F404326
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 229 | 301 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0001509|Ga0501032_0001509_12108_12785 |
| Length | 218 |
| Sequence | MPRGTEQVRDSKYPKIALASASIGEFGVGKERLLAMTDGVTAIIITIMVLELKMPEHPTLEALAGSWHTFLAYALSFVYVTIYWNLVHHVNGTVLWANFGLLFWLSLVPFATAWMGETGFAPIPTAVYGIALFMPAQAWLLMQRVIIHMQGPDSPMRQVLGRDIKANISPVLYAAGIGSSLFTPWVGLGFYLIVALIWLVPDRRIERMLARNDGQISA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 2 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 3 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 4 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 5 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 6 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 7 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 8 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 9 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 10 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 11 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 12 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 13 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 14 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 15 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 16 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 17 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 18 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 154 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 155 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 158 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 159 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 160 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 161 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 162 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 163 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 216 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 223 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 227 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 228 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.95 |
| Metatranscriptomes | 0 |
| Isolates | 5.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.89 |
| Nodule | 0.32 |
| Rhizoplane | 2.52 |
| Rhizosphere | 91.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003221 | 3300001977 | Bacteria | 2568 |
| 2 | JGI25152J39213_1001484 | 3300002773 | Bacteria | 10022 |
| 3 | rootH1_10155078 | 3300003323 | Bacteria | 2505 |
| 4 | Ga0055535_1000104 | 3300003761 | Bacteria | 90825 |
| 5 | Ga0055529_1000242 | 3300003763 | Bacteria | 67874 |
| 6 | Ga0065714_10165377 | 3300005288 | Bacteria | 1030 |
| 7 | Ga0065714_10200722 | 3300005288 | Bacteria | 896 |
| 8 | Ga0065712_10086156 | 3300005290 | Bacteria | 2652 |
| 9 | Ga0070658_10120058 | 3300005327 | Bacteria | 2184 |
| 10 | Ga0070683_100191701 | 3300005329 | Bacteria | 1941 |
| 11 | Ga0070677_10034756 | 3300005333 | Bacteria | 1949 |
| 12 | Ga0070680_100148422 | 3300005336 | Bacteria | 1968 |
| 13 | Ga0070680_100402376 | 3300005336 | Bacteria | 1167 |
| 14 | Ga0070682_100160100 | 3300005337 | Bacteria | 1554 |
| 15 | Ga0070682_100432979 | 3300005337 | Bacteria | 1003 |
| 16 | Ga0070660_100314416 | 3300005339 | Bacteria | 1285 |
| 17 | Ga0070689_100140591 | 3300005340 | Bacteria | 1941 |
| 18 | Ga0070687_100004964 | 3300005343 | Bacteria | 5348 |
| 19 | Ga0070687_100227586 | 3300005343 | Bacteria | 1146 |
| 20 | Ga0070692_10386901 | 3300005345 | Bacteria | 879 |
| 21 | Ga0070669_100016909 | 3300005353 | Bacteria | 5207 |
| 22 | Ga0070675_100040489 | 3300005354 | Bacteria | 3804 |
| 23 | Ga0070671_100673283 | 3300005355 | Bacteria | 897 |
| 24 | Ga0070674_100065823 | 3300005356 | Bacteria | 2545 |
| 25 | Ga0070688_100026443 | 3300005365 | Bacteria | 3448 |
| 26 | Ga0070659_100205774 | 3300005366 | Bacteria | 1621 |
| 27 | Ga0070659_101031251 | 3300005366 | Bacteria | 723 |
| 28 | Ga0070667_100057404 | 3300005367 | Bacteria | 3290 |
| 29 | Ga0070709_10002476 | 3300005434 | Bacteria | 10003 |
| 30 | Ga0070709_10112713 | 3300005434 | Bacteria | 1830 |
| 31 | Ga0070709_10548064 | 3300005434 | Bacteria | 884 |
| 32 | Ga0070714_100301664 | 3300005435 | Bacteria | 1493 |
| 33 | Ga0070714_100496464 | 3300005435 | Bacteria | 1164 |
| 34 | Ga0070713_100010620 | 3300005436 | Bacteria | 6661 |
| 35 | Ga0070713_100041606 | 3300005436 | Bacteria | 3745 |
| 36 | Ga0070711_100113826 | 3300005439 | Bacteria | 1990 |
| 37 | Ga0070711_100118984 | 3300005439 | Bacteria | 1951 |
| 38 | Ga0070694_100919625 | 3300005444 | Bacteria | 723 |
| 39 | Ga0070662_100462884 | 3300005457 | Bacteria | 1054 |
| 40 | Ga0070681_10201968 | 3300005458 | Bacteria | 1906 |
| 41 | Ga0070681_10285773 | 3300005458 | Bacteria | 1560 |
| 42 | Ga0070681_10333819 | 3300005458 | Bacteria | 1425 |
| 43 | Ga0068867_100000956 | 3300005459 | Bacteria | 19662 |
| 44 | Ga0070685_10027388 | 3300005466 | Bacteria | 3149 |
| 45 | Ga0070685_10027804 | 3300005466 | Bacteria | 3130 |
| 46 | Ga0070685_10777951 | 3300005466 | Bacteria | 704 |
| 47 | Ga0070699_100127550 | 3300005518 | Bacteria | 2241 |
| 48 | Ga0070684_100500336 | 3300005535 | Bacteria | 1126 |
| 49 | Ga0070684_101213181 | 3300005535 | Bacteria | 709 |
| 50 | Ga0070697_100000063 | 3300005536 | Bacteria | 84582 |
| 51 | Ga0068853_100228674 | 3300005539 | Bacteria | 1701 |
| 52 | Ga0070672_100358892 | 3300005543 | Bacteria | 1243 |
| 53 | Ga0070672_100565606 | 3300005543 | Bacteria | 988 |
| 54 | Ga0070695_100009828 | 3300005545 | Bacteria | 5699 |
| 55 | Ga0070693_100620075 | 3300005547 | Bacteria | 783 |
| 56 | Ga0070665_100029486 | 3300005548 | Bacteria | 5522 |
| 57 | Ga0070704_100302020 | 3300005549 | Bacteria | 1334 |
| 58 | Ga0068855_100050383 | 3300005563 | Bacteria | 4907 |
| 59 | Ga0068855_100076420 | 3300005563 | Bacteria | 3887 |
| 60 | Ga0068855_100302890 | 3300005563 | Bacteria | 1770 |
| 61 | Ga0070664_100007666 | 3300005564 | Bacteria | 8720 |
| 62 | Ga0068857_100600127 | 3300005577 | Bacteria | 1041 |
| 63 | Ga0068854_100236421 | 3300005578 | Bacteria | 1453 |
| 64 | Ga0068854_100353757 | 3300005578 | Bacteria | 1203 |
| 65 | Ga0068854_100401859 | 3300005578 | Bacteria | 1134 |
| 66 | Ga0068856_100013171 | 3300005614 | Bacteria | 8010 |
| 67 | Ga0068856_100111874 | 3300005614 | Bacteria | 2728 |
| 68 | Ga0068859_100011168 | 3300005617 | Bacteria | 9029 |
| 69 | Ga0068859_100256591 | 3300005617 | Bacteria | 1839 |
| 70 | Ga0068870_10187238 | 3300005840 | Bacteria | 1246 |
| 71 | Ga0068863_100744138 | 3300005841 | Bacteria | 976 |
| 72 | Ga0068860_100158585 | 3300005843 | Bacteria | 2181 |
| 73 | Ga0068860_100897742 | 3300005843 | Bacteria | 902 |
| 74 | Ga0081455_10000760 | 3300005937 | Bacteria | 41934 |
| 75 | Ga0070717_10000467 | 3300006028 | Bacteria | 25732 |
| 76 | Ga0070717_10006291 | 3300006028 | Bacteria | 8720 |
| 77 | Ga0070712_100039823 | 3300006175 | Bacteria | 3218 |
| 78 | Ga0070712_100098897 | 3300006175 | Bacteria | 2152 |
| 79 | Ga0070712_100449922 | 3300006175 | Bacteria | 1072 |
| 80 | Ga0068871_100049623 | 3300006358 | Bacteria | 3393 |
| 81 | Ga0075434_100762916 | 3300006871 | Bacteria | 984 |
| 82 | Ga0075436_100113981 | 3300006914 | Bacteria | 1888 |
| 83 | Ga0097620_100011168 | 3300006931 | Bacteria | 9029 |
| 84 | Ga0097620_100256588 | 3300006931 | Bacteria | 1839 |
| 85 | Ga0099794_10183293 | 3300007265 | Bacteria | 1069 |
| 86 | Ga0099795_10040689 | 3300007788 | Bacteria | 1652 |
| 87 | Ga0105240_10000009 | 3300009093 | Bacteria | 591332 |
| 88 | Ga0105240_10464818 | 3300009093 | Bacteria | 1413 |
| 89 | Ga0105245_10259045 | 3300009098 | Bacteria | 1692 |
| 90 | Ga0114129_10952806 | 3300009147 | Bacteria | 1084 |
| 91 | Ga0105243_10000065 | 3300009148 | Bacteria | 124947 |
| 92 | Ga0105243_10989720 | 3300009148 | Bacteria | 843 |
| 93 | Ga0105241_10175267 | 3300009174 | Bacteria | 1774 |
| 94 | Ga0105241_10357051 | 3300009174 | Bacteria | 1271 |
| 95 | Ga0105248_10212065 | 3300009177 | Bacteria | 2182 |
| 96 | Ga0105237_10011772 | 3300009545 | Bacteria | 9255 |
| 97 | Ga0105237_10015952 | 3300009545 | Bacteria | 7811 |
| 98 | Ga0105237_10578289 | 3300009545 | Bacteria | 1130 |
| 99 | Ga0105238_10031479 | 3300009551 | Bacteria | 5401 |
| 100 | Ga0105238_10040138 | 3300009551 | Bacteria | 4743 |
| 101 | Ga0105249_10577626 | 3300009553 | Bacteria | 1177 |
| 102 | Ga0099796_10006026 | 3300010159 | Bacteria | 3076 |
| 103 | Ga0105239_10002444 | 3300010375 | Bacteria | 23693 |
| 104 | Ga0105239_12250938 | 3300010375 | Bacteria | 634 |
| 105 | Ga0105246_10702910 | 3300011119 | Bacteria | 886 |
| 106 | Ga0157373_10277138 | 3300013100 | Bacteria | 1188 |
| 107 | Ga0157370_10033239 | 3300013104 | Bacteria | 5028 |
| 108 | Ga0157370_10045596 | 3300013104 | Bacteria | 4205 |
| 109 | Ga0157370_10390918 | 3300013104 | Bacteria | 1281 |
| 110 | Ga0157369_10565913 | 3300013105 | Bacteria | 1174 |
| 111 | Ga0163162_11328628 | 3300013306 | Bacteria | 817 |
| 112 | Ga0157372_10378070 | 3300013307 | Bacteria | 1651 |
| 113 | Ga0157375_10002392 | 3300013308 | Bacteria | 16239 |
| 114 | Ga0157375_10290558 | 3300013308 | Bacteria | 1798 |
| 115 | Ga0157375_10365073 | 3300013308 | Bacteria | 1610 |
| 116 | Ga0157379_10523156 | 3300014968 | Bacteria | 1101 |
| 117 | Ga0182006_1000038 | 3300015261 | Bacteria | 212127 |
| 118 | Ga0183365_10002 | 3300015684 | Bacteria | 545891 |
| 119 | Ga0163161_10005044 | 3300017792 | Bacteria | 9184 |
| 120 | Ga0163161_10053854 | 3300017792 | Bacteria | 2918 |
| 121 | Ga0207692_10362302 | 3300025898 | Bacteria | 896 |
| 122 | Ga0207688_10036521 | 3300025901 | Bacteria | 2723 |
| 123 | Ga0207680_10000551 | 3300025903 | Bacteria | 17800 |
| 124 | Ga0207699_10171117 | 3300025906 | Bacteria | 1453 |
| 125 | Ga0207643_10004904 | 3300025908 | Bacteria | 7162 |
| 126 | Ga0207705_10398023 | 3300025909 | Bacteria | 1065 |
| 127 | Ga0207707_10003060 | 3300025912 | Bacteria | 14860 |
| 128 | Ga0207707_10170652 | 3300025912 | Bacteria | 1901 |
| 129 | Ga0207695_10000038 | 3300025913 | Bacteria | 475092 |
| 130 | Ga0207671_10009628 | 3300025914 | Bacteria | 8055 |
| 131 | Ga0207671_10010485 | 3300025914 | Bacteria | 7640 |
| 132 | Ga0207693_10002459 | 3300025915 | Bacteria | 16095 |
| 133 | Ga0207693_10050511 | 3300025915 | Bacteria | 3266 |
| 134 | Ga0207693_10400157 | 3300025915 | Bacteria | 1074 |
| 135 | Ga0207663_10090530 | 3300025916 | Bacteria | 2028 |
| 136 | Ga0207663_10256016 | 3300025916 | Bacteria | 1290 |
| 137 | Ga0207660_10354349 | 3300025917 | Bacteria | 1176 |
| 138 | Ga0207662_10001567 | 3300025918 | Bacteria | 11184 |
| 139 | Ga0207662_10008637 | 3300025918 | Bacteria | 5588 |
| 140 | Ga0207652_10301106 | 3300025921 | Bacteria | 1447 |
| 141 | Ga0207681_10285279 | 3300025923 | Bacteria | 1301 |
| 142 | Ga0207694_11104210 | 3300025924 | Bacteria | 671 |
| 143 | Ga0207650_10146933 | 3300025925 | Bacteria | 1858 |
| 144 | Ga0207659_10191576 | 3300025926 | Bacteria | 1628 |
| 145 | Ga0207659_10325473 | 3300025926 | Bacteria | 1269 |
| 146 | Ga0207687_10173335 | 3300025927 | Bacteria | 1665 |
| 147 | Ga0207700_10032494 | 3300025928 | Bacteria | 3723 |
| 148 | Ga0207664_10160475 | 3300025929 | Bacteria | 1917 |
| 149 | Ga0207690_10102876 | 3300025932 | Bacteria | 2043 |
| 150 | Ga0207690_10306397 | 3300025932 | Bacteria | 1244 |
| 151 | Ga0207706_10442750 | 3300025933 | Bacteria | 1124 |
| 152 | Ga0207686_10130453 | 3300025934 | Bacteria | 1723 |
| 153 | Ga0207709_10000407 | 3300025935 | Bacteria | 42024 |
| 154 | Ga0207669_10243166 | 3300025937 | Bacteria | 1335 |
| 155 | Ga0207665_10001414 | 3300025939 | Bacteria | 16140 |
| 156 | Ga0207665_10011049 | 3300025939 | Bacteria | 5925 |
| 157 | Ga0207665_10188685 | 3300025939 | Bacteria | 1496 |
| 158 | Ga0207691_10014149 | 3300025940 | Bacteria | 7612 |
| 159 | Ga0207691_10931787 | 3300025940 | Bacteria | 726 |
| 160 | Ga0207661_10732353 | 3300025944 | Bacteria | 910 |
| 161 | Ga0207667_10003796 | 3300025949 | Bacteria | 18593 |
| 162 | Ga0207667_10023310 | 3300025949 | Bacteria | 6817 |
| 163 | Ga0207651_10022815 | 3300025960 | Bacteria | 3836 |
| 164 | Ga0207712_10382586 | 3300025961 | Bacteria | 1178 |
| 165 | Ga0207668_10351735 | 3300025972 | Bacteria | 1232 |
| 166 | Ga0207640_10040280 | 3300025981 | Bacteria | 2962 |
| 167 | Ga0207703_10222883 | 3300026035 | Bacteria | 1687 |
| 168 | Ga0207639_10252967 | 3300026041 | Bacteria | 1537 |
| 169 | Ga0207702_10023017 | 3300026078 | Bacteria | 5168 |
| 170 | Ga0207702_10036526 | 3300026078 | Bacteria | 4110 |
| 171 | Ga0207641_10351157 | 3300026088 | Bacteria | 1406 |
| 172 | Ga0207648_10000702 | 3300026089 | Bacteria | 37525 |
| 173 | Ga0207674_10022398 | 3300026116 | Bacteria | 6784 |
| 174 | Ga0207674_11115449 | 3300026116 | Bacteria | 758 |
| 175 | Ga0207698_10193109 | 3300026142 | Bacteria | 1816 |
| 176 | Ga0209588_1092561 | 3300027671 | Bacteria | 974 |
| 177 | Ga0268264_10766757 | 3300028381 | Bacteria | 962 |
| 178 | Ga0265328_10205218 | 3300031239 | Bacteria | 749 |
| 179 | Ga0307412_10000047 | 3300031911 | Bacteria | 163617 |
| 180 | Ga0307412_10000584 | 3300031911 | Bacteria | 21597 |
| 181 | Ga0307412_10003486 | 3300031911 | Bacteria | 8741 |
| 182 | Ga0307412_10879520 | 3300031911 | Bacteria | 784 |
| 183 | Ga0307416_100507744 | 3300032002 | Bacteria | 1271 |
| 184 | Ga0307416_101809209 | 3300032002 | Bacteria | 715 |
| 185 | Ga0307414_10051220 | 3300032004 | Bacteria | 2865 |
| 186 | Ga0307414_10051556 | 3300032004 | Bacteria | 2857 |
| 187 | Ga0307414_10059395 | 3300032004 | Bacteria | 2700 |
| 188 | Ga0307411_10179692 | 3300032005 | Bacteria | 1605 |
| 189 | Ga0373954_0004086 | 3300035118 | Bacteria | 6254 |
| 190 | Ga0373956_0013267 | 3300035119 | Bacteria | 3426 |
| 191 | Ga0373943_0113829 | 3300035170 | Bacteria | 1430 |
| 192 | Ga0373955_0007502 | 3300035172 | Bacteria | 5016 |
| 193 | Ga0373955_0157331 | 3300035172 | Bacteria | 1339 |
| 194 | Ga0373933_0005197 | 3300035724 | Bacteria | 7102 |
| 195 | Ga0373937_0005046 | 3300036401 | Bacteria | 11240 |
| 196 | Ga0373937_0040524 | 3300036401 | Bacteria | 4245 |
| 197 | Ga0373937_0088699 | 3300036401 | Bacteria | 2864 |
| 198 | Ga0373925_0524679 | 3300037068 | Bacteria | 973 |
| 199 | Ga0395900_0007503 | 3300037418 | Bacteria | 11268 |
| 200 | Ga0395898_0001314 | 3300037466 | Bacteria | 36175 |
| 201 | Ga0395898_0395468 | 3300037466 | Bacteria | 1318 |
| 202 | Ga0395901_0158730 | 3300038443 | Bacteria | 2375 |
| 203 | Ga0395901_0502152 | 3300038443 | Bacteria | 1235 |
| 204 | Ga0436365_0009191 | 3300039437 | Bacteria | 2347 |
| 205 | Ga0436365_0657255 | 3300039437 | Bacteria | 1254 |
| 206 | Ga0436365_1462042 | 3300039437 | Bacteria | 773 |
| 207 | Ga0436365_1835429 | 3300039437 | Bacteria | 5385 |
| 208 | Ga0436360_0555544 | 3300039438 | Bacteria | 1138 |
| 209 | Ga0436360_1020136 | 3300039438 | Bacteria | 1655 |
| 210 | Ga0436360_1367606 | 3300039438 | Bacteria | 7473 |
| 211 | Ga0436361_0106094 | 3300039447 | Bacteria | 3172 |
| 212 | Ga0436361_0158143 | 3300039447 | Bacteria | 927 |
| 213 | Ga0436361_0444199 | 3300039447 | Bacteria | 1019 |
| 214 | Ga0436363_0645227 | 3300039450 | Bacteria | 4102 |
| 215 | Ga0436362_0681071 | 3300039453 | Bacteria | 857 |
| 216 | Ga0436362_0864961 | 3300039453 | Bacteria | 2116 |
| 217 | Ga0439465_0005617 | 3300041413 | Bacteria | 3994 |
| 218 | Ga0439442_001005 | 3300042002 | Bacteria | 5698 |
| 219 | Ga0439442_002884 | 3300042002 | Bacteria | 3385 |
| 220 | Ga0439445_0000008 | 3300042004 | Bacteria | 25873 |
| 221 | Ga0451577_0003329 | 3300042876 | Bacteria | 18051 |
| 222 | Ga0451577_0233864 | 3300042876 | Bacteria | 1662 |
| 223 | Ga0451577_0489022 | 3300042876 | Bacteria | 1117 |
| 224 | Ga0466965_0022492 | 3300044683 | Bacteria | 3039 |
| 225 | Ga0466966_0164042 | 3300044684 | Bacteria | 1352 |
| 226 | Ga0466961_0152387 | 3300044693 | Bacteria | 1443 |
| 227 | Ga0466970_0017629 | 3300044765 | Bacteria | 3690 |
| 228 | Ga0466970_0418431 | 3300044765 | Bacteria | 766 |
| 229 | Ga0451576_0295156 | 3300045051 | Bacteria | 1695 |
| 230 | Ga0495627_000025 | 3300046453 | Bacteria | 248825 |
| 231 | Ga0495651_0626727 | 3300046462 | Bacteria | 676 |
| 232 | Ga0495580_0000258 | 3300046472 | Bacteria | 42219 |
| 233 | Ga0495643_0187405 | 3300046522 | Bacteria | 1001 |
| 234 | Ga0495652_0240888 | 3300046529 | Bacteria | 1346 |
| 235 | Ga0495654_0000008 | 3300046530 | Bacteria | 398340 |
| 236 | Ga0495654_0272840 | 3300046530 | Bacteria | 698 |
| 237 | Ga0495587_0121502 | 3300046536 | Bacteria | 1496 |
| 238 | Ga0495621_0015704 | 3300046539 | Bacteria | 2418 |
| 239 | Ga0495645_0099879 | 3300046543 | Bacteria | 2065 |
| 240 | Ga0495633_0000126 | 3300046558 | Bacteria | 101794 |
| 241 | Ga0495633_0001373 | 3300046558 | Bacteria | 19021 |
| 242 | Ga0495625_0001770 | 3300046660 | Bacteria | 24960 |
| 243 | Ga0495657_0119785 | 3300046675 | Bacteria | 1659 |
| 244 | Ga0495657_0278908 | 3300046675 | Bacteria | 1001 |
| 245 | Ga0495623_0406820 | 3300046679 | Bacteria | 731 |
| 246 | Ga0495604_0029734 | 3300047317 | Bacteria | 4346 |
| 247 | Ga0495685_031901 | 3300047447 | Bacteria | 1810 |
| 248 | Ga0495686_0005277 | 3300047472 | Bacteria | 10256 |
| 249 | Ga0495602_0597337 | 3300048088 | Bacteria | 759 |
| 250 | Ga0495615_0022130 | 3300048090 | Bacteria | 1442 |
| 251 | Ga0495615_0106626 | 3300048090 | Bacteria | 797 |
| 252 | Ga0496100_0340395 | 3300048903 | Bacteria | 1131 |
| 253 | Ga0496101_1291639 | 3300048904 | Unclassified | 571 |
| 254 | Ga0496104_0207744 | 3300048907 | Bacteria | 1870 |
| 255 | Ga0496105_0525101 | 3300048908 | Bacteria | 927 |
| 256 | Ga0496107_0677937 | 3300048910 | Bacteria | 759 |
| 257 | Ga0496108_1112491 | 3300048911 | Bacteria | 671 |
| 258 | Ga0496109_0828697 | 3300048912 | Bacteria | 863 |
| 259 | Ga0496115_0350234 | 3300048918 | Bacteria | 1205 |
| 260 | Ga0496122_0000162 | 3300048925 | Bacteria | 158851 |
| 261 | Ga0496122_0070332 | 3300048925 | Bacteria | 2501 |
| 262 | Ga0501032_0001509 | 3300049569 | Bacteria | 18594 |
| 263 | Ga0501032_0018331 | 3300049569 | Bacteria | 4905 |
| 264 | Ga0501033_0020818 | 3300049570 | Bacteria | 4951 |
| 265 | Ga0501034_0044488 | 3300049571 | Bacteria | 4490 |
| 266 | Ga0501034_0135135 | 3300049571 | Bacteria | 2447 |
| 267 | Ga0501034_0344158 | 3300049571 | Bacteria | 1420 |
| 268 | Ga0501036_0008340 | 3300049572 | Bacteria | 8489 |
| 269 | Ga0501037_0092791 | 3300049573 | Bacteria | 2183 |
| 270 | Ga0501038_0017348 | 3300049574 | Bacteria | 6508 |
| 271 | Ga0501042_0098185 | 3300049578 | Bacteria | 2106 |
| 272 | Ga0501043_0007686 | 3300049579 | Bacteria | 8538 |
| 273 | Ga0501046_0010067 | 3300049580 | Bacteria | 8143 |
| 274 | Ga0501048_0001952 | 3300049582 | Bacteria | 15673 |
| 275 | Ga0501067_0002199 | 3300049583 | Bacteria | 10770 |
| 276 | Ga0501068_0071316 | 3300049584 | Bacteria | 2121 |
| 277 | Ga0501069_0002352 | 3300049585 | Bacteria | 9576 |
| 278 | Ga0501069_0420322 | 3300049585 | Bacteria | 792 |
| 279 | Ga0501070_0015000 | 3300049586 | Bacteria | 6519 |
| 280 | Ga0501070_0117933 | 3300049586 | Bacteria | 2193 |
| 281 | Ga0501073_0006661 | 3300049589 | Bacteria | 8603 |
| 282 | Ga0501073_0480409 | 3300049589 | Bacteria | 859 |
| 283 | Ga0501074_0024841 | 3300049590 | Bacteria | 4352 |
| 284 | Ga0501079_0008695 | 3300049741 | Bacteria | 7699 |
| 285 | Ga0501083_0009190 | 3300049744 | Bacteria | 6983 |
| 286 | Ga0501241_000007 | 3300049758 | Bacteria | 148190 |
| 287 | Ga0501269_000041 | 3300049766 | Bacteria | 39355 |
| 288 | Ga0501035_0080813 | 3300049822 | Bacteria | 2869 |
| 289 | Ga0501035_0220399 | 3300049822 | Bacteria | 1620 |
| 290 | Ga0501044_0049855 | 3300049823 | Bacteria | 4322 |
| 291 | nmdc:mga0n895_848883_c1 | 3300050512 | Bacteria | 901 |
| 292 | nmdc:mga08x19_74895_c1 | 3300050514 | Bacteria | 2212 |
| 293 | Ga0495601_0191293 | 3300053077 | Bacteria | 1337 |
| 294 | Ga0500635_0018921 | 3300053080 | Bacteria | 2087 |
| 295 | Ga0495655_0001489 | 3300053083 | Bacteria | 3600 |
| 296 | Ga0495595_0003175 | 3300053084 | Bacteria | 6518 |
| 297 | Ga0495619_0017758 | 3300053085 | Bacteria | 4508 |
| 298 | Ga0500608_000303 | 3300053122 | Bacteria | 18987 |
| 299 | Ga0500619_176348 | 3300053154 | Bacteria | 723 |
| 300 | Ga0501084_0056601 | 3300054114 | Bacteria | 3280 |
| 301 | Ga0501082_0024512 | 3300060353 | Bacteria | 5200 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100076420 | Ga0068855_1000764203 | 156 |
| 2 | 3300009093 | Ga0105240_10464818 | Ga0105240_104648182 | 156 |
| 3 | 3300009545 | Ga0105237_10011772 | Ga0105237_100117728 | 156 |
| 4 | 3300010375 | Ga0105239_10002444 | Ga0105239_1000244416 | 156 |
| 5 | 3300017792 | Ga0163161_10053854 | Ga0163161_100538543 | 156 |
| 6 | 3300025914 | Ga0207671_10010485 | Ga0207671_100104855 | 156 |
| 7 | 3300025949 | Ga0207667_10023310 | Ga0207667_100233105 | 156 |
| 8 | 3300005578 | Ga0068854_100353757 | Ga0068854_1003537571 | 157 |
| 9 | 3300009545 | Ga0105237_10015952 | Ga0105237_100159526 | 157 |
| 10 | 3300025914 | Ga0207671_10009628 | Ga0207671_100096282 | 157 |
| 11 | 3300048925 | Ga0496122_0070332 | Ga0496122_0070332_277_855 | 158 |
| 12 | 3300053122 | Ga0500608_000303 | Ga0500608_000303_12840_13442 | 161 |
| 13 | 3300013104 | Ga0157370_10390918 | Ga0157370_103909183 | 162 |
| 14 | 3300015684 | Ga0183365_10002 | Ga0183365_10002211 | 162 |
| 15 | 3300049571 | Ga0501034_0044488 | Ga0501034_0044488_650_1252 | 162 |
| 16 | 3300049571 | Ga0501034_0135135 | Ga0501034_0135135_1553_2152 | 162 |
| 17 | 3300048904 | Ga0496101_1291639 | Ga0496101_1291639_43_558 | 165 |
| 18 | 3300045051 | Ga0451576_0295156 | Ga0451576_0295156_652_1236 | 167 |
| 19 | 3300003761 | Ga0055535_1000104 | Ga0055535_100010459 | 168 |
| 20 | 3300003763 | Ga0055529_1000242 | Ga0055529_100024232 | 168 |
| 21 | 3300032002 | Ga0307416_101809209 | Ga0307416_1018092091 | 168 |
| 22 | 3300032005 | Ga0307411_10179692 | Ga0307411_101796921 | 168 |
| 23 | 3300015261 | Ga0182006_1000038 | Ga0182006_100003856 | 169 |
| 24 | 3300053080 | Ga0500635_0018921 | Ga0500635_0018921_796_1374 | 169 |
| 25 | 3300053154 | Ga0500619_176348 | Ga0500619_176348_25_603 | 169 |
| 26 | 3300035170 | Ga0373943_0113829 | Ga0373943_0113829_28_609 | 170 |
| 27 | 3300046522 | Ga0495643_0187405 | Ga0495643_0187405_123_686 | 170 |
| 28 | 3300025939 | Ga0207665_10001414 | Ga0207665_1000141410 | 171 |
| 29 | 3300009553 | Ga0105249_10577626 | Ga0105249_105776262 | 172 |
| 30 | 3300025961 | Ga0207712_10382586 | Ga0207712_103825862 | 172 |
| 31 | 3300046472 | Ga0495580_0000258 | Ga0495580_0000258_10389_10964 | 172 |
| 32 | 3300005578 | Ga0068854_100401859 | Ga0068854_1004018592 | 173 |
| 33 | 3300037418 | Ga0395900_0007503 | Ga0395900_0007503_3248_3838 | 173 |
| 34 | 3300037466 | Ga0395898_0001314 | Ga0395898_0001314_3746_4336 | 173 |
| 35 | 3300044684 | Ga0466966_0164042 | Ga0466966_0164042_63_659 | 173 |
| 36 | 3300044693 | Ga0466961_0152387 | Ga0466961_0152387_826_1422 | 173 |
| 37 | 3300005434 | Ga0070709_10548064 | Ga0070709_105480642 | 174 |
| 38 | 3300005458 | Ga0070681_10285773 | Ga0070681_102857732 | 174 |
| 39 | 3300005543 | Ga0070672_100565606 | Ga0070672_1005656062 | 174 |
| 40 | 3300005545 | Ga0070695_100009828 | Ga0070695_1000098283 | 174 |
| 41 | 3300005563 | Ga0068855_100050383 | Ga0068855_1000503834 | 174 |
| 42 | 3300009093 | Ga0105240_10000009 | Ga0105240_10000009164 | 174 |
| 43 | 3300009177 | Ga0105248_10212065 | Ga0105248_102120653 | 174 |
| 44 | 3300009551 | Ga0105238_10040138 | Ga0105238_100401383 | 174 |
| 45 | 3300025912 | Ga0207707_10003060 | Ga0207707_1000306013 | 174 |
| 46 | 3300025913 | Ga0207695_10000038 | Ga0207695_1000003866 | 174 |
| 47 | 3300025940 | Ga0207691_10931787 | Ga0207691_109317871 | 174 |
| 48 | 3300025949 | Ga0207667_10003796 | Ga0207667_1000379623 | 174 |
| 49 | 3300044765 | Ga0466970_0418431 | Ga0466970_0418431_135_749 | 174 |
| 50 | 3300005434 | Ga0070709_10002476 | Ga0070709_1000247615 | 175 |
| 51 | 3300005439 | Ga0070711_100113826 | Ga0070711_1001138262 | 175 |
| 52 | 3300005518 | Ga0070699_100127550 | Ga0070699_1001275502 | 175 |
| 53 | 3300017792 | Ga0163161_10005044 | Ga0163161_100050445 | 175 |
| 54 | 3300031911 | Ga0307412_10879520 | Ga0307412_108795201 | 175 |
| 55 | 3300005466 | Ga0070685_10777951 | Ga0070685_107779511 | 177 |
| 56 | 3300025972 | Ga0207668_10351735 | Ga0207668_103517352 | 177 |
| 57 | 3300032002 | Ga0307416_100507744 | Ga0307416_1005077442 | 177 |
| 58 | 3300039437 | Ga0436365_1835429 | Ga0436365_1835429_915_1487 | 177 |
| 59 | 3300039438 | Ga0436360_0555544 | Ga0436360_0555544_419_997 | 177 |
| 60 | 3300046679 | Ga0495623_0406820 | Ga0495623_0406820_78_653 | 177 |
| 61 | 3300005458 | Ga0070681_10201968 | Ga0070681_102019683 | 178 |
| 62 | 3300013104 | Ga0157370_10045596 | Ga0157370_100455963 | 178 |
| 63 | 3300025898 | Ga0207692_10362302 | Ga0207692_103623022 | 178 |
| 64 | 3300025912 | Ga0207707_10170652 | Ga0207707_101706522 | 178 |
| 65 | 3300025932 | Ga0207690_10102876 | Ga0207690_101028762 | 178 |
| 66 | 3300031911 | Ga0307412_10003486 | Ga0307412_1000348610 | 178 |
| 67 | 3300039437 | Ga0436365_0657255 | Ga0436365_0657255_584_1159 | 178 |
| 68 | 3300039453 | Ga0436362_0681071 | Ga0436362_0681071_41_625 | 178 |
| 69 | 3300048907 | Ga0496104_0207744 | Ga0496104_0207744_78_743 | 178 |
| 70 | 3300049569 | Ga0501032_0001509 | Ga0501032_0001509_12108_12785 | 178 |
| 71 | 3300049570 | Ga0501033_0020818 | Ga0501033_0020818_4096_4773 | 178 |
| 72 | 3300049571 | Ga0501034_0344158 | Ga0501034_0344158_282_959 | 178 |
| 73 | 3300049572 | Ga0501036_0008340 | Ga0501036_0008340_4826_5503 | 178 |
| 74 | 3300049573 | Ga0501037_0092791 | Ga0501037_0092791_229_906 | 178 |
| 75 | 3300049574 | Ga0501038_0017348 | Ga0501038_0017348_5586_6263 | 178 |
| 76 | 3300049578 | Ga0501042_0098185 | Ga0501042_0098185_295_972 | 178 |
| 77 | 3300049579 | Ga0501043_0007686 | Ga0501043_0007686_7772_8449 | 178 |
| 78 | 3300049580 | Ga0501046_0010067 | Ga0501046_0010067_4870_5547 | 178 |
| 79 | 3300049582 | Ga0501048_0001952 | Ga0501048_0001952_13198_13875 | 178 |
| 80 | 3300049583 | Ga0501067_0002199 | Ga0501067_0002199_9947_10624 | 178 |
| 81 | 3300049584 | Ga0501068_0071316 | Ga0501068_0071316_636_1313 | 178 |
| 82 | 3300049585 | Ga0501069_0002352 | Ga0501069_0002352_3508_4185 | 178 |
| 83 | 3300049586 | Ga0501070_0015000 | Ga0501070_0015000_261_938 | 178 |
| 84 | 3300049589 | Ga0501073_0006661 | Ga0501073_0006661_5609_6286 | 178 |
| 85 | 3300049589 | Ga0501073_0480409 | Ga0501073_0480409_144_731 | 178 |
| 86 | 3300049590 | Ga0501074_0024841 | Ga0501074_0024841_1708_2385 | 178 |
| 87 | 3300049741 | Ga0501079_0008695 | Ga0501079_0008695_4313_4990 | 178 |
| 88 | 3300049744 | Ga0501083_0009190 | Ga0501083_0009190_4725_5402 | 178 |
| 89 | 3300049822 | Ga0501035_0080813 | Ga0501035_0080813_463_1140 | 178 |
| 90 | 3300049822 | Ga0501035_0220399 | Ga0501035_0220399_117_704 | 178 |
| 91 | 3300049823 | Ga0501044_0049855 | Ga0501044_0049855_2751_3338 | 178 |
| 92 | 3300053077 | Ga0495601_0191293 | Ga0495601_0191293_97_762 | 178 |
| 93 | 3300053084 | Ga0495595_0003175 | Ga0495595_0003175_357_1022 | 178 |
| 94 | 3300053085 | Ga0495619_0017758 | Ga0495619_0017758_360_1025 | 178 |
| 95 | 3300054114 | Ga0501084_0056601 | Ga0501084_0056601_1253_1930 | 178 |
| 96 | 3300060353 | Ga0501082_0024512 | Ga0501082_0024512_137_814 | 178 |
| 97 | 3300005614 | Ga0068856_100111874 | Ga0068856_1001118743 | 179 |
| 98 | 3300026078 | Ga0207702_10023017 | Ga0207702_100230175 | 179 |
| 99 | 3300037466 | Ga0395898_0395468 | Ga0395898_0395468_306_896 | 179 |
| 100 | 3300042002 | Ga0439442_001005 | Ga0439442_001005_2512_3114 | 180 |
| 101 | 3300046530 | Ga0495654_0272840 | Ga0495654_0272840_81_674 | 180 |
| 102 | 3300046539 | Ga0495621_0015704 | Ga0495621_0015704_427_1020 | 180 |
| 103 | 3300047447 | Ga0495685_031901 | Ga0495685_031901_1077_1670 | 180 |
| 104 | 3300048090 | Ga0495615_0106626 | Ga0495615_0106626_166_759 | 180 |
| 105 | iso_pu_bacteria | 2511231000 | 2511233437 | 181 |
| 106 | iso_pu_bacteria | 2582581281 | 2585157509 | 181 |
| 107 | iso_pu_bacteria | 2582581282 | 2585161907 | 181 |
| 108 | iso_pu_bacteria | 2585428115 | 2587942320 | 181 |
| 109 | iso_pu_bacteria | 2585428187 | 2588231238 | 181 |
| 110 | iso_pu_bacteria | 2588254257 | 2590610781 | 181 |
| 111 | iso_pu_bacteria | 2728369107 | 2729202591 | 181 |
| 112 | iso_pu_bacteria | 2772190705 | 2772607178 | 181 |
| 113 | iso_pu_bacteria | 2775506739 | 2775673898 | 181 |
| 114 | iso_pu_bacteria | 2841734538 | 2841739266 | 181 |
| 115 | iso_pu_bacteria | 2842083920 | 2842087460 | 181 |
| 116 | iso_pu_bacteria | 2905999023 | 2906001377 | 181 |
| 117 | iso_pu_bacteria | 2919097161 | 2919100145 | 181 |
| 118 | iso_pu_bacteria | 2945941187 | 2945944348 | 181 |
| 119 | iso_pu_bacteria | 2946019816 | 2946020105 | 181 |
| 120 | iso_pu_bacteria | 2968117919 | 2968120691 | 181 |
| 121 | 3300010375 | Ga0105239_12250938 | Ga0105239_122509381 | 184 |
| 122 | 3300013105 | Ga0157369_10565913 | Ga0157369_105659131 | 184 |
| 123 | 3300013307 | Ga0157372_10378070 | Ga0157372_103780703 | 184 |
| 124 | 3300044683 | Ga0466965_0022492 | Ga0466965_0022492_870_1460 | 184 |
| 125 | 3300044765 | Ga0466970_0017629 | Ga0466970_0017629_311_901 | 184 |
| 126 | 3300002773 | JGI25152J39213_1001484 | JGI25152J39213_10014843 | 185 |
| 127 | 3300003323 | rootH1_10155078 | rootH1_101550783 | 185 |
| 128 | 3300005290 | Ga0065712_10086156 | Ga0065712_100861561 | 185 |
| 129 | 3300005327 | Ga0070658_10120058 | Ga0070658_101200582 | 185 |
| 130 | 3300005329 | Ga0070683_100191701 | Ga0070683_1001917013 | 185 |
| 131 | 3300005333 | Ga0070677_10034756 | Ga0070677_100347562 | 185 |
| 132 | 3300005336 | Ga0070680_100148422 | Ga0070680_1001484222 | 185 |
| 133 | 3300005336 | Ga0070680_100402376 | Ga0070680_1004023762 | 185 |
| 134 | 3300005337 | Ga0070682_100160100 | Ga0070682_1001601002 | 185 |
| 135 | 3300005339 | Ga0070660_100314416 | Ga0070660_1003144162 | 185 |
| 136 | 3300005340 | Ga0070689_100140591 | Ga0070689_1001405912 | 185 |
| 137 | 3300005343 | Ga0070687_100004964 | Ga0070687_1000049641 | 185 |
| 138 | 3300005343 | Ga0070687_100227586 | Ga0070687_1002275862 | 185 |
| 139 | 3300005345 | Ga0070692_10386901 | Ga0070692_103869011 | 185 |
| 140 | 3300005353 | Ga0070669_100016909 | Ga0070669_1000169092 | 185 |
| 141 | 3300005354 | Ga0070675_100040489 | Ga0070675_1000404892 | 185 |
| 142 | 3300005355 | Ga0070671_100673283 | Ga0070671_1006732831 | 185 |
| 143 | 3300005356 | Ga0070674_100065823 | Ga0070674_1000658234 | 185 |
| 144 | 3300005365 | Ga0070688_100026443 | Ga0070688_1000264432 | 185 |
| 145 | 3300005366 | Ga0070659_100205774 | Ga0070659_1002057742 | 185 |
| 146 | 3300005366 | Ga0070659_101031251 | Ga0070659_1010312511 | 185 |
| 147 | 3300005367 | Ga0070667_100057404 | Ga0070667_1000574043 | 185 |
| 148 | 3300005434 | Ga0070709_10112713 | Ga0070709_101127132 | 185 |
| 149 | 3300005435 | Ga0070714_100301664 | Ga0070714_1003016642 | 185 |
| 150 | 3300005435 | Ga0070714_100496464 | Ga0070714_1004964642 | 185 |
| 151 | 3300005436 | Ga0070713_100010620 | Ga0070713_1000106202 | 185 |
| 152 | 3300005436 | Ga0070713_100041606 | Ga0070713_1000416062 | 185 |
| 153 | 3300005444 | Ga0070694_100919625 | Ga0070694_1009196251 | 185 |
| 154 | 3300005457 | Ga0070662_100462884 | Ga0070662_1004628842 | 185 |
| 155 | 3300005458 | Ga0070681_10333819 | Ga0070681_103338192 | 185 |
| 156 | 3300005466 | Ga0070685_10027388 | Ga0070685_100273882 | 185 |
| 157 | 3300005466 | Ga0070685_10027804 | Ga0070685_100278042 | 185 |
| 158 | 3300005535 | Ga0070684_100500336 | Ga0070684_1005003362 | 185 |
| 159 | 3300005535 | Ga0070684_101213181 | Ga0070684_1012131811 | 185 |
| 160 | 3300005536 | Ga0070697_100000063 | Ga0070697_10000006342 | 185 |
| 161 | 3300005539 | Ga0068853_100228674 | Ga0068853_1002286742 | 185 |
| 162 | 3300005543 | Ga0070672_100358892 | Ga0070672_1003588922 | 185 |
| 163 | 3300005547 | Ga0070693_100620075 | Ga0070693_1006200751 | 185 |
| 164 | 3300005548 | Ga0070665_100029486 | Ga0070665_1000294865 | 185 |
| 165 | 3300005549 | Ga0070704_100302020 | Ga0070704_1003020202 | 185 |
| 166 | 3300005563 | Ga0068855_100302890 | Ga0068855_1003028902 | 185 |
| 167 | 3300005577 | Ga0068857_100600127 | Ga0068857_1006001272 | 185 |
| 168 | 3300005578 | Ga0068854_100236421 | Ga0068854_1002364212 | 185 |
| 169 | 3300005614 | Ga0068856_100013171 | Ga0068856_1000131713 | 185 |
| 170 | 3300005617 | Ga0068859_100011168 | Ga0068859_1000111687 | 185 |
| 171 | 3300005617 | Ga0068859_100256591 | Ga0068859_1002565912 | 185 |
| 172 | 3300005840 | Ga0068870_10187238 | Ga0068870_101872382 | 185 |
| 173 | 3300005841 | Ga0068863_100744138 | Ga0068863_1007441382 | 185 |
| 174 | 3300005843 | Ga0068860_100158585 | Ga0068860_1001585852 | 185 |
| 175 | 3300005843 | Ga0068860_100897742 | Ga0068860_1008977422 | 185 |
| 176 | 3300006028 | Ga0070717_10000467 | Ga0070717_100004677 | 185 |
| 177 | 3300006028 | Ga0070717_10006291 | Ga0070717_100062918 | 185 |
| 178 | 3300006175 | Ga0070712_100098897 | Ga0070712_1000988972 | 185 |
| 179 | 3300006175 | Ga0070712_100449922 | Ga0070712_1004499222 | 185 |
| 180 | 3300006358 | Ga0068871_100049623 | Ga0068871_1000496234 | 185 |
| 181 | 3300006871 | Ga0075434_100762916 | Ga0075434_1007629162 | 185 |
| 182 | 3300006914 | Ga0075436_100113981 | Ga0075436_1001139812 | 185 |
| 183 | 3300006931 | Ga0097620_100011168 | Ga0097620_1000111682 | 185 |
| 184 | 3300006931 | Ga0097620_100256588 | Ga0097620_1002565882 | 185 |
| 185 | 3300007265 | Ga0099794_10183293 | Ga0099794_101832932 | 185 |
| 186 | 3300007788 | Ga0099795_10040689 | Ga0099795_100406892 | 185 |
| 187 | 3300009098 | Ga0105245_10259045 | Ga0105245_102590452 | 185 |
| 188 | 3300009147 | Ga0114129_10952806 | Ga0114129_109528062 | 185 |
| 189 | 3300009148 | Ga0105243_10989720 | Ga0105243_109897201 | 185 |
| 190 | 3300009174 | Ga0105241_10175267 | Ga0105241_101752672 | 185 |
| 191 | 3300009174 | Ga0105241_10357051 | Ga0105241_103570512 | 185 |
| 192 | 3300009545 | Ga0105237_10578289 | Ga0105237_105782892 | 185 |
| 193 | 3300009551 | Ga0105238_10031479 | Ga0105238_100314792 | 185 |
| 194 | 3300010159 | Ga0099796_10006026 | Ga0099796_100060262 | 185 |
| 195 | 3300011119 | Ga0105246_10702910 | Ga0105246_107029102 | 185 |
| 196 | 3300013100 | Ga0157373_10277138 | Ga0157373_102771382 | 185 |
| 197 | 3300013306 | Ga0163162_11328628 | Ga0163162_113286281 | 185 |
| 198 | 3300013308 | Ga0157375_10002392 | Ga0157375_100023928 | 185 |
| 199 | 3300013308 | Ga0157375_10290558 | Ga0157375_102905583 | 185 |
| 200 | 3300013308 | Ga0157375_10365073 | Ga0157375_103650732 | 185 |
| 201 | 3300014968 | Ga0157379_10523156 | Ga0157379_105231562 | 185 |
| 202 | 3300025901 | Ga0207688_10036521 | Ga0207688_100365212 | 185 |
| 203 | 3300025903 | Ga0207680_10000551 | Ga0207680_1000055114 | 185 |
| 204 | 3300025906 | Ga0207699_10171117 | Ga0207699_101711172 | 185 |
| 205 | 3300025908 | Ga0207643_10004904 | Ga0207643_100049042 | 185 |
| 206 | 3300025909 | Ga0207705_10398023 | Ga0207705_103980232 | 185 |
| 207 | 3300025915 | Ga0207693_10002459 | Ga0207693_1000245914 | 185 |
| 208 | 3300025915 | Ga0207693_10400157 | Ga0207693_104001572 | 185 |
| 209 | 3300025916 | Ga0207663_10256016 | Ga0207663_102560162 | 185 |
| 210 | 3300025917 | Ga0207660_10354349 | Ga0207660_103543491 | 185 |
| 211 | 3300025918 | Ga0207662_10001567 | Ga0207662_100015672 | 185 |
| 212 | 3300025918 | Ga0207662_10008637 | Ga0207662_100086374 | 185 |
| 213 | 3300025921 | Ga0207652_10301106 | Ga0207652_103011062 | 185 |
| 214 | 3300025923 | Ga0207681_10285279 | Ga0207681_102852792 | 185 |
| 215 | 3300025924 | Ga0207694_11104210 | Ga0207694_111042101 | 185 |
| 216 | 3300025925 | Ga0207650_10146933 | Ga0207650_101469332 | 185 |
| 217 | 3300025926 | Ga0207659_10191576 | Ga0207659_101915763 | 185 |
| 218 | 3300025926 | Ga0207659_10325473 | Ga0207659_103254732 | 185 |
| 219 | 3300025927 | Ga0207687_10173335 | Ga0207687_101733352 | 185 |
| 220 | 3300025928 | Ga0207700_10032494 | Ga0207700_100324944 | 185 |
| 221 | 3300025929 | Ga0207664_10160475 | Ga0207664_101604752 | 185 |
| 222 | 3300025932 | Ga0207690_10306397 | Ga0207690_103063971 | 185 |
| 223 | 3300025933 | Ga0207706_10442750 | Ga0207706_104427502 | 185 |
| 224 | 3300025937 | Ga0207669_10243166 | Ga0207669_102431662 | 185 |
| 225 | 3300025939 | Ga0207665_10188685 | Ga0207665_101886852 | 185 |
| 226 | 3300025940 | Ga0207691_10014149 | Ga0207691_100141492 | 185 |
| 227 | 3300025944 | Ga0207661_10732353 | Ga0207661_107323532 | 185 |
| 228 | 3300025960 | Ga0207651_10022815 | Ga0207651_100228152 | 185 |
| 229 | 3300025981 | Ga0207640_10040280 | Ga0207640_100402802 | 185 |
| 230 | 3300026035 | Ga0207703_10222883 | Ga0207703_102228832 | 185 |
| 231 | 3300026041 | Ga0207639_10252967 | Ga0207639_102529672 | 185 |
| 232 | 3300026078 | Ga0207702_10036526 | Ga0207702_100365264 | 185 |
| 233 | 3300026088 | Ga0207641_10351157 | Ga0207641_103511572 | 185 |
| 234 | 3300026116 | Ga0207674_10022398 | Ga0207674_100223984 | 185 |
| 235 | 3300026116 | Ga0207674_11115449 | Ga0207674_111154491 | 185 |
| 236 | 3300026142 | Ga0207698_10193109 | Ga0207698_101931092 | 185 |
| 237 | 3300027671 | Ga0209588_1092561 | Ga0209588_10925612 | 185 |
| 238 | 3300028381 | Ga0268264_10766757 | Ga0268264_107667572 | 185 |
| 239 | 3300031239 | Ga0265328_10205218 | Ga0265328_102052181 | 185 |
| 240 | 3300031911 | Ga0307412_10000047 | Ga0307412_10000047115 | 185 |
| 241 | 3300031911 | Ga0307412_10000584 | Ga0307412_1000058417 | 185 |
| 242 | 3300032004 | Ga0307414_10051220 | Ga0307414_100512205 | 185 |
| 243 | 3300032004 | Ga0307414_10051556 | Ga0307414_100515565 | 185 |
| 244 | 3300032004 | Ga0307414_10059395 | Ga0307414_100593953 | 185 |
| 245 | 3300035118 | Ga0373954_0004086 | Ga0373954_0004086_727_1314 | 185 |
| 246 | 3300035119 | Ga0373956_0013267 | Ga0373956_0013267_485_1072 | 185 |
| 247 | 3300035172 | Ga0373955_0007502 | Ga0373955_0007502_1880_2467 | 185 |
| 248 | 3300035172 | Ga0373955_0157331 | Ga0373955_0157331_696_1271 | 185 |
| 249 | 3300035724 | Ga0373933_0005197 | Ga0373933_0005197_2049_2636 | 185 |
| 250 | 3300036401 | Ga0373937_0005046 | Ga0373937_0005046_1698_2285 | 185 |
| 251 | 3300036401 | Ga0373937_0040524 | Ga0373937_0040524_3220_3795 | 185 |
| 252 | 3300036401 | Ga0373937_0088699 | Ga0373937_0088699_567_1142 | 185 |
| 253 | 3300037068 | Ga0373925_0524679 | Ga0373925_0524679_316_891 | 185 |
| 254 | 3300038443 | Ga0395901_0158730 | Ga0395901_0158730_657_1226 | 185 |
| 255 | 3300038443 | Ga0395901_0502152 | Ga0395901_0502152_160_729 | 185 |
| 256 | 3300039437 | Ga0436365_0009191 | Ga0436365_0009191_799_1377 | 185 |
| 257 | 3300039437 | Ga0436365_1462042 | Ga0436365_1462042_114_695 | 185 |
| 258 | 3300039438 | Ga0436360_1020136 | Ga0436360_1020136_180_755 | 185 |
| 259 | 3300039447 | Ga0436361_0158143 | Ga0436361_0158143_293_877 | 185 |
| 260 | 3300039447 | Ga0436361_0444199 | Ga0436361_0444199_384_974 | 185 |
| 261 | 3300039450 | Ga0436363_0645227 | Ga0436363_0645227_1127_1738 | 185 |
| 262 | 3300039453 | Ga0436362_0864961 | Ga0436362_0864961_52_627 | 185 |
| 263 | 3300041413 | Ga0439465_0005617 | Ga0439465_0005617_2690_3268 | 185 |
| 264 | 3300042002 | Ga0439442_002884 | Ga0439442_002884_636_1223 | 185 |
| 265 | 3300042004 | Ga0439445_0000008 | Ga0439445_0000008_22342_22920 | 185 |
| 266 | 3300042876 | Ga0451577_0003329 | Ga0451577_0003329_3205_3801 | 185 |
| 267 | 3300042876 | Ga0451577_0233864 | Ga0451577_0233864_311_886 | 185 |
| 268 | 3300046453 | Ga0495627_000025 | Ga0495627_000025_18350_18931 | 185 |
| 269 | 3300046462 | Ga0495651_0626727 | Ga0495651_0626727_59_646 | 185 |
| 270 | 3300046529 | Ga0495652_0240888 | Ga0495652_0240888_377_952 | 185 |
| 271 | 3300046530 | Ga0495654_0000008 | Ga0495654_0000008_129405_129986 | 185 |
| 272 | 3300046536 | Ga0495587_0121502 | Ga0495587_0121502_835_1410 | 185 |
| 273 | 3300046543 | Ga0495645_0099879 | Ga0495645_0099879_192_767 | 185 |
| 274 | 3300046558 | Ga0495633_0000126 | Ga0495633_0000126_82007_82585 | 185 |
| 275 | 3300046558 | Ga0495633_0001373 | Ga0495633_0001373_12024_12602 | 185 |
| 276 | 3300046660 | Ga0495625_0001770 | Ga0495625_0001770_1703_2281 | 185 |
| 277 | 3300046675 | Ga0495657_0119785 | Ga0495657_0119785_406_993 | 185 |
| 278 | 3300046675 | Ga0495657_0278908 | Ga0495657_0278908_216_791 | 185 |
| 279 | 3300047317 | Ga0495604_0029734 | Ga0495604_0029734_1815_2390 | 185 |
| 280 | 3300047472 | Ga0495686_0005277 | Ga0495686_0005277_5487_6068 | 185 |
| 281 | 3300048088 | Ga0495602_0597337 | Ga0495602_0597337_16_591 | 185 |
| 282 | 3300048090 | Ga0495615_0022130 | Ga0495615_0022130_702_1289 | 185 |
| 283 | 3300048903 | Ga0496100_0340395 | Ga0496100_0340395_301_876 | 185 |
| 284 | 3300048908 | Ga0496105_0525101 | Ga0496105_0525101_37_663 | 185 |
| 285 | 3300048910 | Ga0496107_0677937 | Ga0496107_0677937_167_742 | 185 |
| 286 | 3300048911 | Ga0496108_1112491 | Ga0496108_1112491_80_658 | 185 |
| 287 | 3300048912 | Ga0496109_0828697 | Ga0496109_0828697_52_627 | 185 |
| 288 | 3300048918 | Ga0496115_0350234 | Ga0496115_0350234_406_984 | 185 |
| 289 | 3300048925 | Ga0496122_0000162 | Ga0496122_0000162_142584_143162 | 185 |
| 290 | 3300049569 | Ga0501032_0018331 | Ga0501032_0018331_3970_4554 | 185 |
| 291 | 3300049585 | Ga0501069_0420322 | Ga0501069_0420322_114_686 | 185 |
| 292 | 3300049586 | Ga0501070_0117933 | Ga0501070_0117933_1487_2071 | 185 |
| 293 | 3300049758 | Ga0501241_000007 | Ga0501241_000007_42600_43178 | 185 |
| 294 | 3300049766 | Ga0501269_000041 | Ga0501269_000041_32257_32835 | 185 |
| 295 | 3300050512 | nmdc:mga0n895_848883_c1 | nmdc:mga0n895_848883_c1_154_753 | 185 |
| 296 | 3300050514 | nmdc:mga08x19_74895_c1 | nmdc:mga08x19_74895_c1_1503_2081 | 185 |
| 297 | 3300053083 | Ga0495655_0001489 | Ga0495655_0001489_2412_2987 | 185 |
| 298 | 3300005288 | Ga0065714_10200722 | Ga0065714_102007221 | 186 |
| 299 | 3300005337 | Ga0070682_100432979 | Ga0070682_1004329791 | 186 |
| 300 | 3300005439 | Ga0070711_100118984 | Ga0070711_1001189842 | 186 |
| 301 | 3300006175 | Ga0070712_100039823 | Ga0070712_1000398232 | 186 |
| 302 | 3300013104 | Ga0157370_10033239 | Ga0157370_100332392 | 186 |
| 303 | 3300025915 | Ga0207693_10050511 | Ga0207693_100505115 | 186 |
| 304 | 3300025916 | Ga0207663_10090530 | Ga0207663_100905303 | 186 |
| 305 | 3300025939 | Ga0207665_10011049 | Ga0207665_100110495 | 186 |
| 306 | 3300042876 | Ga0451577_0489022 | Ga0451577_0489022_389_994 | 187 |
| 307 | 3300001977 | JGI24746J21847_1003221 | JGI24746J21847_10032213 | 189 |
| 308 | 3300005288 | Ga0065714_10165377 | Ga0065714_101653771 | 189 |
| 309 | 3300005459 | Ga0068867_100000956 | Ga0068867_10000095610 | 189 |
| 310 | 3300005564 | Ga0070664_100007666 | Ga0070664_1000076669 | 189 |
| 311 | 3300005937 | Ga0081455_10000760 | Ga0081455_1000076030 | 189 |
| 312 | 3300009148 | Ga0105243_10000065 | Ga0105243_1000006569 | 189 |
| 313 | 3300025934 | Ga0207686_10130453 | Ga0207686_101304532 | 189 |
| 314 | 3300025935 | Ga0207709_10000407 | Ga0207709_1000040712 | 189 |
| 315 | 3300026089 | Ga0207648_10000702 | Ga0207648_1000070224 | 189 |
| 316 | 3300039438 | Ga0436360_1367606 | Ga0436360_1367606_5545_6168 | 189 |
| 317 | 3300039447 | Ga0436361_0106094 | Ga0436361_0106094_527_1150 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vre-assembly1.cif.gz_D | crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus | 0.8773 | 3 | 179 |
| 5vre-assembly1.cif.gz_D | crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus | 0.8244 | 3 | 179 |
| 6w8p-assembly1.cif.gz_B | structure of membrane protein with ions | 0.7924 | 1 | 179 |
| 6w8p-assembly1.cif.gz_A | structure of membrane protein with ions | 0.7893 | 1 | 179 |
| 7lf6-assembly1.cif.gz_B | structure of lysosomal membrane protein | 0.7866 | 1 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0HUX5_50_167_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.6876 | 1 | 126 | 1.20.930.20 |
| af_A0A0R0HUX5_50_167_1.20.930.20 | Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain | 0.678 | 1 | 126 | 1.20.930.20 |
| af_Q8MZ67_1_133_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6145 | 41 | 178 | 1.20.140.150 |
| af_A0A0R0HFK2_1_219_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.5981 | 7 | 128 | 1.20.1420.10 |
| af_A0A1D6Q0X7_1_285_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.5841 | 1 | 176 | 1.20.1410.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U3QFG1-F1-model_v4 | DUF1211 domain-containing protein | 0.9928 | 1 | 185 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A0K8Q9U3-F1-model_v4 | Transmembrane protein 175 | 0.9893 | 3 | 184 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A7V8XUC2-F1-model_v4 | DUF1211 domain-containing protein | 0.9882 | 1 | 185 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-V4P709-F1-model_v4 | DUF1211 domain-containing protein | 0.988 | 1 | 184 |
GO:0005267
GO:0015252 GO:0016020 |
| AF-A0A2V5PTR6-F1-model_v4 | DUF1211 domain-containing protein | 0.986 | 1 | 175 |
GO:0005267
GO:0015252 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar