F404565

General Info

Members Datasets Scaffolds Average Seq Length
318 244 636 338

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100138852|Ga0075435_1001388522
Length 389
Sequence MYGAQNDTRQLLRGKWMVVCLLPMEWTPRLVSASMCQSGDVCSPLTEGASDMEINAVGIDLAKSVFQVHCVDRRGRVVLMRQLKRAQVTSFFARLMPCVIGMEACSSAHHWARKLQALGHTVRLIAPQFVKPYVKSNKNDVADAEAICEALQRPGMRFVAVKTVEQQALLSLHRARQGFVKARTAQANQIRGLLSEYGLVMPQGIGHIAKRVPELIEDGSNDLPGMFRALINRLLGHLKVLDEQIAQLERQIRAWHRDSELSRKLEQIPGIGPLGASAFVASVGDAQSFANGRQVAAWLGLVPRQRSSGGKPTLLGISKRGDSYLRTLLIHGARAVIRAAQRKHQHSGWLHELLKRRNPNVAAVALANKNARIAWALLAHDRPYATLAT

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
124 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
125 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
126 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
130 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
234 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
237 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
238 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
239 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
240 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
241 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
242 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
243 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
244 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0.63
Rhizoplane 6.6
Rhizosphere 78.93
Stem 0
Stem Tuber 0
Unclassified 1.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100138852 3300007076 Bacteria 2038
2 SwRhRL2b_contig_38539 2162886007 Bacteria 1779
3 LJNas_1002621 3300000546 Bacteria 2145
4 LJNas_1002775 3300000546 Bacteria 2072
5 JGI24735J21928_10031026 3300002067 Bacteria 1585
6 JGI25406J46586_10051014 3300003203 Bacteria 1387
7 rootH1_10006679 3300003323 Bacteria 27659
8 rootH1_10015157 3300003323 Bacteria 9589
9 rootH1_10015158 3300003323 Bacteria 3436
10 JGI25160J50197_1011065 3300003354 Bacteria 3222
11 Ga0065704_10110753 3300005289 Bacteria 1973
12 Ga0070658_10163343 3300005327 Bacteria 1869
13 Ga0070677_10058241 3300005333 Bacteria 1586
14 Ga0070680_100105584 3300005336 Bacteria 2341
15 Ga0070660_100230001 3300005339 Bacteria 1509
16 Ga0070660_100269841 3300005339 Bacteria 1391
17 Ga0070661_100143696 3300005344 Bacteria 1799
18 Ga0070668_100228538 3300005347 Bacteria 1537
19 Ga0070671_100316435 3300005355 Bacteria 1330
20 Ga0070674_100018810 3300005356 Bacteria 4376
21 Ga0070674_100247701 3300005356 Bacteria 1398
22 Ga0070674_100253658 3300005356 Bacteria 1383
23 Ga0070674_100364559 3300005356 Bacteria 1171
24 Ga0070673_100287797 3300005364 Bacteria 1443
25 Ga0070659_100052525 3300005366 Bacteria 3206
26 Ga0070709_10053259 3300005434 Bacteria 2547
27 Ga0070711_100219914 3300005439 Bacteria 1476
28 Ga0070700_100206809 3300005441 Unclassified 1382
29 Ga0070663_100192350 3300005455 Bacteria 1588
30 Ga0070678_100063632 3300005456 Bacteria 2730
31 Ga0070678_100237858 3300005456 Bacteria 1521
32 Ga0068867_100115271 3300005459 Bacteria 2069
33 Ga0070685_10129826 3300005466 Bacteria 1574
34 Ga0070679_100246234 3300005530 Bacteria 1744
35 Ga0070697_100332974 3300005536 Bacteria 1309
36 Ga0070672_100162727 3300005543 Bacteria 1852
37 Ga0070665_100289935 3300005548 Bacteria 1639
38 Ga0070665_100298937 3300005548 Bacteria 1612
39 Ga0068855_100011937 3300005563 Bacteria 10503
40 Ga0070664_100043488 3300005564 Bacteria 3790
41 Ga0070664_100113713 3300005564 Bacteria 2364
42 Ga0068852_100083317 3300005616 Bacteria 2843
43 Ga0068858_100079417 3300005842 Bacteria 3049
44 Ga0081455_10069645 3300005937 Unclassified 2924
45 Ga0081539_10110271 3300005985 Bacteria 1387
46 Ga0075432_10015708 3300006058 Bacteria 2583
47 Ga0070715_10080420 3300006163 Bacteria 1478
48 Ga0075367_10063926 3300006178 Bacteria 2201
49 Ga0075366_10066558 3300006195 Bacteria 2144
50 Ga0097621_100058955 3300006237 Bacteria 3142
51 Ga0097621_100153120 3300006237 Bacteria 1978
52 Ga0075370_10080125 3300006353 Bacteria 1876
53 Ga0075428_100202694 3300006844 Bacteria 2144
54 Ga0075428_100356976 3300006844 Bacteria 1568
55 Ga0075430_100373713 3300006846 Bacteria 1177
56 Ga0075431_100191690 3300006847 Bacteria 2094
57 Ga0075434_100149262 3300006871 Bacteria 2358
58 Ga0075429_100266372 3300006880 Bacteria 1500
59 Ga0099794_10035505 3300007265 Bacteria 2353
60 Ga0105251_10016365 3300009011 Bacteria 4010
61 Ga0105251_10063027 3300009011 Bacteria 1740
62 Ga0105240_10023883 3300009093 Bacteria 8075
63 Ga0111539_10292443 3300009094 Bacteria 1896
64 Ga0111539_10850457 3300009094 Bacteria 1061
65 Ga0105245_10284151 3300009098 Bacteria 1618
66 Ga0114129_10336193 3300009147 Bacteria 2004
67 Ga0114129_10522260 3300009147 Bacteria 1548
68 Ga0105238_10209855 3300009551 Bacteria 1923
69 Ga0105238_10422303 3300009551 Bacteria 1328
70 Ga0157371_10186112 3300013102 Bacteria 1486
71 Ga0157369_10037488 3300013105 Bacteria 5308
72 Ga0157369_10070244 3300013105 Bacteria 3763
73 Ga0163162_10369777 3300013306 Bacteria 1567
74 Ga0157372_10385883 3300013307 Bacteria 1632
75 Ga0157375_10257860 3300013308 Bacteria 1905
76 Ga0157375_10314098 3300013308 Bacteria 1731
77 Ga0163163_10291906 3300014325 Bacteria 1683
78 Ga0157380_10129239 3300014326 Bacteria 2153
79 Ga0182008_10057890 3300014497 Bacteria 1913
80 Ga0157379_10308977 3300014968 Bacteria 1442
81 Ga0157376_10386272 3300014969 Bacteria 1350
82 Ga0163161_10127129 3300017792 Bacteria 1920
83 Ga0213875_10146198 3300021388 Unclassified 1107
84 Ga0209565_1017507 3300025263 Bacteria 1569
85 Ga0209673_1007637 3300025273 Bacteria 4939
86 Ga0207426_1004790 3300025302 Bacteria 6431
87 Ga0209051_1017615 3300025303 Bacteria 3188
88 Ga0207682_10048345 3300025893 Bacteria 1753
89 Ga0207688_10153577 3300025901 Bacteria 1361
90 Ga0207680_10023823 3300025903 Bacteria 3349
91 Ga0207685_10037637 3300025905 Bacteria 1783
92 Ga0207705_10205992 3300025909 Bacteria 1491
93 Ga0207695_10091145 3300025913 Bacteria 3063
94 Ga0207695_10220369 3300025913 Bacteria 1805
95 Ga0207663_10180078 3300025916 Bacteria 1508
96 Ga0207660_10025054 3300025917 Bacteria 4046
97 Ga0207657_10106876 3300025919 Bacteria 2315
98 Ga0207657_10216454 3300025919 Bacteria 1536
99 Ga0207649_10190067 3300025920 Bacteria 1443
100 Ga0207652_10148095 3300025921 Bacteria 2101
101 Ga0207681_10203431 3300025923 Bacteria 1522
102 Ga0207694_10033258 3300025924 Bacteria 3950
103 Ga0207687_10202085 3300025927 Bacteria 1554
104 Ga0207700_10313486 3300025928 Bacteria 1358
105 Ga0207690_10102093 3300025932 Bacteria 2050
106 Ga0207706_10245472 3300025933 Bacteria 1565
107 Ga0207669_10124072 3300025937 Bacteria 1760
108 Ga0207669_10129965 3300025937 Bacteria 1728
109 Ga0207691_10061113 3300025940 Bacteria 3423
110 Ga0207679_10001312 3300025945 Bacteria 15712
111 Ga0207679_10055823 3300025945 Bacteria 2913
112 Ga0207651_10159041 3300025960 Bacteria 1769
113 Ga0207668_10201746 3300025972 Bacteria 1584
114 Ga0207668_10259724 3300025972 Bacteria 1415
115 Ga0207658_10110309 3300025986 Bacteria 2173
116 Ga0207703_10272809 3300026035 Bacteria 1533
117 Ga0207708_10224385 3300026075 Bacteria 1507
118 Ga0207675_100327159 3300026118 Bacteria 1498
119 Ga0207683_10212497 3300026121 Bacteria 1761
120 Ga0207428_10127776 3300027907 Bacteria 1946
121 Ga0268266_10248254 3300028379 Bacteria 1645
122 Ga0268264_10178105 3300028381 Bacteria 1929
123 Ga0268264_10389322 3300028381 Bacteria 1337
124 Ga0265318_10047175 3300028577 Bacteria 1625
125 Ga0307517_10063260 3300028786 Bacteria 3463
126 Ga0307515_10198614 3300028794 Bacteria 1889
127 Ga0265338_10288755 3300028800 Bacteria 1196
128 Ga0316183_1011968 3300030742 Bacteria 2322
129 Ga0265328_10042479 3300031239 Bacteria 1673
130 Ga0265331_10001761 3300031250 Bacteria 15546
131 Ga0265327_10003097 3300031251 Bacteria 16409
132 Ga0265327_10065125 3300031251 Bacteria 1844
133 Ga0265316_10007260 3300031344 Bacteria 10461
134 Ga0265316_10101902 3300031344 Bacteria 2181
135 Ga0307408_100017231 3300031548 Bacteria 4833
136 Ga0265314_10010883 3300031711 Bacteria 7561
137 Ga0307405_10194588 3300031731 Bacteria 1467
138 Ga0307413_10135038 3300031824 Bacteria 1695
139 Ga0307410_10235552 3300031852 Bacteria 1416
140 Ga0307406_10065751 3300031901 Bacteria 2357
141 Ga0307416_100106740 3300032002 Bacteria 2455
142 Ga0307416_100364060 3300032002 Bacteria 1469
143 Ga0373956_0063048 3300035119 Bacteria 1680
144 Ga0373957_0081285 3300035120 Bacteria 1279
145 Ga0316574_0144320 3300035398 Bacteria 1534
146 Ga0316574_0162618 3300035398 Bacteria 1437
147 Ga0316574_0220866 3300035398 Bacteria 1214
148 Ga0373933_0146867 3300035724 Bacteria 1491
149 Ga0373937_0303062 3300036401 Bacteria 1510
150 Ga0395905_0105399 3300037471 Bacteria 2647
151 Ga0395905_0267433 3300037471 Bacteria 1595
152 Ga0436364_0547634 3300037853 Bacteria 1887
153 Ga0400488_35356 3300038741 Bacteria 3205
154 Ga0400486_02625 3300038742 Bacteria 1919
155 Ga0400483_065893 3300039062 Bacteria 1622
156 Ga0400483_191666 3300039062 Bacteria 2543
157 Ga0400483_215847 3300039062 Bacteria 1674
158 Ga0400487_20654 3300039110 Unclassified 2100
159 Ga0436361_1063914 3300039447 Bacteria 1411
160 Ga0436362_0352878 3300039453 Bacteria 1563
161 Ga0439465_0053354 3300041413 Bacteria 1328
162 Ga0439432_044302 3300042006 Bacteria 1401
163 Ga0439440_0013840 3300042993 Bacteria 1736
164 Ga0466961_0019237 3300044693 Bacteria 4395
165 Ga0466968_0027526 3300044735 Unclassified 2341
166 Ga0451576_0086436 3300045051 Bacteria 3261
167 Ga0451576_0258631 3300045051 Bacteria 1819
168 Ga0495592_0227222 3300046454 Bacteria 1244
169 Ga0495603_0118465 3300046455 Bacteria 1543
170 Ga0495591_009376 3300046458 Bacteria 3899
171 Ga0495629_0041856 3300046459 Bacteria 3220
172 Ga0495638_0005598 3300046460 Bacteria 9285
173 Ga0495651_0110475 3300046462 Bacteria 2033
174 Ga0495653_0016598 3300046463 Bacteria 5994
175 Ga0495653_0024418 3300046463 Bacteria 4872
176 Ga0495653_0106954 3300046463 Bacteria 2016
177 Ga0495580_0208164 3300046472 Bacteria 1346
178 Ga0495580_0229230 3300046472 Bacteria 1275
179 Ga0495580_0240807 3300046472 Bacteria 1240
180 Ga0495582_0053204 3300046473 Bacteria 2233
181 Ga0495605_0018084 3300046474 Bacteria 3785
182 Ga0495584_0150566 3300046491 Bacteria 1182
183 Ga0495585_0110598 3300046492 Bacteria 1461
184 Ga0495594_0161373 3300046499 Bacteria 1274
185 Ga0495596_0013478 3300046500 Bacteria 3467
186 Ga0495607_0049379 3300046501 Bacteria 2454
187 Ga0495583_0063514 3300046506 Bacteria 1640
188 Ga0495606_0036223 3300046507 Bacteria 3363
189 Ga0495606_0130199 3300046507 Bacteria 1496
190 Ga0495608_0038629 3300046511 Bacteria 3204
191 Ga0495616_0060654 3300046513 Bacteria 1857
192 Ga0495618_0029061 3300046514 Bacteria 3447
193 Ga0495620_0015508 3300046515 Bacteria 3845
194 Ga0495628_0009958 3300046516 Bacteria 8090
195 Ga0495630_0063773 3300046517 Bacteria 2768
196 Ga0495632_0106140 3300046519 Bacteria 1321
197 Ga0495637_0027649 3300046520 Bacteria 2535
198 Ga0495643_0082558 3300046522 Bacteria 1669
199 Ga0495644_0058757 3300046523 Bacteria 1445
200 Ga0495648_0108396 3300046524 Bacteria 1516
201 Ga0495652_0030825 3300046529 Bacteria 4699
202 Ga0495665_0042387 3300046531 Bacteria 2422
203 Ga0495586_0031015 3300046535 Bacteria 2862
204 Ga0495633_0032844 3300046558 Bacteria 2505
205 Ga0495668_0102697 3300046616 Bacteria 1564
206 Ga0495661_0125690 3300046665 Bacteria 1411
207 Ga0495588_0006150 3300046674 Bacteria 5391
208 Ga0495588_0090652 3300046674 Bacteria 1601
209 Ga0495657_0060420 3300046675 Bacteria 2511
210 Ga0495599_0178539 3300046678 Bacteria 1309
211 Ga0495623_0031659 3300046679 Bacteria 3400
212 Ga0495623_0062506 3300046679 Bacteria 2333
213 Ga0495646_0056548 3300046680 Bacteria 2352
214 Ga0495613_0280644 3300046689 Bacteria 1157
215 Ga0495624_0021793 3300046690 Bacteria 4245
216 Ga0495624_0028474 3300046690 Bacteria 3651
217 Ga0495624_0136813 3300046690 Bacteria 1501
218 Ga0495670_0072242 3300046691 Bacteria 1747
219 Ga0495671_0080267 3300046692 Bacteria 1598
220 Ga0495671_0114943 3300046692 Bacteria 1314
221 Ga0495649_0034560 3300046694 Bacteria 2781
222 Ga0495649_0055531 3300046694 Bacteria 2139
223 Ga0495649_0101798 3300046694 Bacteria 1526
224 Ga0495600_0094873 3300046809 Bacteria 1945
225 Ga0495660_0059551 3300046810 Bacteria 2053
226 Ga0495581_0156369 3300047315 Bacteria 1332
227 Ga0495604_0108205 3300047317 Bacteria 2031
228 Ga0495636_0041028 3300047318 Bacteria 1920
229 Ga0495674_0166194 3300047319 Bacteria 1843
230 Ga0495674_0241165 3300047319 Bacteria 1489
231 Ga0495672_0094833 3300047320 Bacteria 1630
232 Ga0495676_0086861 3300047321 Bacteria 2352
233 Ga0495680_0043581 3300047322 Bacteria 3551
234 Ga0495680_0052113 3300047322 Bacteria 3191
235 Ga0495680_0203137 3300047322 Bacteria 1421
236 Ga0495683_0013505 3300047323 Bacteria 4270
237 Ga0495683_0081531 3300047323 Bacteria 1577
238 Ga0495675_0039874 3300047444 Bacteria 2992
239 Ga0495679_000115 3300047446 Bacteria 71277
240 Ga0495679_056830 3300047446 Bacteria 1158
241 Ga0495685_062179 3300047447 Bacteria 1257
242 Ga0495686_0122642 3300047472 Bacteria 1547
243 Ga0495593_0001933 3300047673 Bacteria 12356
244 Ga0495593_0024058 3300047673 Bacteria 3379
245 Ga0495593_0098522 3300047673 Bacteria 1501
246 Ga0495602_0020077 3300048088 Bacteria 6610
247 Ga0495602_0049128 3300048088 Bacteria 3782
248 Ga0495602_0186125 3300048088 Bacteria 1596
249 Ga0495614_0079791 3300048089 Bacteria 1417
250 Ga0495626_0038044 3300048091 Bacteria 2283
251 Ga0495626_0039196 3300048091 Bacteria 2243
252 Ga0495626_0040015 3300048091 Bacteria 2216
253 Ga0496100_0017739 3300048903 Bacteria 4209
254 Ga0496101_0307523 3300048904 Bacteria 1242
255 Ga0496102_0113020 3300048905 Bacteria 2533
256 Ga0496102_0197760 3300048905 Bacteria 1895
257 Ga0496102_0246516 3300048905 Bacteria 1684
258 Ga0496102_0266972 3300048905 Bacteria 1613
259 Ga0496104_0266517 3300048907 Bacteria 1625
260 Ga0496104_0343044 3300048907 Bacteria 1407
261 Ga0496104_0366966 3300048907 Bacteria 1352
262 Ga0496105_0130969 3300048908 Bacteria 2068
263 Ga0496105_0224232 3300048908 Bacteria 1529
264 Ga0496106_0204160 3300048909 Bacteria 1573
265 Ga0496106_0333587 3300048909 Bacteria 1218
266 Ga0496107_0184952 3300048910 Bacteria 1547
267 Ga0496108_0298513 3300048911 Bacteria 1403
268 Ga0496109_0553399 3300048912 Bacteria 1085
269 Ga0496111_0244713 3300048914 Unclassified 1332
270 Ga0496112_0200783 3300048915 Bacteria 1953
271 Ga0496114_0055474 3300048917 Bacteria 3304
272 Ga0496114_0430612 3300048917 Bacteria 1169
273 Ga0496115_0255954 3300048918 Bacteria 1440
274 Ga0496121_0025627 3300048924 Bacteria 5589
275 Ga0496121_0054339 3300048924 Bacteria 3347
276 Ga0496121_0126682 3300048924 Bacteria 1918
277 Ga0496124_0285741 3300048927 Bacteria 1200
278 Ga0496126_0183655 3300048929 Bacteria 1775
279 Ga0496126_0222343 3300048929 Bacteria 1585
280 Ga0495682_0030857 3300049460 Bacteria 1982
281 Ga0501033_0184565 3300049570 Bacteria 1494
282 Ga0501037_0045135 3300049573 Bacteria 3235
283 Ga0501037_0187244 3300049573 Bacteria 1466
284 Ga0501038_0226056 3300049574 Bacteria 1491
285 Ga0501043_0114849 3300049579 Bacteria 2113
286 Ga0501046_0151981 3300049580 Bacteria 1746
287 Ga0501047_0273425 3300049581 Bacteria 1535
288 Ga0501198_007496 3300049649 Bacteria 1570
289 Ga0501035_0170188 3300049822 Bacteria 1882
290 Ga0501044_0316181 3300049823 Bacteria 1487
291 nmdc:mga03n38_55177_c1 3300050490 Bacteria 1789
292 nmdc:mga0k408_1941_c2 3300050493 Bacteria 7752
293 nmdc:mga06z11_1350_c2 3300050494 Bacteria 8332
294 nmdc:mga07m45_98138_c1 3300050496 Bacteria 1682
295 nmdc:mga05p37_402199_c1 3300050507 Bacteria 1599
296 nmdc:mga05p37_45879_c1 3300050507 Bacteria 5375
297 nmdc:mga09592_281672_c1 3300050508 Bacteria 1442
298 nmdc:mga09592_66753_c1 3300050508 Bacteria 3050
299 nmdc:mga0qj67_357328_c1 3300050509 Bacteria 1181
300 nmdc:mga06r32_84791_c1 3300050510 Bacteria 3089
301 Ga0500646_0028721 3300053090 Bacteria 1520
302 Ga0500652_045487 3300053131 Bacteria 1779
303 Ga0500604_0018625 3300053151 Bacteria 1936
304 Ga0500634_0092750 3300053161 Bacteria 1528
305 Ga0500637_0032380 3300053178 Bacteria 2915
306 Ga0466962_0073615 3300061719 Bacteria 1632
307 2516024283 2515154189 Bacteria 9629850
308 2516025460 2515154189 Bacteria 9629850
309 2644026630 2643221603 Bacteria 6147767
310 2776268247 2775506902 Bacteria 6208009
311 2776268485 2775506902 Bacteria 6208009
312 2776281723 2775506904 Bacteria 5954060
313 2881929918 2881927736 Bacteria 3993927
314 2883088395 2883087390 Bacteria 9532701
315 2883095435 2883087390 Bacteria 9532701
316 642599037 642555112 Bacteria 8676562
317 642599196 642555112 Bacteria 8676562
318 8011352396 8011350971 Bacteria 6158957
319 Ga0075435_100138852
320 SwRhRL2b_contig_38539
321 LJNas_1002621
322 LJNas_1002775
323 JGI24735J21928_10031026
324 JGI25406J46586_10051014
325 rootH1_10006679
326 rootH1_10015157
327 rootH1_10015158
328 JGI25160J50197_1011065
329 Ga0065704_10110753
330 Ga0070658_10163343
331 Ga0070677_10058241
332 Ga0070680_100105584
333 Ga0070660_100230001
334 Ga0070660_100269841
335 Ga0070661_100143696
336 Ga0070668_100228538
337 Ga0070671_100316435
338 Ga0070674_100018810
339 Ga0070674_100247701
340 Ga0070674_100253658
341 Ga0070674_100364559
342 Ga0070673_100287797
343 Ga0070659_100052525
344 Ga0070709_10053259
345 Ga0070711_100219914
346 Ga0070700_100206809
347 Ga0070663_100192350
348 Ga0070678_100063632
349 Ga0070678_100237858
350 Ga0068867_100115271
351 Ga0070685_10129826
352 Ga0070679_100246234
353 Ga0070697_100332974
354 Ga0070672_100162727
355 Ga0070665_100289935
356 Ga0070665_100298937
357 Ga0068855_100011937
358 Ga0070664_100043488
359 Ga0070664_100113713
360 Ga0068852_100083317
361 Ga0068858_100079417
362 Ga0081455_10069645
363 Ga0081539_10110271
364 Ga0075432_10015708
365 Ga0070715_10080420
366 Ga0075367_10063926
367 Ga0075366_10066558
368 Ga0097621_100058955
369 Ga0097621_100153120
370 Ga0075370_10080125
371 Ga0075428_100202694
372 Ga0075428_100356976
373 Ga0075430_100373713
374 Ga0075431_100191690
375 Ga0075434_100149262
376 Ga0075429_100266372
377 Ga0099794_10035505
378 Ga0105251_10016365
379 Ga0105251_10063027
380 Ga0105240_10023883
381 Ga0111539_10292443
382 Ga0111539_10850457
383 Ga0105245_10284151
384 Ga0114129_10336193
385 Ga0114129_10522260
386 Ga0105238_10209855
387 Ga0105238_10422303
388 Ga0157371_10186112
389 Ga0157369_10037488
390 Ga0157369_10070244
391 Ga0163162_10369777
392 Ga0157372_10385883
393 Ga0157375_10257860
394 Ga0157375_10314098
395 Ga0163163_10291906
396 Ga0157380_10129239
397 Ga0182008_10057890
398 Ga0157379_10308977
399 Ga0157376_10386272
400 Ga0163161_10127129
401 Ga0213875_10146198
402 Ga0209565_1017507
403 Ga0209673_1007637
404 Ga0207426_1004790
405 Ga0209051_1017615
406 Ga0207682_10048345
407 Ga0207688_10153577
408 Ga0207680_10023823
409 Ga0207685_10037637
410 Ga0207705_10205992
411 Ga0207695_10091145
412 Ga0207695_10220369
413 Ga0207663_10180078
414 Ga0207660_10025054
415 Ga0207657_10106876
416 Ga0207657_10216454
417 Ga0207649_10190067
418 Ga0207652_10148095
419 Ga0207681_10203431
420 Ga0207694_10033258
421 Ga0207687_10202085
422 Ga0207700_10313486
423 Ga0207690_10102093
424 Ga0207706_10245472
425 Ga0207669_10124072
426 Ga0207669_10129965
427 Ga0207691_10061113
428 Ga0207679_10001312
429 Ga0207679_10055823
430 Ga0207651_10159041
431 Ga0207668_10201746
432 Ga0207668_10259724
433 Ga0207658_10110309
434 Ga0207703_10272809
435 Ga0207708_10224385
436 Ga0207675_100327159
437 Ga0207683_10212497
438 Ga0207428_10127776
439 Ga0268266_10248254
440 Ga0268264_10178105
441 Ga0268264_10389322
442 Ga0265318_10047175
443 Ga0307517_10063260
444 Ga0307515_10198614
445 Ga0265338_10288755
446 Ga0316183_1011968
447 Ga0265328_10042479
448 Ga0265331_10001761
449 Ga0265327_10003097
450 Ga0265327_10065125
451 Ga0265316_10007260
452 Ga0265316_10101902
453 Ga0307408_100017231
454 Ga0265314_10010883
455 Ga0307405_10194588
456 Ga0307413_10135038
457 Ga0307410_10235552
458 Ga0307406_10065751
459 Ga0307416_100106740
460 Ga0307416_100364060
461 Ga0373956_0063048
462 Ga0373957_0081285
463 Ga0316574_0144320
464 Ga0316574_0162618
465 Ga0316574_0220866
466 Ga0373933_0146867
467 Ga0373937_0303062
468 Ga0395905_0105399
469 Ga0395905_0267433
470 Ga0436364_0547634
471 Ga0400488_35356
472 Ga0400486_02625
473 Ga0400483_065893
474 Ga0400483_191666
475 Ga0400483_215847
476 Ga0400487_20654
477 Ga0436361_1063914
478 Ga0436362_0352878
479 Ga0439465_0053354
480 Ga0439432_044302
481 Ga0439440_0013840
482 Ga0466961_0019237
483 Ga0466968_0027526
484 Ga0451576_0086436
485 Ga0451576_0258631
486 Ga0495592_0227222
487 Ga0495603_0118465
488 Ga0495591_009376
489 Ga0495629_0041856
490 Ga0495638_0005598
491 Ga0495651_0110475
492 Ga0495653_0016598
493 Ga0495653_0024418
494 Ga0495653_0106954
495 Ga0495580_0208164
496 Ga0495580_0229230
497 Ga0495580_0240807
498 Ga0495582_0053204
499 Ga0495605_0018084
500 Ga0495584_0150566
501 Ga0495585_0110598
502 Ga0495594_0161373
503 Ga0495596_0013478
504 Ga0495607_0049379
505 Ga0495583_0063514
506 Ga0495606_0036223
507 Ga0495606_0130199
508 Ga0495608_0038629
509 Ga0495616_0060654
510 Ga0495618_0029061
511 Ga0495620_0015508
512 Ga0495628_0009958
513 Ga0495630_0063773
514 Ga0495632_0106140
515 Ga0495637_0027649
516 Ga0495643_0082558
517 Ga0495644_0058757
518 Ga0495648_0108396
519 Ga0495652_0030825
520 Ga0495665_0042387
521 Ga0495586_0031015
522 Ga0495633_0032844
523 Ga0495668_0102697
524 Ga0495661_0125690
525 Ga0495588_0006150
526 Ga0495588_0090652
527 Ga0495657_0060420
528 Ga0495599_0178539
529 Ga0495623_0031659
530 Ga0495623_0062506
531 Ga0495646_0056548
532 Ga0495613_0280644
533 Ga0495624_0021793
534 Ga0495624_0028474
535 Ga0495624_0136813
536 Ga0495670_0072242
537 Ga0495671_0080267
538 Ga0495671_0114943
539 Ga0495649_0034560
540 Ga0495649_0055531
541 Ga0495649_0101798
542 Ga0495600_0094873
543 Ga0495660_0059551
544 Ga0495581_0156369
545 Ga0495604_0108205
546 Ga0495636_0041028
547 Ga0495674_0166194
548 Ga0495674_0241165
549 Ga0495672_0094833
550 Ga0495676_0086861
551 Ga0495680_0043581
552 Ga0495680_0052113
553 Ga0495680_0203137
554 Ga0495683_0013505
555 Ga0495683_0081531
556 Ga0495675_0039874
557 Ga0495679_000115
558 Ga0495679_056830
559 Ga0495685_062179
560 Ga0495686_0122642
561 Ga0495593_0001933
562 Ga0495593_0024058
563 Ga0495593_0098522
564 Ga0495602_0020077
565 Ga0495602_0049128
566 Ga0495602_0186125
567 Ga0495614_0079791
568 Ga0495626_0038044
569 Ga0495626_0039196
570 Ga0495626_0040015
571 Ga0496100_0017739
572 Ga0496101_0307523
573 Ga0496102_0113020
574 Ga0496102_0197760
575 Ga0496102_0246516
576 Ga0496102_0266972
577 Ga0496104_0266517
578 Ga0496104_0343044
579 Ga0496104_0366966
580 Ga0496105_0130969
581 Ga0496105_0224232
582 Ga0496106_0204160
583 Ga0496106_0333587
584 Ga0496107_0184952
585 Ga0496108_0298513
586 Ga0496109_0553399
587 Ga0496111_0244713
588 Ga0496112_0200783
589 Ga0496114_0055474
590 Ga0496114_0430612
591 Ga0496115_0255954
592 Ga0496121_0025627
593 Ga0496121_0054339
594 Ga0496121_0126682
595 Ga0496124_0285741
596 Ga0496126_0183655
597 Ga0496126_0222343
598 Ga0495682_0030857
599 Ga0501033_0184565
600 Ga0501037_0045135
601 Ga0501037_0187244
602 Ga0501038_0226056
603 Ga0501043_0114849
604 Ga0501046_0151981
605 Ga0501047_0273425
606 Ga0501198_007496
607 Ga0501035_0170188
608 Ga0501044_0316181
609 nmdc:mga03n38_55177_c1
610 nmdc:mga0k408_1941_c2
611 nmdc:mga06z11_1350_c2
612 nmdc:mga07m45_98138_c1
613 nmdc:mga05p37_402199_c1
614 nmdc:mga05p37_45879_c1
615 nmdc:mga09592_281672_c1
616 nmdc:mga09592_66753_c1
617 nmdc:mga0qj67_357328_c1
618 nmdc:mga06r32_84791_c1
619 Ga0500646_0028721
620 Ga0500652_045487
621 Ga0500604_0018625
622 Ga0500634_0092750
623 Ga0500637_0032380
624 Ga0466962_0073615
625 2516024283
626 2516025460
627 2644026630
628 2776268247
629 2776268485
630 2776281723
631 2881929918
632 2883088395
633 2883095435
634 642599037
635 642599196
636 8011352396

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02371

Transposase_20

Transposase IS116/IS110/IS902 family

262

347

0.94

PF01548

DEDD_Tnp_IS110

Transposase

57

199

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tw1-assembly1.cif.gz_A structure of rtt106-ahn 0.7961 2 40
3to1-assembly2.cif.gz_B two surfaces on rtt106 mediate histone binding and chaperone activity 0.7853 2 40
2iir-assembly4.cif.gz_G acetate kinase from a hypothermophile thermotoga maritima 0.7787 5 34
3to1-assembly1.cif.gz_A two surfaces on rtt106 mediate histone binding and chaperone activity 0.769 2 40
2ews-assembly1.cif.gz_A crystal structure of s.aureus pantothenate kinase 0.7657 4 82
ID Description Score Start End Superfamily
af_P96234_14_162_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8395 8 142 3.30.420.10
af_P40161_206_302_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7929 2 40 2.30.29.30
2iirA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.776 5 34 3.30.420.40
3to1A02 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.769 2 40 2.30.29.30
af_A4I2P0_106_288_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7686 3 33 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1H3UI73-F1-model_v4 Transposase 0.9975 1 76
AF-A0A2W7QET8-F1-model_v4 Transposase 0.9963 2 84
AF-A0A1H6PI80-F1-model_v4 deleted 0.9959 2 71
AF-A0A1I7M1B3-F1-model_v4 deleted 0.9957 2 74
AF-A0A1G8Z4I1-F1-model_v4 Transposase 0.9941 2 76

Map