F404339

General Info

Members Datasets Scaffolds Average Seq Length
317 213 316 329

Family's Representative Sequence

Representative Sequence 3300049660|Ga0501216_003002|Ga0501216_003002_33_1100
Length 355
Sequence MKFHGTSPWYLFDFLCKAMKAWILKTPQEINQRPLQLAELTVPNPRADEVLVQVNACGICRTDLHVIEGELPVRRSPLVPGHQIVGRITALGDLVENFAIGDRVGVAWLNRTCGKCEYCLSGRENLCDEALFTGWSVDGGYAEYAVAPAPFTYPIPDDFQDVQAAPLLCAGIIGYRCLRLTGLKENEWNGARLGIYGFGAAGHICIQLARFRGAEVYVCTRDRERHQALAQELGATWVGDAASEPPHGLDAAIIFAPAGELVPAALKSTTKGGTVVLGGIHMSPIPSFDYSLIYGERVVRSVANNTRADGREFLLEAARVPVRTHVQTFSFDHANEALIALKNDAIRGAGVVVNP

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
146 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
153 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
189 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
190 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
191 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.32
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.21
Rhizosphere 95.9
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_1281791 2162886011 Unclassified 1141
2 JGI24740J21852_10010158 3300001979 Bacteria 3640
3 JGI24737J22298_10039738 3300001990 Bacteria 1446
4 JGI24748J21848_1000022 3300002074 Bacteria 106580
5 JGI24034J26672_10000026 3300002239 Bacteria 109498
6 JGI24742J22300_10002607 3300002244 Unclassified 2887
7 JGI25406J46586_10062640 3300003203 Bacteria 1194
8 Ga0065714_10002633 3300005288 Bacteria 18790
9 Ga0065712_10000117 3300005290 Bacteria 235194
10 Ga0065715_10001480 3300005293 Bacteria 8670
11 Ga0065715_10141902 3300005293 Unclassified 1822
12 Ga0065715_10146527 3300005293 Unclassified 1782
13 Ga0065715_10147344 3300005293 Bacteria 1772
14 Ga0065707_10007850 3300005295 Unclassified 3720
15 Ga0070690_100027839 3300005330 Bacteria 3497
16 Ga0070670_100007620 3300005331 Bacteria 9195
17 Ga0070660_100072486 3300005339 Bacteria 2692
18 Ga0070661_100048003 3300005344 Bacteria 3125
19 Ga0070669_100000911 3300005353 Bacteria 21496
20 Ga0070671_100040214 3300005355 Bacteria 3883
21 Ga0070671_100346181 3300005355 Bacteria 1268
22 Ga0070674_100122706 3300005356 Unclassified 1925
23 Ga0070674_100184533 3300005356 Bacteria 1600
24 Ga0070673_100047158 3300005364 Bacteria 3351
25 Ga0070673_100065579 3300005364 Bacteria 2897
26 Ga0070673_100400030 3300005364 Unclassified 1228
27 Ga0070688_100037474 3300005365 Bacteria 2954
28 Ga0070705_100088213 3300005440 Bacteria 1925
29 Ga0070708_100000354 3300005445 Bacteria 34774
30 Ga0070708_100002408 3300005445 Bacteria 14498
31 Ga0070708_100003240 3300005445 Bacteria 12700
32 Ga0070685_10077497 3300005466 Bacteria 1985
33 Ga0070706_100040737 3300005467 Bacteria 4288
34 Ga0070706_100300926 3300005467 Bacteria 1497
35 Ga0070707_100000747 3300005468 Bacteria 32252
36 Ga0070707_100065454 3300005468 Bacteria 3491
37 Ga0070707_100092968 3300005468 Bacteria 2920
38 Ga0070698_100047926 3300005471 Bacteria 4367
39 Ga0070698_100082535 3300005471 Bacteria 3206
40 Ga0070699_100030856 3300005518 Bacteria 4627
41 Ga0070697_100002144 3300005536 Bacteria 15113
42 Ga0070697_100005034 3300005536 Bacteria 10145
43 Ga0070697_100051951 3300005536 Bacteria 3330
44 Ga0070696_100155954 3300005546 Bacteria 1679
45 Ga0070665_100210873 3300005548 Bacteria 1943
46 Ga0070704_100045030 3300005549 Unclassified 3069
47 Ga0068855_100096386 3300005563 Bacteria 3408
48 Ga0068855_100152550 3300005563 Bacteria 2626
49 Ga0068855_100198038 3300005563 Bacteria 2262
50 Ga0070664_100005808 3300005564 Bacteria 9953
51 Ga0070664_100147855 3300005564 Unclassified 2073
52 Ga0068857_100021673 3300005577 Bacteria 5654
53 Ga0068856_100207023 3300005614 Bacteria 1976
54 Ga0070702_100134557 3300005615 Unclassified 1566
55 Ga0070702_100182282 3300005615 Bacteria 1375
56 Ga0068859_100125188 3300005617 Bacteria 2639
57 Ga0068864_100000821 3300005618 Bacteria 26145
58 Ga0068864_100007183 3300005618 Bacteria 9148
59 Ga0068864_100157397 3300005618 Unclassified 2063
60 Ga0068864_100230605 3300005618 Bacteria 1712
61 Ga0068870_10110660 3300005840 Bacteria 1568
62 Ga0068863_100148122 3300005841 Unclassified 2246
63 Ga0068863_100231548 3300005841 Unclassified 1782
64 Ga0068858_100002831 3300005842 Bacteria 17433
65 Ga0068858_100022983 3300005842 Bacteria 5814
66 Ga0068858_100063168 3300005842 Bacteria 3426
67 Ga0068858_100119443 3300005842 Bacteria 2464
68 Ga0068860_100060683 3300005843 Bacteria 3594
69 Ga0068862_100172595 3300005844 Bacteria 1936
70 Ga0081539_10002274 3300005985 Bacteria 27832
71 Ga0070717_10028343 3300006028 Bacteria 4482
72 Ga0075432_10000968 3300006058 Bacteria 9069
73 Ga0070716_100000002 3300006173 Bacteria 396037
74 Ga0070716_100119413 3300006173 Bacteria 1648
75 Ga0097621_100002113 3300006237 Bacteria 13603
76 Ga0097621_100174783 3300006237 Bacteria 1853
77 Ga0068871_100032932 3300006358 Bacteria 4098
78 Ga0075428_100002995 3300006844 Bacteria 18423
79 Ga0075428_100234498 3300006844 Bacteria 1980
80 Ga0075430_100007121 3300006846 Bacteria 9433
81 Ga0075430_100012687 3300006846 Bacteria 7179
82 Ga0075430_100015023 3300006846 Bacteria 6591
83 Ga0075431_100000940 3300006847 Bacteria 25704
84 Ga0075431_100031201 3300006847 Bacteria 5489
85 Ga0075431_100224098 3300006847 Bacteria 1917
86 Ga0075434_100168937 3300006871 Bacteria 2207
87 Ga0075429_100008794 3300006880 Bacteria 8780
88 Ga0075429_100031564 3300006880 Bacteria 4604
89 Ga0075436_100000302 3300006914 Bacteria 31553
90 Ga0097620_100125192 3300006931 Bacteria 2639
91 Ga0075435_100000926 3300007076 Bacteria 18516
92 Ga0075435_100187490 3300007076 Bacteria 1750
93 Ga0075435_100411820 3300007076 Bacteria 1164
94 Ga0105240_10020883 3300009093 Bacteria 8722
95 Ga0105247_10000047 3300009101 Bacteria 151385
96 Ga0105247_10047881 3300009101 Bacteria 2626
97 Ga0105247_10131502 3300009101 Bacteria 1631
98 Ga0114129_10042448 3300009147 Bacteria 6405
99 Ga0114129_10257615 3300009147 Bacteria 2340
100 Ga0114129_10303703 3300009147 Bacteria 2126
101 Ga0114129_10526672 3300009147 Bacteria 1540
102 Ga0105243_10001517 3300009148 Bacteria 20293
103 Ga0105241_10020182 3300009174 Unclassified 4922
104 Ga0105242_10003401 3300009176 Bacteria 12374
105 Ga0105242_10021316 3300009176 Bacteria 5085
106 Ga0105248_10029205 3300009177 Bacteria 6149
107 Ga0105237_10124168 3300009545 Unclassified 2576
108 Ga0105237_10267863 3300009545 Bacteria 1711
109 Ga0105249_10001074 3300009553 Bacteria 24268
110 Ga0105249_10244321 3300009553 Bacteria 1776
111 Ga0157369_10026018 3300013105 Bacteria 6493
112 Ga0157374_10004918 3300013296 Bacteria 11213
113 Ga0157378_10000102 3300013297 Bacteria 80804
114 Ga0157378_10002729 3300013297 Bacteria 15722
115 Ga0157378_10356516 3300013297 Bacteria 1430
116 Ga0163162_10005550 3300013306 Bacteria 12198
117 Ga0163162_10013792 3300013306 Bacteria 7893
118 Ga0163162_10381661 3300013306 Bacteria 1542
119 Ga0157372_10279281 3300013307 Unclassified 1941
120 Ga0157375_10001539 3300013308 Bacteria 19843
121 Ga0157375_10002107 3300013308 Bacteria 17171
122 Ga0163163_10050896 3300014325 Bacteria 4081
123 Ga0163163_10127577 3300014325 Bacteria 2582
124 Ga0163163_10360650 3300014325 Bacteria 1510
125 Ga0163163_10366056 3300014325 Bacteria 1499
126 Ga0163163_10414311 3300014325 Bacteria 1406
127 Ga0157376_10008616 3300014969 Bacteria 7372
128 Ga0206353_11146098 3300020082 Bacteria 4557
129 Ga0213876_10007212 3300021384 Bacteria 6060
130 Ga0207672_1000169 3300025223 Bacteria 9015
131 Ga0207710_10000001 3300025900 Bacteria 1797433
132 Ga0207710_10000429 3300025900 Bacteria 27470
133 Ga0207710_10044558 3300025900 Bacteria 1976
134 Ga0207647_10021441 3300025904 Bacteria 4313
135 Ga0207643_10007175 3300025908 Bacteria 5981
136 Ga0207684_10000110 3300025910 Bacteria 153722
137 Ga0207684_10007336 3300025910 Bacteria 9946
138 Ga0207684_10131336 3300025910 Unclassified 2149
139 Ga0207707_10167884 3300025912 Bacteria 1918
140 Ga0207695_10030668 3300025913 Bacteria 5916
141 Ga0207671_10058816 3300025914 Unclassified 2850
142 Ga0207662_10053652 3300025918 Unclassified 2402
143 Ga0207652_10089640 3300025921 Bacteria 2701
144 Ga0207646_10007319 3300025922 Bacteria 11246
145 Ga0207646_10007578 3300025922 Bacteria 10999
146 Ga0207646_10248711 3300025922 Unclassified 1606
147 Ga0207681_10000605 3300025923 Bacteria 24253
148 Ga0207681_10005153 3300025923 Bacteria 8028
149 Ga0207681_10328675 3300025923 Bacteria 1218
150 Ga0207650_10004845 3300025925 Bacteria 9195
151 Ga0207650_10086687 3300025925 Bacteria 2384
152 Ga0207650_10274514 3300025925 Unclassified 1371
153 Ga0207644_10008700 3300025931 Bacteria 6644
154 Ga0207644_10296070 3300025931 Bacteria 1303
155 Ga0207706_10029056 3300025933 Bacteria 4937
156 Ga0207686_10002392 3300025934 Bacteria 10237
157 Ga0207709_10001169 3300025935 Bacteria 19038
158 Ga0207669_10313090 3300025937 Bacteria 1198
159 Ga0207665_10000004 3300025939 Bacteria 218220
160 Ga0207665_10103778 3300025939 Bacteria 1989
161 Ga0207689_10134165 3300025942 Bacteria 2038
162 Ga0207661_10134012 3300025944 Bacteria 2126
163 Ga0207667_10114397 3300025949 Bacteria 2781
164 Ga0207651_10032160 3300025960 Bacteria 3366
165 Ga0207712_10000700 3300025961 Bacteria 25879
166 Ga0207640_10143726 3300025981 Bacteria 1743
167 Ga0207703_10000867 3300026035 Bacteria 29660
168 Ga0207703_10023740 3300026035 Bacteria 4823
169 Ga0207703_10108304 3300026035 Bacteria 2367
170 Ga0207703_10131410 3300026035 Bacteria 2162
171 Ga0207639_10001369 3300026041 Bacteria 16435
172 Ga0207639_10050751 3300026041 Bacteria 3151
173 Ga0207702_10177623 3300026078 Bacteria 1958
174 Ga0207641_10111202 3300026088 Bacteria 2429
175 Ga0207676_10000989 3300026095 Bacteria 21885
176 Ga0207676_10016429 3300026095 Bacteria 5360
177 Ga0207676_10111070 3300026095 Unclassified 2294
178 Ga0207674_10010992 3300026116 Bacteria 10183
179 Ga0207675_100031266 3300026118 Bacteria 4959
180 Ga0268266_10065476 3300028379 Bacteria 3142
181 Ga0268265_10182533 3300028380 Bacteria 1804
182 Ga0268265_10183482 3300028380 Bacteria 1800
183 Ga0268264_10004317 3300028381 Bacteria 12128
184 Ga0265336_10016674 3300028666 Bacteria 2401
185 Ga0265338_10002436 3300028800 Bacteria 27967
186 Ga0265330_10004912 3300031235 Bacteria 6733
187 Ga0265330_10010999 3300031235 Unclassified 4248
188 Ga0265328_10000887 3300031239 Bacteria 13831
189 Ga0265329_10027847 3300031242 Bacteria 1855
190 Ga0265339_10002914 3300031249 Bacteria 12101
191 Ga0265316_10000010 3300031344 Bacteria 230553
192 Ga0265316_10072290 3300031344 Unclassified 2657
193 Ga0265316_10299013 3300031344 Bacteria 1172
194 Ga0307408_100060134 3300031548 Bacteria 2769
195 Ga0265314_10001140 3300031711 Bacteria 30798
196 Ga0307406_10069823 3300031901 Bacteria 2298
197 Ga0307412_10075346 3300031911 Unclassified 2314
198 Ga0307412_10109169 3300031911 Bacteria 1972
199 Ga0373957_0006975 3300035120 Bacteria 3590
200 Ga0373943_0153492 3300035170 Bacteria 1249
201 Ga0373962_0032384 3300035242 Bacteria 1438
202 Ga0373935_0005040 3300035692 Bacteria 7778
203 Ga0373927_0076338 3300035695 Bacteria 2170
204 Ga0373933_0043048 3300035724 Bacteria 2670
205 Ga0373947_0026614 3300035725 Bacteria 3382
206 Ga0373937_0019809 3300036401 Bacteria 6025
207 Ga0373937_0036649 3300036401 Bacteria 4469
208 Ga0373925_0197213 3300037068 Unclassified 1600
209 Ga0373925_0344491 3300037068 Bacteria 1209
210 Ga0373925_0489313 3300037068 Bacteria 1009
211 Ga0395899_0058193 3300037312 Bacteria 2851
212 Ga0395900_0151882 3300037418 Unclassified 2366
213 Ga0395901_0120375 3300038443 Bacteria 2759
214 Ga0436365_0521032 3300039437 Bacteria 6176
215 Ga0436365_1225937 3300039437 Bacteria 1744
216 Ga0436363_1189903 3300039450 Bacteria 1506
217 Ga0439447_001292 3300041407 Bacteria 9113
218 Ga0439448_0030663 3300042005 Bacteria 1707
219 Ga0451577_0006680 3300042876 Bacteria 11447
220 Ga0451576_0056497 3300045051 Bacteria 4104
221 Ga0451576_0772829 3300045051 Bacteria 1009
222 Ga0466958_0095507 3300045836 Bacteria 1843
223 Ga0466967_0000775 3300045976 Bacteria 16607
224 Ga0466967_0719251 3300045976 Bacteria 989
225 Ga0495617_007150 3300046452 Bacteria 3889
226 Ga0495590_0011360 3300046457 Bacteria 3332
227 Ga0495591_004940 3300046458 Bacteria 6323
228 Ga0495629_0144987 3300046459 Bacteria 1652
229 Ga0495580_0008061 3300046472 Bacteria 8408
230 Ga0495605_0017188 3300046474 Bacteria 3899
231 Ga0495585_0003432 3300046492 Bacteria 10708
232 Ga0495608_0175726 3300046511 Bacteria 1356
233 Ga0495610_0017821 3300046512 Bacteria 4036
234 Ga0495616_0084712 3300046513 Bacteria 1510
235 Ga0495644_0000098 3300046523 Bacteria 42137
236 Ga0495654_0029713 3300046530 Bacteria 2785
237 Ga0495597_0012327 3300046542 Bacteria 4124
238 Ga0495611_0098531 3300046648 Bacteria 1356
239 Ga0495659_0010528 3300046664 Bacteria 2970
240 Ga0495623_0008292 3300046679 Bacteria 6760
241 Ga0495669_0097511 3300046684 Unclassified 1363
242 Ga0495670_0001151 3300046691 Bacteria 12852
243 Ga0495671_0002433 3300046692 Bacteria 11763
244 Ga0495660_0051599 3300046810 Bacteria 2237
245 Ga0495660_0077717 3300046810 Bacteria 1746
246 Ga0495672_0010284 3300047320 Bacteria 6684
247 Ga0495680_0016402 3300047322 Bacteria 6365
248 Ga0495680_0141802 3300047322 Bacteria 1758
249 Ga0495683_0002103 3300047323 Bacteria 12331
250 Ga0495673_0011713 3300047469 Bacteria 4695
251 Ga0495681_0001508 3300047470 Bacteria 17391
252 Ga0496101_0425280 3300048904 Bacteria 1047
253 Ga0496106_0020374 3300048909 Bacteria 4921
254 Ga0496106_0026970 3300048909 Bacteria 4278
255 Ga0496108_0000145 3300048911 Bacteria 68378
256 Ga0496108_0567345 3300048911 Bacteria 990
257 Ga0496115_0036059 3300048918 Bacteria 3914
258 Ga0496115_0111146 3300048918 Unclassified 2251
259 Ga0496126_0006120 3300048929 Bacteria 13496
260 Ga0501031_0104055 3300049568 Bacteria 1853
261 Ga0501031_0126094 3300049568 Bacteria 1672
262 Ga0501032_0103148 3300049569 Bacteria 1890
263 Ga0501033_0137872 3300049570 Bacteria 1765
264 Ga0501034_0004927 3300049571 Bacteria 14705
265 Ga0501034_0019537 3300049571 Bacteria 6929
266 Ga0501034_0656605 3300049571 Bacteria 950
267 Ga0501039_0030276 3300049575 Bacteria 4173
268 Ga0501040_0146888 3300049576 Bacteria 1662
269 Ga0501043_0083265 3300049579 Bacteria 2515
270 Ga0501046_0029396 3300049580 Bacteria 4467
271 Ga0501047_0003961 3300049581 Bacteria 13921
272 Ga0501067_0050800 3300049583 Bacteria 2298
273 Ga0501068_0028687 3300049584 Bacteria 3293
274 Ga0501070_0000166 3300049586 Bacteria 60713
275 Ga0501070_0040786 3300049586 Bacteria 3871
276 Ga0501076_0223763 3300049592 Bacteria 1538
277 Ga0501077_0008114 3300049593 Bacteria 6492
278 Ga0501077_0032892 3300049593 Bacteria 3303
279 Ga0501077_0283231 3300049593 Bacteria 1055
280 Ga0501209_036894 3300049656 Unclassified 1272
281 Ga0501216_003002 3300049660 Unclassified 2435
282 Ga0501217_000525 3300049661 Bacteria 6370
283 Ga0501223_000990 3300049663 Bacteria 6715
284 Ga0501235_003024 3300049669 Unclassified 3627
285 Ga0501257_007948 3300049686 Unclassified 2377
286 Ga0501225_0000723 3300049705 Bacteria 10395
287 Ga0501225_0023637 3300049705 Unclassified 1693
288 Ga0501079_0090665 3300049741 Bacteria 2368
289 Ga0501079_0346609 3300049741 Bacteria 1164
290 Ga0501080_0312920 3300049742 Bacteria 1423
291 Ga0501081_0018726 3300049743 Bacteria 4599
292 Ga0501035_0198976 3300049822 Bacteria 1719
293 Ga0501044_0133715 3300049823 Bacteria 2473
294 Ga0501045_0082161 3300049824 Bacteria 2376
295 Ga0501226_001705 3300049853 Unclassified 2772
296 nmdc:mga05p37_14504_c1 3300050507 Bacteria 9462
297 nmdc:mga05p37_195453_c1 3300050507 Bacteria 2453
298 nmdc:mga05p37_81120_c1 3300050507 Bacteria 3996
299 nmdc:mga09592_10571_c1 3300050508 Bacteria 7512
300 nmdc:mga09592_106960_c1 3300050508 Bacteria 2399
301 nmdc:mga09592_13673_c1 3300050508 Bacteria 6633
302 nmdc:mga0qj67_101123_c1 3300050509 Bacteria 2324
303 nmdc:mga0qj67_7886_c1 3300050509 Bacteria 7867
304 nmdc:mga06r32_43000_c1 3300050510 Bacteria 4298
305 nmdc:mga06r32_81787_c1 3300050510 Bacteria 3146
306 nmdc:mga06r32_8848_c1 3300050510 Bacteria 9075
307 nmdc:mga08y16_537097_c1 3300050511 Bacteria 1184
308 nmdc:mga0rr50_108352_c1 3300050513 Bacteria 2195
309 nmdc:mga0rr50_345_c1 3300050513 Bacteria 25331
310 nmdc:mga0rr50_409853_c1 3300050513 Bacteria 1146
311 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
312 Ga0495601_0113180 3300053077 Bacteria 1759
313 Ga0495595_0267594 3300053084 Bacteria 857
314 Ga0500622_0005047 3300053156 Bacteria 8037
315 Ga0501084_0132498 3300054114 Bacteria 2098
316 Ga0501082_0043905 3300060353 Bacteria 3856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1225937 Ga0436365_1225937_331_1044 231
2 3300039450 Ga0436363_1189903 Ga0436363_1189903_372_1085 231
3 3300049593 Ga0501077_0032892 Ga0501077_0032892_2526_3269 247
4 3300049593 Ga0501077_0283231 Ga0501077_0283231_49_813 247
5 3300049822 Ga0501035_0198976 Ga0501035_0198976_33_842 267
6 3300053084 Ga0495595_0267594 Ga0495595_0267594_35_841 267
7 3300006844 Ga0075428_100002995 Ga0075428_10000299510 281
8 3300006847 Ga0075431_100000940 Ga0075431_10000094014 281
9 3300050507 nmdc:mga05p37_81120_c1 nmdc:mga05p37_81120_c1_544_1395 281
10 3300050508 nmdc:mga09592_10571_c1 nmdc:mga09592_10571_c1_97_948 281
11 3300050510 nmdc:mga06r32_8848_c1 nmdc:mga06r32_8848_c1_6701_7552 281
12 3300049742 Ga0501080_0312920 Ga0501080_0312920_107_964 283
13 3300037068 Ga0373925_0197213 Ga0373925_0197213_622_1476 284
14 3300037068 Ga0373925_0489313 Ga0373925_0489313_15_869 284
15 3300053156 Ga0500622_0005047 Ga0500622_0005047_5486_6343 284
16 3300038443 Ga0395901_0120375 Ga0395901_0120375_1795_2655 285
17 3300049741 Ga0501079_0346609 Ga0501079_0346609_254_1132 285
18 3300039437 Ga0436365_0521032 Ga0436365_0521032_5024_5902 287
19 3300042005 Ga0439448_0030663 Ga0439448_0030663_68_985 291
20 3300045976 Ga0466967_0719251 Ga0466967_0719251_87_965 291
21 3300048911 Ga0496108_0567345 Ga0496108_0567345_59_937 291
22 3300049568 Ga0501031_0104055 Ga0501031_0104055_331_1209 291
23 3300049569 Ga0501032_0103148 Ga0501032_0103148_493_1371 291
24 3300049579 Ga0501043_0083265 Ga0501043_0083265_1042_1920 291
25 3300049581 Ga0501047_0003961 Ga0501047_0003961_1219_2097 291
26 3300049586 Ga0501070_0040786 Ga0501070_0040786_2645_3523 291
27 3300050511 nmdc:mga08y16_537097_c1 nmdc:mga08y16_537097_c1_295_1173 291
28 3300048904 Ga0496101_0425280 Ga0496101_0425280_102_986 292
29 3300049571 Ga0501034_0656605 Ga0501034_0656605_13_891 292
30 3300006846 Ga0075430_100012687 Ga0075430_1000126874 293
31 3300006847 Ga0075431_100224098 Ga0075431_1002240982 293
32 3300006880 Ga0075429_100031564 Ga0075429_1000315643 293
33 3300005467 Ga0070706_100300926 Ga0070706_1003009262 296
34 3300006846 Ga0075430_100015023 Ga0075430_1000150235 297
35 3300006847 Ga0075431_100031201 Ga0075431_1000312014 297
36 3300006880 Ga0075429_100008794 Ga0075429_1000087945 297
37 3300045976 Ga0466967_0000775 Ga0466967_0000775_7994_8923 297
38 3300045051 Ga0451576_0772829 Ga0451576_0772829_74_985 301
39 3300006846 Ga0075430_100007121 Ga0075430_1000071212 308
40 3300042876 Ga0451577_0006680 Ga0451577_0006680_6063_6995 309
41 3300045051 Ga0451576_0056497 Ga0451576_0056497_721_1653 309
42 3300009093 Ga0105240_10020883 Ga0105240_100208833 314
43 3300049576 Ga0501040_0146888 Ga0501040_0146888_622_1641 314
44 3300050507 nmdc:mga05p37_195453_c1 nmdc:mga05p37_195453_c1_358_1305 314
45 3300005466 Ga0070685_10077497 Ga0070685_100774972 316
46 3300049571 Ga0501034_0004927 Ga0501034_0004927_6546_7547 318
47 3300049571 Ga0501034_0019537 Ga0501034_0019537_2973_3974 318
48 3300049584 Ga0501068_0028687 Ga0501068_0028687_990_1982 319
49 3300046664 Ga0495659_0010528 Ga0495659_0010528_1647_2648 320
50 3300049575 Ga0501039_0030276 Ga0501039_0030276_578_1579 320
51 3300049583 Ga0501067_0050800 Ga0501067_0050800_186_1187 322
52 3300005841 Ga0068863_100148122 Ga0068863_1001481222 323
53 3300025913 Ga0207695_10030668 Ga0207695_100306682 323
54 3300026088 Ga0207641_10111202 Ga0207641_101112022 323
55 3300009174 Ga0105241_10020182 Ga0105241_100201826 324
56 3300009545 Ga0105237_10124168 Ga0105237_101241682 325
57 3300025914 Ga0207671_10058816 Ga0207671_100588162 325
58 3300048918 Ga0496115_0111146 Ga0496115_0111146_832_1851 325
59 3300005288 Ga0065714_10002633 Ga0065714_100026339 326
60 3300005842 Ga0068858_100063168 Ga0068858_1000631684 326
61 3300006058 Ga0075432_10000968 Ga0075432_100009682 326
62 3300006237 Ga0097621_100174783 Ga0097621_1001747832 326
63 3300026035 Ga0207703_10108304 Ga0207703_101083043 326
64 3300041407 Ga0439447_001292 Ga0439447_001292_6883_7920 326
65 3300046452 Ga0495617_007150 Ga0495617_007150_1188_2171 326
66 3300046457 Ga0495590_0011360 Ga0495590_0011360_228_1211 326
67 3300046458 Ga0495591_004940 Ga0495591_004940_3828_4811 326
68 3300046459 Ga0495629_0144987 Ga0495629_0144987_263_1246 326
69 3300046474 Ga0495605_0017188 Ga0495605_0017188_390_1373 326
70 3300046492 Ga0495585_0003432 Ga0495585_0003432_538_1521 326
71 3300046512 Ga0495610_0017821 Ga0495610_0017821_274_1257 326
72 3300046513 Ga0495616_0084712 Ga0495616_0084712_85_1068 326
73 3300046523 Ga0495644_0000098 Ga0495644_0000098_33317_34300 326
74 3300046530 Ga0495654_0029713 Ga0495654_0029713_1062_2045 326
75 3300046542 Ga0495597_0012327 Ga0495597_0012327_1139_2122 326
76 3300046648 Ga0495611_0098531 Ga0495611_0098531_51_1034 326
77 3300046684 Ga0495669_0097511 Ga0495669_0097511_229_1212 326
78 3300046691 Ga0495670_0001151 Ga0495670_0001151_3699_4682 326
79 3300046692 Ga0495671_0002433 Ga0495671_0002433_1773_2756 326
80 3300046810 Ga0495660_0051599 Ga0495660_0051599_484_1467 326
81 3300046810 Ga0495660_0077717 Ga0495660_0077717_86_1069 326
82 3300047320 Ga0495672_0010284 Ga0495672_0010284_2141_3124 326
83 3300047323 Ga0495683_0002103 Ga0495683_0002103_10171_11154 326
84 3300047469 Ga0495673_0011713 Ga0495673_0011713_3398_4381 326
85 3300047470 Ga0495681_0001508 Ga0495681_0001508_8571_9554 326
86 3300048929 Ga0496126_0006120 Ga0496126_0006120_11808_12794 326
87 3300053077 Ga0495601_0113180 Ga0495601_0113180_368_1351 326
88 3300047322 Ga0495680_0016402 Ga0495680_0016402_2966_3991 327
89 3300049570 Ga0501033_0137872 Ga0501033_0137872_246_1256 327
90 3300001979 JGI24740J21852_10010158 JGI24740J21852_100101583 328
91 3300005440 Ga0070705_100088213 Ga0070705_1000882131 328
92 3300005445 Ga0070708_100002408 Ga0070708_1000024088 328
93 3300005471 Ga0070698_100082535 Ga0070698_1000825352 328
94 3300005536 Ga0070697_100002144 Ga0070697_1000021446 328
95 3300005548 Ga0070665_100210873 Ga0070665_1002108732 328
96 3300006028 Ga0070717_10028343 Ga0070717_100283434 328
97 3300006844 Ga0075428_100234498 Ga0075428_1002344982 328
98 3300009147 Ga0114129_10042448 Ga0114129_100424488 328
99 3300009545 Ga0105237_10267863 Ga0105237_102678632 328
100 3300025922 Ga0207646_10007319 Ga0207646_100073192 328
101 3300028379 Ga0268266_10065476 Ga0268266_100654762 328
102 3300037312 Ga0395899_0058193 Ga0395899_0058193_10_1023 328
103 3300048918 Ga0496115_0036059 Ga0496115_0036059_2587_3597 328
104 3300049586 Ga0501070_0000166 Ga0501070_0000166_24068_25078 328
105 3300049593 Ga0501077_0008114 Ga0501077_0008114_1523_2515 328
106 3300049741 Ga0501079_0090665 Ga0501079_0090665_725_1717 328
107 3300049743 Ga0501081_0018726 Ga0501081_0018726_3089_4081 328
108 3300049824 Ga0501045_0082161 Ga0501045_0082161_218_1210 328
109 3300050507 nmdc:mga05p37_14504_c1 nmdc:mga05p37_14504_c1_4733_5725 328
110 3300050508 nmdc:mga09592_106960_c1 nmdc:mga09592_106960_c1_101_1093 328
111 3300050508 nmdc:mga09592_13673_c1 nmdc:mga09592_13673_c1_3955_4947 328
112 3300050509 nmdc:mga0qj67_101123_c1 nmdc:mga0qj67_101123_c1_134_1126 328
113 3300050509 nmdc:mga0qj67_7886_c1 nmdc:mga0qj67_7886_c1_4543_5535 328
114 3300050510 nmdc:mga06r32_43000_c1 nmdc:mga06r32_43000_c1_3123_4115 328
115 3300050510 nmdc:mga06r32_81787_c1 nmdc:mga06r32_81787_c1_1314_2306 328
116 3300050513 nmdc:mga0rr50_108352_c1 nmdc:mga0rr50_108352_c1_371_1363 328
117 3300054114 Ga0501084_0132498 Ga0501084_0132498_995_1987 328
118 3300060353 Ga0501082_0043905 Ga0501082_0043905_1788_2780 328
119 iso_pu_bacteria 2919034639 2919035159 328
120 3300001990 JGI24737J22298_10039738 JGI24737J22298_100397381 329
121 3300005563 Ga0068855_100152550 Ga0068855_1001525502 331
122 3300007076 Ga0075435_100411820 Ga0075435_1004118201 331
123 3300020082 Ga0206353_11146098 Ga0206353_111460985 331
124 3300028666 Ga0265336_10016674 Ga0265336_100166742 331
125 3300035170 Ga0373943_0153492 Ga0373943_0153492_188_1183 331
126 3300035692 Ga0373935_0005040 Ga0373935_0005040_3210_4205 331
127 3300035695 Ga0373927_0076338 Ga0373927_0076338_252_1247 331
128 3300035725 Ga0373947_0026614 Ga0373947_0026614_1892_2887 331
129 3300046511 Ga0495608_0175726 Ga0495608_0175726_282_1277 331
130 3300048911 Ga0496108_0000145 Ga0496108_0000145_13615_14613 331
131 3300049823 Ga0501044_0133715 Ga0501044_0133715_996_1994 331
132 3300003203 JGI25406J46586_10062640 JGI25406J46586_100626401 332
133 3300005355 Ga0070671_100346181 Ga0070671_1003461811 332
134 3300005445 Ga0070708_100003240 Ga0070708_1000032407 332
135 3300005468 Ga0070707_100000747 Ga0070707_1000007472 332
136 3300005618 Ga0068864_100230605 Ga0068864_1002306051 332
137 3300005985 Ga0081539_10002274 Ga0081539_100022742 332
138 3300006173 Ga0070716_100119413 Ga0070716_1001194132 332
139 3300009553 Ga0105249_10244321 Ga0105249_102443212 332
140 3300021384 Ga0213876_10007212 Ga0213876_100072124 332
141 3300025910 Ga0207684_10007336 Ga0207684_100073367 332
142 3300025922 Ga0207646_10007578 Ga0207646_100075788 332
143 3300025931 Ga0207644_10296070 Ga0207644_102960702 332
144 3300025939 Ga0207665_10103778 Ga0207665_101037782 332
145 3300031344 Ga0265316_10299013 Ga0265316_102990131 332
146 3300031911 Ga0307412_10109169 Ga0307412_101091692 332
147 3300035242 Ga0373962_0032384 Ga0373962_0032384_238_1245 332
148 3300036401 Ga0373937_0019809 Ga0373937_0019809_3429_4430 332
149 3300046679 Ga0495623_0008292 Ga0495623_0008292_447_1448 332
150 3300049568 Ga0501031_0126094 Ga0501031_0126094_179_1198 332
151 3300049580 Ga0501046_0029396 Ga0501046_0029396_735_1754 332
152 3300005563 Ga0068855_100198038 Ga0068855_1001980382 334
153 3300006871 Ga0075434_100168937 Ga0075434_1001689373 334
154 3300006914 Ga0075436_100000302 Ga0075436_10000030212 334
155 3300007076 Ga0075435_100000926 Ga0075435_1000009266 334
156 3300025949 Ga0207667_10114397 Ga0207667_101143973 334
157 3300026041 Ga0207639_10001369 Ga0207639_1000136913 334
158 3300050513 nmdc:mga0rr50_345_c1 nmdc:mga0rr50_345_c1_16527_17531 334
159 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_330658_331662 334
160 3300002074 JGI24748J21848_1000022 JGI24748J21848_100002212 335
161 3300002239 JGI24034J26672_10000026 JGI24034J26672_1000002696 335
162 3300002244 JGI24742J22300_10002607 JGI24742J22300_100026073 335
163 3300005331 Ga0070670_100007620 Ga0070670_1000076209 335
164 3300005339 Ga0070660_100072486 Ga0070660_1000724862 335
165 3300005344 Ga0070661_100048003 Ga0070661_1000480031 335
166 3300005353 Ga0070669_100000911 Ga0070669_10000091111 335
167 3300005355 Ga0070671_100040214 Ga0070671_1000402145 335
168 3300005356 Ga0070674_100184533 Ga0070674_1001845332 335
169 3300005364 Ga0070673_100047158 Ga0070673_1000471582 335
170 3300005364 Ga0070673_100065579 Ga0070673_1000655793 335
171 3300005365 Ga0070688_100037474 Ga0070688_1000374742 335
172 3300005546 Ga0070696_100155954 Ga0070696_1001559542 335
173 3300005563 Ga0068855_100096386 Ga0068855_1000963864 335
174 3300005564 Ga0070664_100005808 Ga0070664_1000058087 335
175 3300005577 Ga0068857_100021673 Ga0068857_1000216736 335
176 3300005614 Ga0068856_100207023 Ga0068856_1002070232 335
177 3300005617 Ga0068859_100125188 Ga0068859_1001251883 335
178 3300005618 Ga0068864_100157397 Ga0068864_1001573972 335
179 3300005842 Ga0068858_100002831 Ga0068858_1000028314 335
180 3300005843 Ga0068860_100060683 Ga0068860_1000606832 335
181 3300005844 Ga0068862_100172595 Ga0068862_1001725952 335
182 3300006931 Ga0097620_100125192 Ga0097620_1001251923 335
183 3300009101 Ga0105247_10000047 Ga0105247_1000004714 335
184 3300009101 Ga0105247_10131502 Ga0105247_101315022 335
185 3300009148 Ga0105243_10001517 Ga0105243_100015174 335
186 3300009176 Ga0105242_10003401 Ga0105242_1000340112 335
187 3300013105 Ga0157369_10026018 Ga0157369_100260185 335
188 3300013297 Ga0157378_10000102 Ga0157378_1000010249 335
189 3300013306 Ga0163162_10013792 Ga0163162_100137924 335
190 3300013307 Ga0157372_10279281 Ga0157372_102792812 335
191 3300013308 Ga0157375_10001539 Ga0157375_1000153916 335
192 3300014325 Ga0163163_10127577 Ga0163163_101275772 335
193 3300014325 Ga0163163_10366056 Ga0163163_103660562 335
194 3300025223 Ga0207672_1000169 Ga0207672_100016911 335
195 3300025900 Ga0207710_10000001 Ga0207710_10000001543 335
196 3300025912 Ga0207707_10167884 Ga0207707_101678842 335
197 3300025921 Ga0207652_10089640 Ga0207652_100896404 335
198 3300025923 Ga0207681_10000605 Ga0207681_100006057 335
199 3300025925 Ga0207650_10004845 Ga0207650_100048451 335
200 3300025931 Ga0207644_10008700 Ga0207644_100087006 335
201 3300025933 Ga0207706_10029056 Ga0207706_100290567 335
202 3300025934 Ga0207686_10002392 Ga0207686_100023924 335
203 3300025935 Ga0207709_10001169 Ga0207709_100011697 335
204 3300025937 Ga0207669_10313090 Ga0207669_103130901 335
205 3300025944 Ga0207661_10134012 Ga0207661_101340122 335
206 3300025960 Ga0207651_10032160 Ga0207651_100321604 335
207 3300025981 Ga0207640_10143726 Ga0207640_101437261 335
208 3300026035 Ga0207703_10000867 Ga0207703_1000086716 335
209 3300026041 Ga0207639_10050751 Ga0207639_100507513 335
210 3300026078 Ga0207702_10177623 Ga0207702_101776232 335
211 3300026095 Ga0207676_10111070 Ga0207676_101110702 335
212 3300026116 Ga0207674_10010992 Ga0207674_100109929 335
213 3300028380 Ga0268265_10182533 Ga0268265_101825331 335
214 3300028381 Ga0268264_10004317 Ga0268264_100043176 335
215 3300028800 Ga0265338_10002436 Ga0265338_1000243612 335
216 3300031235 Ga0265330_10004912 Ga0265330_100049123 335
217 3300031235 Ga0265330_10010999 Ga0265330_100109994 335
218 3300031239 Ga0265328_10000887 Ga0265328_100008878 335
219 3300031242 Ga0265329_10027847 Ga0265329_100278472 335
220 3300031249 Ga0265339_10002914 Ga0265339_100029148 335
221 3300031344 Ga0265316_10000010 Ga0265316_10000010154 335
222 3300031344 Ga0265316_10072290 Ga0265316_100722904 335
223 3300031548 Ga0307408_100060134 Ga0307408_1000601344 335
224 3300031711 Ga0265314_10001140 Ga0265314_1000114024 335
225 3300031901 Ga0307406_10069823 Ga0307406_100698233 335
226 3300035120 Ga0373957_0006975 Ga0373957_0006975_2047_3084 335
227 3300035724 Ga0373933_0043048 Ga0373933_0043048_1241_2278 335
228 3300036401 Ga0373937_0036649 Ga0373937_0036649_2896_3933 335
229 3300037068 Ga0373925_0344491 Ga0373925_0344491_95_1129 335
230 3300045836 Ga0466958_0095507 Ga0466958_0095507_810_1832 335
231 3300046472 Ga0495580_0008061 Ga0495580_0008061_5853_6872 335
232 3300047322 Ga0495680_0141802 Ga0495680_0141802_305_1342 335
233 3300048909 Ga0496106_0020374 Ga0496106_0020374_3798_4826 335
234 3300005536 Ga0070697_100005034 Ga0070697_10000503410 336
235 3300005841 Ga0068863_100231548 Ga0068863_1002315482 336
236 3300006173 Ga0070716_100000002 Ga0070716_100000002365 336
237 3300007076 Ga0075435_100187490 Ga0075435_1001874901 336
238 3300025939 Ga0207665_10000004 Ga0207665_10000004175 336
239 3300050513 nmdc:mga0rr50_409853_c1 nmdc:mga0rr50_409853_c1_55_1065 336
240 2162886011 MRS1b_contig_1281791 MRS1b_0478.00003070 337
241 3300005290 Ga0065712_10000117 Ga0065712_100001178 337
242 3300005293 Ga0065715_10001480 Ga0065715_100014809 337
243 3300005293 Ga0065715_10141902 Ga0065715_101419022 337
244 3300005293 Ga0065715_10146527 Ga0065715_101465271 337
245 3300005293 Ga0065715_10147344 Ga0065715_101473442 337
246 3300005295 Ga0065707_10007850 Ga0065707_100078503 337
247 3300005330 Ga0070690_100027839 Ga0070690_1000278392 337
248 3300005356 Ga0070674_100122706 Ga0070674_1001227061 337
249 3300005364 Ga0070673_100400030 Ga0070673_1004000301 337
250 3300005445 Ga0070708_100000354 Ga0070708_10000035424 337
251 3300005467 Ga0070706_100040737 Ga0070706_1000407374 337
252 3300005468 Ga0070707_100065454 Ga0070707_1000654541 337
253 3300005468 Ga0070707_100092968 Ga0070707_1000929682 337
254 3300005471 Ga0070698_100047926 Ga0070698_1000479264 337
255 3300005518 Ga0070699_100030856 Ga0070699_1000308563 337
256 3300005536 Ga0070697_100051951 Ga0070697_1000519512 337
257 3300005549 Ga0070704_100045030 Ga0070704_1000450302 337
258 3300005564 Ga0070664_100147855 Ga0070664_1001478552 337
259 3300005615 Ga0070702_100134557 Ga0070702_1001345571 337
260 3300005615 Ga0070702_100182282 Ga0070702_1001822822 337
261 3300005618 Ga0068864_100000821 Ga0068864_1000008216 337
262 3300005618 Ga0068864_100007183 Ga0068864_1000071835 337
263 3300005840 Ga0068870_10110660 Ga0068870_101106602 337
264 3300005842 Ga0068858_100022983 Ga0068858_1000229833 337
265 3300005842 Ga0068858_100119443 Ga0068858_1001194432 337
266 3300006237 Ga0097621_100002113 Ga0097621_1000021134 337
267 3300006358 Ga0068871_100032932 Ga0068871_1000329321 337
268 3300009101 Ga0105247_10047881 Ga0105247_100478812 337
269 3300009147 Ga0114129_10257615 Ga0114129_102576152 337
270 3300009147 Ga0114129_10303703 Ga0114129_103037032 337
271 3300009147 Ga0114129_10526672 Ga0114129_105266722 337
272 3300009176 Ga0105242_10021316 Ga0105242_100213164 337
273 3300009177 Ga0105248_10029205 Ga0105248_100292052 337
274 3300009553 Ga0105249_10001074 Ga0105249_1000107419 337
275 3300013296 Ga0157374_10004918 Ga0157374_1000491811 337
276 3300013297 Ga0157378_10002729 Ga0157378_100027292 337
277 3300013297 Ga0157378_10356516 Ga0157378_103565162 337
278 3300013306 Ga0163162_10005550 Ga0163162_100055501 337
279 3300013306 Ga0163162_10381661 Ga0163162_103816612 337
280 3300013308 Ga0157375_10002107 Ga0157375_100021073 337
281 3300014325 Ga0163163_10050896 Ga0163163_100508962 337
282 3300014325 Ga0163163_10360650 Ga0163163_103606502 337
283 3300014325 Ga0163163_10414311 Ga0163163_104143112 337
284 3300014969 Ga0157376_10008616 Ga0157376_100086163 337
285 3300025900 Ga0207710_10000429 Ga0207710_1000042911 337
286 3300025900 Ga0207710_10044558 Ga0207710_100445582 337
287 3300025904 Ga0207647_10021441 Ga0207647_100214413 337
288 3300025908 Ga0207643_10007175 Ga0207643_100071753 337
289 3300025910 Ga0207684_10000110 Ga0207684_1000011013 337
290 3300025910 Ga0207684_10131336 Ga0207684_101313362 337
291 3300025918 Ga0207662_10053652 Ga0207662_100536522 337
292 3300025922 Ga0207646_10248711 Ga0207646_102487111 337
293 3300025923 Ga0207681_10005153 Ga0207681_100051536 337
294 3300025923 Ga0207681_10328675 Ga0207681_103286751 337
295 3300025925 Ga0207650_10086687 Ga0207650_100866873 337
296 3300025925 Ga0207650_10274514 Ga0207650_102745142 337
297 3300025942 Ga0207689_10134165 Ga0207689_101341651 337
298 3300025961 Ga0207712_10000700 Ga0207712_100007005 337
299 3300026035 Ga0207703_10023740 Ga0207703_100237402 337
300 3300026035 Ga0207703_10131410 Ga0207703_101314101 337
301 3300026095 Ga0207676_10000989 Ga0207676_1000098918 337
302 3300026095 Ga0207676_10016429 Ga0207676_100164292 337
303 3300026118 Ga0207675_100031266 Ga0207675_1000312664 337
304 3300028380 Ga0268265_10183482 Ga0268265_101834822 337
305 3300031911 Ga0307412_10075346 Ga0307412_100753463 337
306 3300037418 Ga0395900_0151882 Ga0395900_0151882_1293_2306 337
307 3300048909 Ga0496106_0026970 Ga0496106_0026970_2555_3577 337
308 3300049592 Ga0501076_0223763 Ga0501076_0223763_42_1055 337
309 3300049656 Ga0501209_036894 Ga0501209_036894_213_1226 337
310 3300049660 Ga0501216_003002 Ga0501216_003002_33_1100 337
311 3300049661 Ga0501217_000525 Ga0501217_000525_5156_6223 337
312 3300049663 Ga0501223_000990 Ga0501223_000990_178_1245 337
313 3300049669 Ga0501235_003024 Ga0501235_003024_75_1142 337
314 3300049686 Ga0501257_007948 Ga0501257_007948_1007_2074 337
315 3300049705 Ga0501225_0000723 Ga0501225_0000723_6892_7959 337
316 3300049705 Ga0501225_0023637 Ga0501225_0023637_293_1306 337
317 3300049853 Ga0501226_001705 Ga0501226_001705_179_1246 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

46

157

0.97

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

200

319

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9285 1 337
3s2i-assembly2.cif.gz_H crystal structure of furx nadh+:furfuryl alcohol ii 0.9258 1 337
6n7l-assembly3.cif.gz_K crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1 0.9253 1 335
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.925 1 336
1llu-assembly1.cif.gz_A the ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate 0.9197 1 336
ID Description Score Start End Superfamily
af_P9WQC1_8_164_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9853 1 150 3.90.180.10
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9686 151 283 3.40.50.720
af_P9WQC1_165_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9613 151 283 3.40.50.720
af_P00332_5_156_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9523 2 151 3.90.180.10
1rjwC01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9482 1 336 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A7V4DEN2-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein (EC 1.-.-.-) 0.9909 1 336 GO:0004022
GO:0005737
AF-A0A2V9U0Z8-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9902 1 337 GO:0004022
GO:0005737
AF-A0A7V4DEN2-F1-model_v4 Zinc-binding alcohol dehydrogenase family protein (EC 1.-.-.-) 0.9879 1 336 GO:0004022
GO:0005737
AF-A0A239NS91-F1-model_v4 alcohol dehydrogenase (EC 1.1.1.1) 0.9835 1 335 GO:0004022
GO:0005737
GO:0008270
AF-X0WYJ5-F1-model_v4 Alcohol dehydrogenase-like N-terminal domain-containing protein 0.9826 1 96 GO:0004022
GO:0005737

Feature Viewer

pLDDT pTM Quality
95.54 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map