501082_0574358 3300060353 Bacteria 986
313 Ga0466962_0504417 3300061719 Bacteria 612
314 Ga0530510_0001857 3300061734 Bacteria 14439
315 Ga0530510_0062689 3300061734 Bacteria 2691
316 Ga0530510_0379047 3300061734 Bacteria 1064
317 Ga0530510_0386564 3300061734 Bacteria 1054
318 Ga0530510_0796872 3300061734 Bacteria 721
319 Ga0157380_13322739
320 JGI25406J46586_10089377
321 Ga0070658_11362816
322 Ga0070683_100251320
323 Ga0070670_101323543
324 Ga0070682_101621903
325 Ga0070687_100131558
326 Ga0070669_100406706
327 Ga0070669_101328975
328 Ga0070674_101794367
329 Ga0070659_100507803
330 Ga0070709_10021991
331 Ga0070714_100085685
332 Ga0070714_100144694
333 Ga0070713_100058787
334 Ga0070713_100091794
335 Ga0070713_101028531
336 Ga0070710_10046139
337 Ga0070710_10665889
338 Ga0070711_100151230
339 Ga0070711_100871089
340 Ga0070700_100338107
341 Ga0070663_101965948
342 Ga0070678_100344960
343 Ga0070699_101061038
344 Ga0070695_100284209
345 Ga0070693_100820033
346 Ga0070693_101473629
347 Ga0070665_100016276
348 Ga0070664_100158510
349 Ga0068857_100409402
350 Ga0068854_101897013
351 Ga0070702_101057707
352 Ga0068859_102604138
353 Ga0068864_100184733
354 Ga0081455_10046674
355 Ga0081455_10070915
356 Ga0081455_10188434
357 Ga0081538_10004757
358 Ga0081538_10018563
359 Ga0081538_10037748
360 Ga0081538_10356932
361 Ga0081540_1031890
362 Ga0081540_1093987
363 Ga0081539_10001821
364 Ga0081539_10004534
365 Ga0070717_10091005
366 Ga0075365_10106444
367 Ga0075364_10030389
368 Ga0075364_10629326
369 Ga0075432_10013109
370 Ga0075432_10074702
371 Ga0070715_10000140
372 Ga0070716_100001358
373 Ga0075362_10048052
374 Ga0068871_100935028
375 Ga0075428_100018653
376 Ga0075428_100207727
377 Ga0075428_100627624
378 Ga0075430_100013658
379 Ga0075430_100047069
380 Ga0075431_100001828
381 Ga0075431_100174757
382 Ga0075429_100016078
383 Ga0075429_100029581
384 Ga0097620_102604571
385 Ga0111539_10022713
386 Ga0111539_10053097
387 Ga0111539_10103921
388 Ga0111539_10246416
389 Ga0105245_10728668
390 Ga0105245_11664902
391 Ga0105245_11718394
392 Ga0105247_10979841
393 Ga0114129_10339947
394 Ga0114129_10436365
395 Ga0114129_10768071
396 Ga0105242_10451654
397 Ga0105242_11181387
398 Ga0105239_10630710
399 Ga0163162_11181026
400 Ga0157375_13244802
401 Ga0163163_11607360
402 Ga0163163_11701684
403 Ga0157380_12019121
404 Ga0157377_10281047
405 Ga0157379_11011473
406 Ga0163161_11342279
407 Ga0207692_10005549
408 Ga0207692_10312948
409 Ga0207688_10046286
410 Ga0207685_10044640
411 Ga0207699_10015411
412 Ga0207643_10402554
413 Ga0207693_10001823
414 Ga0207663_10047967
415 Ga0207663_10663700
416 Ga0207662_10200938
417 Ga0207649_10725272
418 Ga0207659_10448408
419 Ga0207687_10300688
420 Ga0207687_11615144
421 Ga0207700_10001790
422 Ga0207700_10089800
423 Ga0207664_10001545
424 Ga0207686_10276898
425 Ga0207709_10252297
426 Ga0207665_10000820
427 Ga0207689_11649867
428 Ga0207661_10256636
429 Ga0207661_10683855
430 Ga0207679_10034438
431 Ga0207677_10276509
432 Ga0207677_11071186
433 Ga0207677_11436105
434 Ga0207702_10427726
435 Ga0207676_10725148
436 Ga0207683_10025240
437 Ga0207698_12124466
438 Ga0207428_10003848
439 Ga0207428_10013175
440 Ga0207428_10104716
441 Ga0268266_10012931
442 Ga0268266_10859527
443 Ga0265334_10176940
444 Ga0326468_10016205
445 Ga0307406_10235201
446 Ga0307406_11566630
447 Ga0307409_100191056
448 Ga0307409_102008204
449 Ga0307416_100143683
450 Ga0307416_102896296
451 Ga0307415_100586791
452 Ga0395899_0015637
453 Ga0395899_0092453
454 Ga0395899_0161941
455 Ga0395900_0035185
456 Ga0395900_0039392
457 Ga0395900_0372939
458 Ga0395900_0388984
459 Ga0395898_0015283
460 Ga0395898_0029101
461 Ga0395898_0039219
462 Ga0395898_0297697
463 Ga0395905_0008903
464 Ga0395905_0335138
465 Ga0395901_0024817
466 Ga0395901_0114625
467 Ga0395901_0141289
468 Ga0436363_0383767
469 Ga0436363_0651670
470 Ga0439445_0219222
471 Ga0439448_0100251
472 Ga0439462_0099140
473 Ga0439463_119106
474 Ga0439434_0191352
475 Ga0439460_0206164
476 Ga0466969_0134334
477 Ga0466972_0376995
478 Ga0466957_0656270
479 Ga0466959_0492706
480 Ga0466958_0073221
481 Ga0466958_0207152
482 Ga0466967_0315697
483 Ga0466967_0919067
484 Ga0466967_1122197
485 Ga0495608_0616805
486 Ga0495643_0427836
487 Ga0496100_0152006
488 Ga0496101_1326600
489 Ga0496102_0012216
490 Ga0496102_0778144
491 Ga0496103_0434542
492 Ga0496104_0007238
493 Ga0496104_0317907
494 Ga0496105_0010961
495 Ga0496107_0314238
496 Ga0496108_0008555
497 Ga0496108_0428979
498 Ga0496108_1355705
499 Ga0496109_1118445
500 Ga0496110_0279876
501 Ga0496111_0972731
502 Ga0496112_0003134
503 Ga0496112_0022451
504 Ga0496113_0016881
505 Ga0496114_0338010
506 Ga0496115_0007053
507 Ga0496124_0118037
508 Ga0501031_0000263
509 Ga0501031_0117019
510 Ga0501032_0001481
511 Ga0501032_0248400
512 Ga0501033_0000208
513 Ga0501033_0025758
514 Ga0501034_0442356
515 Ga0501034_1698256
516 Ga0501036_0000195
517 Ga0501036_0014871
518 Ga0501036_0213747
519 Ga0501036_0424466
520 Ga0501036_0565577
521 Ga0501037_0000878
522 Ga0501037_0205709
523 Ga0501037_0800073
524 Ga0501038_0001148
525 Ga0501038_0007906
526 Ga0501039_0000171
527 Ga0501039_0102335
528 Ga0501039_0369702
529 Ga0501039_0774745
530 Ga0501039_1246813
531 Ga0501039_1431588
532 Ga0501040_0000094
533 Ga0501040_0320034
534 Ga0501040_0400139
535 Ga0501040_0691686
536 Ga0501041_0006403
537 Ga0501041_0230556
538 Ga0501041_0306163
539 Ga0501042_0000315
540 Ga0501042_1296004
541 Ga0501043_0000295
542 Ga0501043_0374801
543 Ga0501046_0010625
544 Ga0501046_0012978
545 Ga0501046_0272775
546 Ga0501047_0001126
547 Ga0501048_0001207
548 Ga0501048_0010587
549 Ga0501048_0013351
550 Ga0501048_0056682
551 Ga0501048_0909901
552 Ga0501048_1009673
553 Ga0501067_0026109
554 Ga0501068_0000052
555 Ga0501068_0062440
556 Ga0501069_0006120
557 Ga0501069_0072085
558 Ga0501070_0007329
559 Ga0501070_0030937
560 Ga0501070_0595895
561 Ga0501071_0001321
562 Ga0501071_0051052
563 Ga0501071_0112442
564 Ga0501071_0568709
565 Ga0501072_0000942
566 Ga0501072_0313163
567 Ga0501073_0001135
568 Ga0501073_0013849
569 Ga0501073_0359240
570 Ga0501074_0000118
571 Ga0501074_0021310
572 Ga0501074_0034636
573 Ga0501074_0382318
574 Ga0501074_0482017
575 Ga0501075_0000109
576 Ga0501075_0230449
577 Ga0501075_0316087
578 Ga0501076_0001616
579 Ga0501076_0209955
580 Ga0501076_0267969
581 Ga0501076_0457338
582 Ga0501076_0528966
583 Ga0501077_0007186
584 Ga0501077_1053614
585 Ga0501079_0000099
586 Ga0501079_0611653
587 Ga0501079_0740119
588 Ga0501080_0000768
589 Ga0501080_0019823
590 Ga0501081_0000839
591 Ga0501081_0156540
592 Ga0501081_0186675
593 Ga0501081_0631544
594 Ga0501081_1209344
595 Ga0501083_0000227
596 Ga0501083_0020854
597 Ga0501083_0045121
598 Ga0501035_0001709
599 Ga0501044_0000984
600 Ga0501044_0007437
601 Ga0501044_0867698
602 Ga0501045_0009252
603 Ga0501045_0140166
604 Ga0501045_0178403
605 Ga0501045_0587325
606 nmdc:mga03683_266835_c1
607 nmdc:mga00v17_121425_c1
608 nmdc:mga0yw44_52923_c1
609 nmdc:mga0yw44_84958_c1
610 nmdc:mga05p37_608902_c1
611 nmdc:mga09592_12562_c1
612 nmdc:mga09592_67112_c1
613 nmdc:mga0qj67_39719_c1
614 nmdc:mga0qj67_8890_c1
615 nmdc:mga06r32_17560_c1
616 nmdc:mga06r32_22448_c1
617 nmdc:mga06r32_428005_c1
618 nmdc:mga08y16_26033_c1
619 nmdc:mga08y16_71787_c1
620 nmdc:mga08y16_82903_c1
621 Ga0501084_0010624
622 Ga0501084_0364084
623 Ga0501084_0438989
624 Ga0590071_009882
625 Ga0590077_033627
626 Ga0501082_0000563
627 Ga0501082_0123879
628 Ga0501082_0257680
629 Ga0501082_0403760
630 Ga0501082_0574358
631 Ga0466962_0504417
632 Ga0530510_0001857
633 Ga0530510_0062689
634 Ga0530510_0379047
635 Ga0530510_0386564
636 Ga0530510_0796872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

18

67

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

20

66

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.958 18 74
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9512 8 78
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9438 18 73
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9414 19 74
7wqu-assembly1.cif.gz_B feoc from klebsiella pneumoniae 0.9405 19 74
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9761 17 72 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.969 8 81 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.958 18 74 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9505 12 73 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9478 14 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2M7WM41-F1-model_v4 Transcriptional regulator 0.9865 8 79 GO:0003700
AF-A0A838CQM3-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9809 8 79 GO:0003677
GO:0003700
AF-A0A841HZ84-F1-model_v4 HTH arsR-type domain-containing protein 0.9806 8 80 GO:0003700
AF-A0A6N6SY99-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9727 8 74 GO:0003700
AF-A0A0J6WSI4-F1-model_v4 Argininosuccinate lyase 0.9721 6 74 GO:0003700
GO:0016829
GO:0046685

Map