F404326

General Info

Members Datasets Scaffolds Average Seq Length
317 229 301 192

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0001509|Ga0501032_0001509_12108_12785
Length 218
Sequence MPRGTEQVRDSKYPKIALASASIGEFGVGKERLLAMTDGVTAIIITIMVLELKMPEHPTLEALAGSWHTFLAYALSFVYVTIYWNLVHHVNGTVLWANFGLLFWLSLVPFATAWMGETGFAPIPTAVYGIALFMPAQAWLLMQRVIIHMQGPDSPMRQVLGRDIKANISPVLYAAGIGSSLFTPWVGLGFYLIVALIWLVPDRRIERMLARNDGQISA

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
3 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
4 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
5 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
6 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
7 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
8 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
9 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
10 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
11 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
12 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
13 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
14 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
15 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
16 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
17 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
227 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.95
Metatranscriptomes 0
Isolates 5.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0.32
Rhizoplane 2.52
Rhizosphere 91.48
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003221 3300001977 Bacteria 2568
2 JGI25152J39213_1001484 3300002773 Bacteria 10022
3 rootH1_10155078 3300003323 Bacteria 2505
4 Ga0055535_1000104 3300003761 Bacteria 90825
5 Ga0055529_1000242 3300003763 Bacteria 67874
6 Ga0065714_10165377 3300005288 Bacteria 1030
7 Ga0065714_10200722 3300005288 Bacteria 896
8 Ga0065712_10086156 3300005290 Bacteria 2652
9 Ga0070658_10120058 3300005327 Bacteria 2184
10 Ga0070683_100191701 3300005329 Bacteria 1941
11 Ga0070677_10034756 3300005333 Bacteria 1949
12 Ga0070680_100148422 3300005336 Bacteria 1968
13 Ga0070680_100402376 3300005336 Bacteria 1167
14 Ga0070682_100160100 3300005337 Bacteria 1554
15 Ga0070682_100432979 3300005337 Bacteria 1003
16 Ga0070660_100314416 3300005339 Bacteria 1285
17 Ga0070689_100140591 3300005340 Bacteria 1941
18 Ga0070687_100004964 3300005343 Bacteria 5348
19 Ga0070687_100227586 3300005343 Bacteria 1146
20 Ga0070692_10386901 3300005345 Bacteria 879
21 Ga0070669_100016909 3300005353 Bacteria 5207
22 Ga0070675_100040489 3300005354 Bacteria 3804
23 Ga0070671_100673283 3300005355 Bacteria 897
24 Ga0070674_100065823 3300005356 Bacteria 2545
25 Ga0070688_100026443 3300005365 Bacteria 3448
26 Ga0070659_100205774 3300005366 Bacteria 1621
27 Ga0070659_101031251 3300005366 Bacteria 723
28 Ga0070667_100057404 3300005367 Bacteria 3290
29 Ga0070709_10002476 3300005434 Bacteria 10003
30 Ga0070709_10112713 3300005434 Bacteria 1830
31 Ga0070709_10548064 3300005434 Bacteria 884
32 Ga0070714_100301664 3300005435 Bacteria 1493
33 Ga0070714_100496464 3300005435 Bacteria 1164
34 Ga0070713_100010620 3300005436 Bacteria 6661
35 Ga0070713_100041606 3300005436 Bacteria 3745
36 Ga0070711_100113826 3300005439 Bacteria 1990
37 Ga0070711_100118984 3300005439 Bacteria 1951
38 Ga0070694_100919625 3300005444 Bacteria 723
39 Ga0070662_100462884 3300005457 Bacteria 1054
40 Ga0070681_10201968 3300005458 Bacteria 1906
41 Ga0070681_10285773 3300005458 Bacteria 1560
42 Ga0070681_10333819 3300005458 Bacteria 1425
43 Ga0068867_100000956 3300005459 Bacteria 19662
44 Ga0070685_10027388 3300005466 Bacteria 3149
45 Ga0070685_10027804 3300005466 Bacteria 3130
46 Ga0070685_10777951 3300005466 Bacteria 704
47 Ga0070699_100127550 3300005518 Bacteria 2241
48 Ga0070684_100500336 3300005535 Bacteria 1126
49 Ga0070684_101213181 3300005535 Bacteria 709
50 Ga0070697_100000063 3300005536 Bacteria 84582
51 Ga0068853_100228674 3300005539 Bacteria 1701
52 Ga0070672_100358892 3300005543 Bacteria 1243
53 Ga0070672_100565606 3300005543 Bacteria 988
54 Ga0070695_100009828 3300005545 Bacteria 5699
55 Ga0070693_100620075 3300005547 Bacteria 783
56 Ga0070665_100029486 3300005548 Bacteria 5522
57 Ga0070704_100302020 3300005549 Bacteria 1334
58 Ga0068855_100050383 3300005563 Bacteria 4907
59 Ga0068855_100076420 3300005563 Bacteria 3887
60 Ga0068855_100302890 3300005563 Bacteria 1770
61 Ga0070664_100007666 3300005564 Bacteria 8720
62 Ga0068857_100600127 3300005577 Bacteria 1041
63 Ga0068854_100236421 3300005578 Bacteria 1453
64 Ga0068854_100353757 3300005578 Bacteria 1203
65 Ga0068854_100401859 3300005578 Bacteria 1134
66 Ga0068856_100013171 3300005614 Bacteria 8010
67 Ga0068856_100111874 3300005614 Bacteria 2728
68 Ga0068859_100011168 3300005617 Bacteria 9029
69 Ga0068859_100256591 3300005617 Bacteria 1839
70 Ga0068870_10187238 3300005840 Bacteria 1246
71 Ga0068863_100744138 3300005841 Bacteria 976
72 Ga0068860_100158585 3300005843 Bacteria 2181
73 Ga0068860_100897742 3300005843 Bacteria 902
74 Ga0081455_10000760 3300005937 Bacteria 41934
75 Ga0070717_10000467 3300006028 Bacteria 25732
76 Ga0070717_10006291 3300006028 Bacteria 8720
77 Ga0070712_100039823 3300006175 Bacteria 3218
78 Ga0070712_100098897 3300006175 Bacteria 2152
79 Ga0070712_100449922 3300006175 Bacteria 1072
80 Ga0068871_100049623 3300006358 Bacteria 3393
81 Ga0075434_100762916 3300006871 Bacteria 984
82 Ga0075436_100113981 3300006914 Bacteria 1888
83 Ga0097620_100011168 3300006931 Bacteria 9029
84 Ga0097620_100256588 3300006931 Bacteria 1839
85 Ga0099794_10183293 3300007265 Bacteria 1069
86 Ga0099795_10040689 3300007788 Bacteria 1652
87 Ga0105240_10000009 3300009093 Bacteria 591332
88 Ga0105240_10464818 3300009093 Bacteria 1413
89 Ga0105245_10259045 3300009098 Bacteria 1692
90 Ga0114129_10952806 3300009147 Bacteria 1084
91 Ga0105243_10000065 3300009148 Bacteria 124947
92 Ga0105243_10989720 3300009148 Bacteria 843
93 Ga0105241_10175267 3300009174 Bacteria 1774
94 Ga0105241_10357051 3300009174 Bacteria 1271
95 Ga0105248_10212065 3300009177 Bacteria 2182
96 Ga0105237_10011772 3300009545 Bacteria 9255
97 Ga0105237_10015952 3300009545 Bacteria 7811
98 Ga0105237_10578289 3300009545 Bacteria 1130
99 Ga0105238_10031479 3300009551 Bacteria 5401
100 Ga0105238_10040138 3300009551 Bacteria 4743
101 Ga0105249_10577626 3300009553 Bacteria 1177
102 Ga0099796_10006026 3300010159 Bacteria 3076
103 Ga0105239_10002444 3300010375 Bacteria 23693
104 Ga0105239_12250938 3300010375 Bacteria 634
105 Ga0105246_10702910 3300011119 Bacteria 886
106 Ga0157373_10277138 3300013100 Bacteria 1188
107 Ga0157370_10033239 3300013104 Bacteria 5028
108 Ga0157370_10045596 3300013104 Bacteria 4205
109 Ga0157370_10390918 3300013104 Bacteria 1281
110 Ga0157369_10565913 3300013105 Bacteria 1174
111 Ga0163162_11328628 3300013306 Bacteria 817
112 Ga0157372_10378070 3300013307 Bacteria 1651
113 Ga0157375_10002392 3300013308 Bacteria 16239
114 Ga0157375_10290558 3300013308 Bacteria 1798
115 Ga0157375_10365073 3300013308 Bacteria 1610
116 Ga0157379_10523156 3300014968 Bacteria 1101
117 Ga0182006_1000038 3300015261 Bacteria 212127
118 Ga0183365_10002 3300015684 Bacteria 545891
119 Ga0163161_10005044 3300017792 Bacteria 9184
120 Ga0163161_10053854 3300017792 Bacteria 2918
121 Ga0207692_10362302 3300025898 Bacteria 896
122 Ga0207688_10036521 3300025901 Bacteria 2723
123 Ga0207680_10000551 3300025903 Bacteria 17800
124 Ga0207699_10171117 3300025906 Bacteria 1453
125 Ga0207643_10004904 3300025908 Bacteria 7162
126 Ga0207705_10398023 3300025909 Bacteria 1065
127 Ga0207707_10003060 3300025912 Bacteria 14860
128 Ga0207707_10170652 3300025912 Bacteria 1901
129 Ga0207695_10000038 3300025913 Bacteria 475092
130 Ga0207671_10009628 3300025914 Bacteria 8055
131 Ga0207671_10010485 3300025914 Bacteria 7640
132 Ga0207693_10002459 3300025915 Bacteria 16095
133 Ga0207693_10050511 3300025915 Bacteria 3266
134 Ga0207693_10400157 3300025915 Bacteria 1074
135 Ga0207663_10090530 3300025916 Bacteria 2028
136 Ga0207663_10256016 3300025916 Bacteria 1290
137 Ga0207660_10354349 3300025917 Bacteria 1176
138 Ga0207662_10001567 3300025918 Bacteria 11184
139 Ga0207662_10008637 3300025918 Bacteria 5588
140 Ga0207652_10301106 3300025921 Bacteria 1447
141 Ga0207681_10285279 3300025923 Bacteria 1301
142 Ga0207694_11104210 3300025924 Bacteria 671
143 Ga0207650_10146933 3300025925 Bacteria 1858
144 Ga0207659_10191576 3300025926 Bacteria 1628
145 Ga0207659_10325473 3300025926 Bacteria 1269
146 Ga0207687_10173335 3300025927 Bacteria 1665
147 Ga0207700_10032494 3300025928 Bacteria 3723
148 Ga0207664_10160475 3300025929 Bacteria 1917
149 Ga0207690_10102876 3300025932 Bacteria 2043
150 Ga0207690_10306397 3300025932 Bacteria 1244
151 Ga0207706_10442750 3300025933 Bacteria 1124
152 Ga0207686_10130453 3300025934 Bacteria 1723
153 Ga0207709_10000407 3300025935 Bacteria 42024
154 Ga0207669_10243166 3300025937 Bacteria 1335
155 Ga0207665_10001414 3300025939 Bacteria 16140
156 Ga0207665_10011049 3300025939 Bacteria 5925
157 Ga0207665_10188685 3300025939 Bacteria 1496
158 Ga0207691_10014149 3300025940 Bacteria 7612
159 Ga0207691_10931787 3300025940 Bacteria 726
160 Ga0207661_10732353 3300025944 Bacteria 910
161 Ga0207667_10003796 3300025949 Bacteria 18593
162 Ga0207667_10023310 3300025949 Bacteria 6817
163 Ga0207651_10022815 3300025960 Bacteria 3836
164 Ga0207712_10382586 3300025961 Bacteria 1178
165 Ga0207668_10351735 3300025972 Bacteria 1232
166 Ga0207640_10040280 3300025981 Bacteria 2962
167 Ga0207703_10222883 3300026035 Bacteria 1687
168 Ga0207639_10252967 3300026041 Bacteria 1537
169 Ga0207702_10023017 3300026078 Bacteria 5168
170 Ga0207702_10036526 3300026078 Bacteria 4110
171 Ga0207641_10351157 3300026088 Bacteria 1406
172 Ga0207648_10000702 3300026089 Bacteria 37525
173 Ga0207674_10022398 3300026116 Bacteria 6784
174 Ga0207674_11115449 3300026116 Bacteria 758
175 Ga0207698_10193109 3300026142 Bacteria 1816
176 Ga0209588_1092561 3300027671 Bacteria 974
177 Ga0268264_10766757 3300028381 Bacteria 962
178 Ga0265328_10205218 3300031239 Bacteria 749
179 Ga0307412_10000047 3300031911 Bacteria 163617
180 Ga0307412_10000584 3300031911 Bacteria 21597
181 Ga0307412_10003486 3300031911 Bacteria 8741
182 Ga0307412_10879520 3300031911 Bacteria 784
183 Ga0307416_100507744 3300032002 Bacteria 1271
184 Ga0307416_101809209 3300032002 Bacteria 715
185 Ga0307414_10051220 3300032004 Bacteria 2865
186 Ga0307414_10051556 3300032004 Bacteria 2857
187 Ga0307414_10059395 3300032004 Bacteria 2700
188 Ga0307411_10179692 3300032005 Bacteria 1605
189 Ga0373954_0004086 3300035118 Bacteria 6254
190 Ga0373956_0013267 3300035119 Bacteria 3426
191 Ga0373943_0113829 3300035170 Bacteria 1430
192 Ga0373955_0007502 3300035172 Bacteria 5016
193 Ga0373955_0157331 3300035172 Bacteria 1339
194 Ga0373933_0005197 3300035724 Bacteria 7102
195 Ga0373937_0005046 3300036401 Bacteria 11240
196 Ga0373937_0040524 3300036401 Bacteria 4245
197 Ga0373937_0088699 3300036401 Bacteria 2864
198 Ga0373925_0524679 3300037068 Bacteria 973
199 Ga0395900_0007503 3300037418 Bacteria 11268
200 Ga0395898_0001314 3300037466 Bacteria 36175
201 Ga0395898_0395468 3300037466 Bacteria 1318
202 Ga0395901_0158730 3300038443 Bacteria 2375
203 Ga0395901_0502152 3300038443 Bacteria 1235
204 Ga0436365_0009191 3300039437 Bacteria 2347
205 Ga0436365_0657255 3300039437 Bacteria 1254
206 Ga0436365_1462042 3300039437 Bacteria 773
207 Ga0436365_1835429 3300039437 Bacteria 5385
208 Ga0436360_0555544 3300039438 Bacteria 1138
209 Ga0436360_1020136 3300039438 Bacteria 1655
210 Ga0436360_1367606 3300039438 Bacteria 7473
211 Ga0436361_0106094 3300039447 Bacteria 3172
212 Ga0436361_0158143 3300039447 Bacteria 927
213 Ga0436361_0444199 3300039447 Bacteria 1019
214 Ga0436363_0645227 3300039450 Bacteria 4102
215 Ga0436362_0681071 3300039453 Bacteria 857
216 Ga0436362_0864961 3300039453 Bacteria 2116
217 Ga0439465_0005617 3300041413 Bacteria 3994
218 Ga0439442_001005 3300042002 Bacteria 5698
219 Ga0439442_002884 3300042002 Bacteria 3385
220 Ga0439445_0000008 3300042004 Bacteria 25873
221 Ga0451577_0003329 3300042876 Bacteria 18051
222 Ga0451577_0233864 3300042876 Bacteria 1662
223 Ga0451577_0489022 3300042876 Bacteria 1117
224 Ga0466965_0022492 3300044683 Bacteria 3039
225 Ga0466966_0164042 3300044684 Bacteria 1352
226 Ga0466961_0152387 3300044693 Bacteria 1443
227 Ga0466970_0017629 3300044765 Bacteria 3690
228 Ga0466970_0418431 3300044765 Bacteria 766
229 Ga0451576_0295156 3300045051 Bacteria 1695
230 Ga0495627_000025 3300046453 Bacteria 248825
231 Ga0495651_0626727 3300046462 Bacteria 676
232 Ga0495580_0000258 3300046472 Bacteria 42219
233 Ga0495643_0187405 3300046522 Bacteria 1001
234 Ga0495652_0240888 3300046529 Bacteria 1346
235 Ga0495654_0000008 3300046530 Bacteria 398340
236 Ga0495654_0272840 3300046530 Bacteria 698
237 Ga0495587_0121502 3300046536 Bacteria 1496
238 Ga0495621_0015704 3300046539 Bacteria 2418
239 Ga0495645_0099879 3300046543 Bacteria 2065
240 Ga0495633_0000126 3300046558 Bacteria 101794
241 Ga0495633_0001373 3300046558 Bacteria 19021
242 Ga0495625_0001770 3300046660 Bacteria 24960
243 Ga0495657_0119785 3300046675 Bacteria 1659
244 Ga0495657_0278908 3300046675 Bacteria 1001
245 Ga0495623_0406820 3300046679 Bacteria 731
246 Ga0495604_0029734 3300047317 Bacteria 4346
247 Ga0495685_031901 3300047447 Bacteria 1810
248 Ga0495686_0005277 3300047472 Bacteria 10256
249 Ga0495602_0597337 3300048088 Bacteria 759
250 Ga0495615_0022130 3300048090 Bacteria 1442
251 Ga0495615_0106626 3300048090 Bacteria 797
252 Ga0496100_0340395 3300048903 Bacteria 1131
253 Ga0496101_1291639 3300048904 Unclassified 571
254 Ga0496104_0207744 3300048907 Bacteria 1870
255 Ga0496105_0525101 3300048908 Bacteria 927
256 Ga0496107_0677937 3300048910 Bacteria 759
257 Ga0496108_1112491 3300048911 Bacteria 671
258 Ga0496109_0828697 3300048912 Bacteria 863
259 Ga0496115_0350234 3300048918 Bacteria 1205
260 Ga0496122_0000162 3300048925 Bacteria 158851
261 Ga0496122_0070332 3300048925 Bacteria 2501
262 Ga0501032_0001509 3300049569 Bacteria 18594
263 Ga0501032_0018331 3300049569 Bacteria 4905
264 Ga0501033_0020818 3300049570 Bacteria 4951
265 Ga0501034_0044488 3300049571 Bacteria 4490
266 Ga0501034_0135135 3300049571 Bacteria 2447
267 Ga0501034_0344158 3300049571 Bacteria 1420
268 Ga0501036_0008340 3300049572 Bacteria 8489
269 Ga0501037_0092791 3300049573 Bacteria 2183
270 Ga0501038_0017348 3300049574 Bacteria 6508
271 Ga0501042_0098185 3300049578 Bacteria 2106
272 Ga0501043_0007686 3300049579 Bacteria 8538
273 Ga0501046_0010067 3300049580 Bacteria 8143
274 Ga0501048_0001952 3300049582 Bacteria 15673
275 Ga0501067_0002199 3300049583 Bacteria 10770
276 Ga0501068_0071316 3300049584 Bacteria 2121
277 Ga0501069_0002352 3300049585 Bacteria 9576
278 Ga0501069_0420322 3300049585 Bacteria 792
279 Ga0501070_0015000 3300049586 Bacteria 6519
280 Ga0501070_0117933 3300049586 Bacteria 2193
281 Ga0501073_0006661 3300049589 Bacteria 8603
282 Ga0501073_0480409 3300049589 Bacteria 859
283 Ga0501074_0024841 3300049590 Bacteria 4352
284 Ga0501079_0008695 3300049741 Bacteria 7699
285 Ga0501083_0009190 3300049744 Bacteria 6983
286 Ga0501241_000007 3300049758 Bacteria 148190
287 Ga0501269_000041 3300049766 Bacteria 39355
288 Ga0501035_0080813 3300049822 Bacteria 2869
289 Ga0501035_0220399 3300049822 Bacteria 1620
290 Ga0501044_0049855 3300049823 Bacteria 4322
291 nmdc:mga0n895_848883_c1 3300050512 Bacteria 901
292 nmdc:mga08x19_74895_c1 3300050514 Bacteria 2212
293 Ga0495601_0191293 3300053077 Bacteria 1337
294 Ga0500635_0018921 3300053080 Bacteria 2087
295 Ga0495655_0001489 3300053083 Bacteria 3600
296 Ga0495595_0003175 3300053084 Bacteria 6518
297 Ga0495619_0017758 3300053085 Bacteria 4508
298 Ga0500608_000303 3300053122 Bacteria 18987
299 Ga0500619_176348 3300053154 Bacteria 723
300 Ga0501084_0056601 3300054114 Bacteria 3280
301 Ga0501082_0024512 3300060353 Bacteria 5200

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100076420 Ga0068855_1000764203 156
2 3300009093 Ga0105240_10464818 Ga0105240_104648182 156
3 3300009545 Ga0105237_10011772 Ga0105237_100117728 156
4 3300010375 Ga0105239_10002444 Ga0105239_1000244416 156
5 3300017792 Ga0163161_10053854 Ga0163161_100538543 156
6 3300025914 Ga0207671_10010485 Ga0207671_100104855 156
7 3300025949 Ga0207667_10023310 Ga0207667_100233105 156
8 3300005578 Ga0068854_100353757 Ga0068854_1003537571 157
9 3300009545 Ga0105237_10015952 Ga0105237_100159526 157
10 3300025914 Ga0207671_10009628 Ga0207671_100096282 157
11 3300048925 Ga0496122_0070332 Ga0496122_0070332_277_855 158
12 3300053122 Ga0500608_000303 Ga0500608_000303_12840_13442 161
13 3300013104 Ga0157370_10390918 Ga0157370_103909183 162
14 3300015684 Ga0183365_10002 Ga0183365_10002211 162
15 3300049571 Ga0501034_0044488 Ga0501034_0044488_650_1252 162
16 3300049571 Ga0501034_0135135 Ga0501034_0135135_1553_2152 162
17 3300048904 Ga0496101_1291639 Ga0496101_1291639_43_558 165
18 3300045051 Ga0451576_0295156 Ga0451576_0295156_652_1236 167
19 3300003761 Ga0055535_1000104 Ga0055535_100010459 168
20 3300003763 Ga0055529_1000242 Ga0055529_100024232 168
21 3300032002 Ga0307416_101809209 Ga0307416_1018092091 168
22 3300032005 Ga0307411_10179692 Ga0307411_101796921 168
23 3300015261 Ga0182006_1000038 Ga0182006_100003856 169
24 3300053080 Ga0500635_0018921 Ga0500635_0018921_796_1374 169
25 3300053154 Ga0500619_176348 Ga0500619_176348_25_603 169
26 3300035170 Ga0373943_0113829 Ga0373943_0113829_28_609 170
27 3300046522 Ga0495643_0187405 Ga0495643_0187405_123_686 170
28 3300025939 Ga0207665_10001414 Ga0207665_1000141410 171
29 3300009553 Ga0105249_10577626 Ga0105249_105776262 172
30 3300025961 Ga0207712_10382586 Ga0207712_103825862 172
31 3300046472 Ga0495580_0000258 Ga0495580_0000258_10389_10964 172
32 3300005578 Ga0068854_100401859 Ga0068854_1004018592 173
33 3300037418 Ga0395900_0007503 Ga0395900_0007503_3248_3838 173
34 3300037466 Ga0395898_0001314 Ga0395898_0001314_3746_4336 173
35 3300044684 Ga0466966_0164042 Ga0466966_0164042_63_659 173
36 3300044693 Ga0466961_0152387 Ga0466961_0152387_826_1422 173
37 3300005434 Ga0070709_10548064 Ga0070709_105480642 174
38 3300005458 Ga0070681_10285773 Ga0070681_102857732 174
39 3300005543 Ga0070672_100565606 Ga0070672_1005656062 174
40 3300005545 Ga0070695_100009828 Ga0070695_1000098283 174
41 3300005563 Ga0068855_100050383 Ga0068855_1000503834 174
42 3300009093 Ga0105240_10000009 Ga0105240_10000009164 174
43 3300009177 Ga0105248_10212065 Ga0105248_102120653 174
44 3300009551 Ga0105238_10040138 Ga0105238_100401383 174
45 3300025912 Ga0207707_10003060 Ga0207707_1000306013 174
46 3300025913 Ga0207695_10000038 Ga0207695_1000003866 174
47 3300025940 Ga0207691_10931787 Ga0207691_109317871 174
48 3300025949 Ga0207667_10003796 Ga0207667_1000379623 174
49 3300044765 Ga0466970_0418431 Ga0466970_0418431_135_749 174
50 3300005434 Ga0070709_10002476 Ga0070709_1000247615 175
51 3300005439 Ga0070711_100113826 Ga0070711_1001138262 175
52 3300005518 Ga0070699_100127550 Ga0070699_1001275502 175
53 3300017792 Ga0163161_10005044 Ga0163161_100050445 175
54 3300031911 Ga0307412_10879520 Ga0307412_108795201 175
55 3300005466 Ga0070685_10777951 Ga0070685_107779511 177
56 3300025972 Ga0207668_10351735 Ga0207668_103517352 177
57 3300032002 Ga0307416_100507744 Ga0307416_1005077442 177
58 3300039437 Ga0436365_1835429 Ga0436365_1835429_915_1487 177
59 3300039438 Ga0436360_0555544 Ga0436360_0555544_419_997 177
60 3300046679 Ga0495623_0406820 Ga0495623_0406820_78_653 177
61 3300005458 Ga0070681_10201968 Ga0070681_102019683 178
62 3300013104 Ga0157370_10045596 Ga0157370_100455963 178
63 3300025898 Ga0207692_10362302 Ga0207692_103623022 178
64 3300025912 Ga0207707_10170652 Ga0207707_101706522 178
65 3300025932 Ga0207690_10102876 Ga0207690_101028762 178
66 3300031911 Ga0307412_10003486 Ga0307412_1000348610 178
67 3300039437 Ga0436365_0657255 Ga0436365_0657255_584_1159 178
68 3300039453 Ga0436362_0681071 Ga0436362_0681071_41_625 178
69 3300048907 Ga0496104_0207744 Ga0496104_0207744_78_743 178
70 3300049569 Ga0501032_0001509 Ga0501032_0001509_12108_12785 178
71 3300049570 Ga0501033_0020818 Ga0501033_0020818_4096_4773 178
72 3300049571 Ga0501034_0344158 Ga0501034_0344158_282_959 178
73 3300049572 Ga0501036_0008340 Ga0501036_0008340_4826_5503 178
74 3300049573 Ga0501037_0092791 Ga0501037_0092791_229_906 178
75 3300049574 Ga0501038_0017348 Ga0501038_0017348_5586_6263 178
76 3300049578 Ga0501042_0098185 Ga0501042_0098185_295_972 178
77 3300049579 Ga0501043_0007686 Ga0501043_0007686_7772_8449 178
78 3300049580 Ga0501046_0010067 Ga0501046_0010067_4870_5547 178
79 3300049582 Ga0501048_0001952 Ga0501048_0001952_13198_13875 178
80 3300049583 Ga0501067_0002199 Ga0501067_0002199_9947_10624 178
81 3300049584 Ga0501068_0071316 Ga0501068_0071316_636_1313 178
82 3300049585 Ga0501069_0002352 Ga0501069_0002352_3508_4185 178
83 3300049586 Ga0501070_0015000 Ga0501070_0015000_261_938 178
84 3300049589 Ga0501073_0006661 Ga0501073_0006661_5609_6286 178
85 3300049589 Ga0501073_0480409 Ga0501073_0480409_144_731 178
86 3300049590 Ga0501074_0024841 Ga0501074_0024841_1708_2385 178
87 3300049741 Ga0501079_0008695 Ga0501079_0008695_4313_4990 178
88 3300049744 Ga0501083_0009190 Ga0501083_0009190_4725_5402 178
89 3300049822 Ga0501035_0080813 Ga0501035_0080813_463_1140 178
90 3300049822 Ga0501035_0220399 Ga0501035_0220399_117_704 178
91 3300049823 Ga0501044_0049855 Ga0501044_0049855_2751_3338 178
92 3300053077 Ga0495601_0191293 Ga0495601_0191293_97_762 178
93 3300053084 Ga0495595_0003175 Ga0495595_0003175_357_1022 178
94 3300053085 Ga0495619_0017758 Ga0495619_0017758_360_1025 178
95 3300054114 Ga0501084_0056601 Ga0501084_0056601_1253_1930 178
96 3300060353 Ga0501082_0024512 Ga0501082_0024512_137_814 178
97 3300005614 Ga0068856_100111874 Ga0068856_1001118743 179
98 3300026078 Ga0207702_10023017 Ga0207702_100230175 179
99 3300037466 Ga0395898_0395468 Ga0395898_0395468_306_896 179
100 3300042002 Ga0439442_001005 Ga0439442_001005_2512_3114 180
101 3300046530 Ga0495654_0272840 Ga0495654_0272840_81_674 180
102 3300046539 Ga0495621_0015704 Ga0495621_0015704_427_1020 180
103 3300047447 Ga0495685_031901 Ga0495685_031901_1077_1670 180
104 3300048090 Ga0495615_0106626 Ga0495615_0106626_166_759 180
105 iso_pu_bacteria 2511231000 2511233437 181
106 iso_pu_bacteria 2582581281 2585157509 181
107 iso_pu_bacteria 2582581282 2585161907 181
108 iso_pu_bacteria 2585428115 2587942320 181
109 iso_pu_bacteria 2585428187 2588231238 181
110 iso_pu_bacteria 2588254257 2590610781 181
111 iso_pu_bacteria 2728369107 2729202591 181
112 iso_pu_bacteria 2772190705 2772607178 181
113 iso_pu_bacteria 2775506739 2775673898 181
114 iso_pu_bacteria 2841734538 2841739266 181
115 iso_pu_bacteria 2842083920 2842087460 181
116 iso_pu_bacteria 2905999023 2906001377 181
117 iso_pu_bacteria 2919097161 2919100145 181
118 iso_pu_bacteria 2945941187 2945944348 181
119 iso_pu_bacteria 2946019816 2946020105 181
120 iso_pu_bacteria 2968117919 2968120691 181
121 3300010375 Ga0105239_12250938 Ga0105239_122509381 184
122 3300013105 Ga0157369_10565913 Ga0157369_105659131 184
123 3300013307 Ga0157372_10378070 Ga0157372_103780703 184
124 3300044683 Ga0466965_0022492 Ga0466965_0022492_870_1460 184
125 3300044765 Ga0466970_0017629 Ga0466970_0017629_311_901 184
126 3300002773 JGI25152J39213_1001484 JGI25152J39213_10014843 185
127 3300003323 rootH1_10155078 rootH1_101550783 185
128 3300005290 Ga0065712_10086156 Ga0065712_100861561 185
129 3300005327 Ga0070658_10120058 Ga0070658_101200582 185
130 3300005329 Ga0070683_100191701 Ga0070683_1001917013 185
131 3300005333 Ga0070677_10034756 Ga0070677_100347562 185
132 3300005336 Ga0070680_100148422 Ga0070680_1001484222 185
133 3300005336 Ga0070680_100402376 Ga0070680_1004023762 185
134 3300005337 Ga0070682_100160100 Ga0070682_1001601002 185
135 3300005339 Ga0070660_100314416 Ga0070660_1003144162 185
136 3300005340 Ga0070689_100140591 Ga0070689_1001405912 185
137 3300005343 Ga0070687_100004964 Ga0070687_1000049641 185
138 3300005343 Ga0070687_100227586 Ga0070687_1002275862 185
139 3300005345 Ga0070692_10386901 Ga0070692_103869011 185
140 3300005353 Ga0070669_100016909 Ga0070669_1000169092 185
141 3300005354 Ga0070675_100040489 Ga0070675_1000404892 185
142 3300005355 Ga0070671_100673283 Ga0070671_1006732831 185
143 3300005356 Ga0070674_100065823 Ga0070674_1000658234 185
144 3300005365 Ga0070688_100026443 Ga0070688_1000264432 185
145 3300005366 Ga0070659_100205774 Ga0070659_1002057742 185
146 3300005366 Ga0070659_101031251 Ga0070659_1010312511 185
147 3300005367 Ga0070667_100057404 Ga0070667_1000574043 185
148 3300005434 Ga0070709_10112713 Ga0070709_101127132 185
149 3300005435 Ga0070714_100301664 Ga0070714_1003016642 185
150 3300005435 Ga0070714_100496464 Ga0070714_1004964642 185
151 3300005436 Ga0070713_100010620 Ga0070713_1000106202 185
152 3300005436 Ga0070713_100041606 Ga0070713_1000416062 185
153 3300005444 Ga0070694_100919625 Ga0070694_1009196251 185
154 3300005457 Ga0070662_100462884 Ga0070662_1004628842 185
155 3300005458 Ga0070681_10333819 Ga0070681_103338192 185
156 3300005466 Ga0070685_10027388 Ga0070685_100273882 185
157 3300005466 Ga0070685_10027804 Ga0070685_100278042 185
158 3300005535 Ga0070684_100500336 Ga0070684_1005003362 185
159 3300005535 Ga0070684_101213181 Ga0070684_1012131811 185
160 3300005536 Ga0070697_100000063 Ga0070697_10000006342 185
161 3300005539 Ga0068853_100228674 Ga0068853_1002286742 185
162 3300005543 Ga0070672_100358892 Ga0070672_1003588922 185
163 3300005547 Ga0070693_100620075 Ga0070693_1006200751 185
164 3300005548 Ga0070665_100029486 Ga0070665_1000294865 185
165 3300005549 Ga0070704_100302020 Ga0070704_1003020202 185
166 3300005563 Ga0068855_100302890 Ga0068855_1003028902 185
167 3300005577 Ga0068857_100600127 Ga0068857_1006001272 185
168 3300005578 Ga0068854_100236421 Ga0068854_1002364212 185
169 3300005614 Ga0068856_100013171 Ga0068856_1000131713 185
170 3300005617 Ga0068859_100011168 Ga0068859_1000111687 185
171 3300005617 Ga0068859_100256591 Ga0068859_1002565912 185
172 3300005840 Ga0068870_10187238 Ga0068870_101872382 185
173 3300005841 Ga0068863_100744138 Ga0068863_1007441382 185
174 3300005843 Ga0068860_100158585 Ga0068860_1001585852 185
175 3300005843 Ga0068860_100897742 Ga0068860_1008977422 185
176 3300006028 Ga0070717_10000467 Ga0070717_100004677 185
177 3300006028 Ga0070717_10006291 Ga0070717_100062918 185
178 3300006175 Ga0070712_100098897 Ga0070712_1000988972 185
179 3300006175 Ga0070712_100449922 Ga0070712_1004499222 185
180 3300006358 Ga0068871_100049623 Ga0068871_1000496234 185
181 3300006871 Ga0075434_100762916 Ga0075434_1007629162 185
182 3300006914 Ga0075436_100113981 Ga0075436_1001139812 185
183 3300006931 Ga0097620_100011168 Ga0097620_1000111682 185
184 3300006931 Ga0097620_100256588 Ga0097620_1002565882 185
185 3300007265 Ga0099794_10183293 Ga0099794_101832932 185
186 3300007788 Ga0099795_10040689 Ga0099795_100406892 185
187 3300009098 Ga0105245_10259045 Ga0105245_102590452 185
188 3300009147 Ga0114129_10952806 Ga0114129_109528062 185
189 3300009148 Ga0105243_10989720 Ga0105243_109897201 185
190 3300009174 Ga0105241_10175267 Ga0105241_101752672 185
191 3300009174 Ga0105241_10357051 Ga0105241_103570512 185
192 3300009545 Ga0105237_10578289 Ga0105237_105782892 185
193 3300009551 Ga0105238_10031479 Ga0105238_100314792 185
194 3300010159 Ga0099796_10006026 Ga0099796_100060262 185
195 3300011119 Ga0105246_10702910 Ga0105246_107029102 185
196 3300013100 Ga0157373_10277138 Ga0157373_102771382 185
197 3300013306 Ga0163162_11328628 Ga0163162_113286281 185
198 3300013308 Ga0157375_10002392 Ga0157375_100023928 185
199 3300013308 Ga0157375_10290558 Ga0157375_102905583 185
200 3300013308 Ga0157375_10365073 Ga0157375_103650732 185
201 3300014968 Ga0157379_10523156 Ga0157379_105231562 185
202 3300025901 Ga0207688_10036521 Ga0207688_100365212 185
203 3300025903 Ga0207680_10000551 Ga0207680_1000055114 185
204 3300025906 Ga0207699_10171117 Ga0207699_101711172 185
205 3300025908 Ga0207643_10004904 Ga0207643_100049042 185
206 3300025909 Ga0207705_10398023 Ga0207705_103980232 185
207 3300025915 Ga0207693_10002459 Ga0207693_1000245914 185
208 3300025915 Ga0207693_10400157 Ga0207693_104001572 185
209 3300025916 Ga0207663_10256016 Ga0207663_102560162 185
210 3300025917 Ga0207660_10354349 Ga0207660_103543491 185
211 3300025918 Ga0207662_10001567 Ga0207662_100015672 185
212 3300025918 Ga0207662_10008637 Ga0207662_100086374 185
213 3300025921 Ga0207652_10301106 Ga0207652_103011062 185
214 3300025923 Ga0207681_10285279 Ga0207681_102852792 185
215 3300025924 Ga0207694_11104210 Ga0207694_111042101 185
216 3300025925 Ga0207650_10146933 Ga0207650_101469332 185
217 3300025926 Ga0207659_10191576 Ga0207659_101915763 185
218 3300025926 Ga0207659_10325473 Ga0207659_103254732 185
219 3300025927 Ga0207687_10173335 Ga0207687_101733352 185
220 3300025928 Ga0207700_10032494 Ga0207700_100324944 185
221 3300025929 Ga0207664_10160475 Ga0207664_101604752 185
222 3300025932 Ga0207690_10306397 Ga0207690_103063971 185
223 3300025933 Ga0207706_10442750 Ga0207706_104427502 185
224 3300025937 Ga0207669_10243166 Ga0207669_102431662 185
225 3300025939 Ga0207665_10188685 Ga0207665_101886852 185
226 3300025940 Ga0207691_10014149 Ga0207691_100141492 185
227 3300025944 Ga0207661_10732353 Ga0207661_107323532 185
228 3300025960 Ga0207651_10022815 Ga0207651_100228152 185
229 3300025981 Ga0207640_10040280 Ga0207640_100402802 185
230 3300026035 Ga0207703_10222883 Ga0207703_102228832 185
231 3300026041 Ga0207639_10252967 Ga0207639_102529672 185
232 3300026078 Ga0207702_10036526 Ga0207702_100365264 185
233 3300026088 Ga0207641_10351157 Ga0207641_103511572 185
234 3300026116 Ga0207674_10022398 Ga0207674_100223984 185
235 3300026116 Ga0207674_11115449 Ga0207674_111154491 185
236 3300026142 Ga0207698_10193109 Ga0207698_101931092 185
237 3300027671 Ga0209588_1092561 Ga0209588_10925612 185
238 3300028381 Ga0268264_10766757 Ga0268264_107667572 185
239 3300031239 Ga0265328_10205218 Ga0265328_102052181 185
240 3300031911 Ga0307412_10000047 Ga0307412_10000047115 185
241 3300031911 Ga0307412_10000584 Ga0307412_1000058417 185
242 3300032004 Ga0307414_10051220 Ga0307414_100512205 185
243 3300032004 Ga0307414_10051556 Ga0307414_100515565 185
244 3300032004 Ga0307414_10059395 Ga0307414_100593953 185
245 3300035118 Ga0373954_0004086 Ga0373954_0004086_727_1314 185
246 3300035119 Ga0373956_0013267 Ga0373956_0013267_485_1072 185
247 3300035172 Ga0373955_0007502 Ga0373955_0007502_1880_2467 185
248 3300035172 Ga0373955_0157331 Ga0373955_0157331_696_1271 185
249 3300035724 Ga0373933_0005197 Ga0373933_0005197_2049_2636 185
250 3300036401 Ga0373937_0005046 Ga0373937_0005046_1698_2285 185
251 3300036401 Ga0373937_0040524 Ga0373937_0040524_3220_3795 185
252 3300036401 Ga0373937_0088699 Ga0373937_0088699_567_1142 185
253 3300037068 Ga0373925_0524679 Ga0373925_0524679_316_891 185
254 3300038443 Ga0395901_0158730 Ga0395901_0158730_657_1226 185
255 3300038443 Ga0395901_0502152 Ga0395901_0502152_160_729 185
256 3300039437 Ga0436365_0009191 Ga0436365_0009191_799_1377 185
257 3300039437 Ga0436365_1462042 Ga0436365_1462042_114_695 185
258 3300039438 Ga0436360_1020136 Ga0436360_1020136_180_755 185
259 3300039447 Ga0436361_0158143 Ga0436361_0158143_293_877 185
260 3300039447 Ga0436361_0444199 Ga0436361_0444199_384_974 185
261 3300039450 Ga0436363_0645227 Ga0436363_0645227_1127_1738 185
262 3300039453 Ga0436362_0864961 Ga0436362_0864961_52_627 185
263 3300041413 Ga0439465_0005617 Ga0439465_0005617_2690_3268 185
264 3300042002 Ga0439442_002884 Ga0439442_002884_636_1223 185
265 3300042004 Ga0439445_0000008 Ga0439445_0000008_22342_22920 185
266 3300042876 Ga0451577_0003329 Ga0451577_0003329_3205_3801 185
267 3300042876 Ga0451577_0233864 Ga0451577_0233864_311_886 185
268 3300046453 Ga0495627_000025 Ga0495627_000025_18350_18931 185
269 3300046462 Ga0495651_0626727 Ga0495651_0626727_59_646 185
270 3300046529 Ga0495652_0240888 Ga0495652_0240888_377_952 185
271 3300046530 Ga0495654_0000008 Ga0495654_0000008_129405_129986 185
272 3300046536 Ga0495587_0121502 Ga0495587_0121502_835_1410 185
273 3300046543 Ga0495645_0099879 Ga0495645_0099879_192_767 185
274 3300046558 Ga0495633_0000126 Ga0495633_0000126_82007_82585 185
275 3300046558 Ga0495633_0001373 Ga0495633_0001373_12024_12602 185
276 3300046660 Ga0495625_0001770 Ga0495625_0001770_1703_2281 185
277 3300046675 Ga0495657_0119785 Ga0495657_0119785_406_993 185
278 3300046675 Ga0495657_0278908 Ga0495657_0278908_216_791 185
279 3300047317 Ga0495604_0029734 Ga0495604_0029734_1815_2390 185
280 3300047472 Ga0495686_0005277 Ga0495686_0005277_5487_6068 185
281 3300048088 Ga0495602_0597337 Ga0495602_0597337_16_591 185
282 3300048090 Ga0495615_0022130 Ga0495615_0022130_702_1289 185
283 3300048903 Ga0496100_0340395 Ga0496100_0340395_301_876 185
284 3300048908 Ga0496105_0525101 Ga0496105_0525101_37_663 185
285 3300048910 Ga0496107_0677937 Ga0496107_0677937_167_742 185
286 3300048911 Ga0496108_1112491 Ga0496108_1112491_80_658 185
287 3300048912 Ga0496109_0828697 Ga0496109_0828697_52_627 185
288 3300048918 Ga0496115_0350234 Ga0496115_0350234_406_984 185
289 3300048925 Ga0496122_0000162 Ga0496122_0000162_142584_143162 185
290 3300049569 Ga0501032_0018331 Ga0501032_0018331_3970_4554 185
291 3300049585 Ga0501069_0420322 Ga0501069_0420322_114_686 185
292 3300049586 Ga0501070_0117933 Ga0501070_0117933_1487_2071 185
293 3300049758 Ga0501241_000007 Ga0501241_000007_42600_43178 185
294 3300049766 Ga0501269_000041 Ga0501269_000041_32257_32835 185
295 3300050512 nmdc:mga0n895_848883_c1 nmdc:mga0n895_848883_c1_154_753 185
296 3300050514 nmdc:mga08x19_74895_c1 nmdc:mga08x19_74895_c1_1503_2081 185
297 3300053083 Ga0495655_0001489 Ga0495655_0001489_2412_2987 185
298 3300005288 Ga0065714_10200722 Ga0065714_102007221 186
299 3300005337 Ga0070682_100432979 Ga0070682_1004329791 186
300 3300005439 Ga0070711_100118984 Ga0070711_1001189842 186
301 3300006175 Ga0070712_100039823 Ga0070712_1000398232 186
302 3300013104 Ga0157370_10033239 Ga0157370_100332392 186
303 3300025915 Ga0207693_10050511 Ga0207693_100505115 186
304 3300025916 Ga0207663_10090530 Ga0207663_100905303 186
305 3300025939 Ga0207665_10011049 Ga0207665_100110495 186
306 3300042876 Ga0451577_0489022 Ga0451577_0489022_389_994 187
307 3300001977 JGI24746J21847_1003221 JGI24746J21847_10032213 189
308 3300005288 Ga0065714_10165377 Ga0065714_101653771 189
309 3300005459 Ga0068867_100000956 Ga0068867_10000095610 189
310 3300005564 Ga0070664_100007666 Ga0070664_1000076669 189
311 3300005937 Ga0081455_10000760 Ga0081455_1000076030 189
312 3300009148 Ga0105243_10000065 Ga0105243_1000006569 189
313 3300025934 Ga0207686_10130453 Ga0207686_101304532 189
314 3300025935 Ga0207709_10000407 Ga0207709_1000040712 189
315 3300026089 Ga0207648_10000702 Ga0207648_1000070224 189
316 3300039438 Ga0436360_1367606 Ga0436360_1367606_5545_6168 189
317 3300039447 Ga0436361_0106094 Ga0436361_0106094_527_1150 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06736

TMEM175

Endosomal/lysosomal potassium channel TMEM175

32

109

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8773 3 179
5vre-assembly1.cif.gz_D crystal structure of a lysosomal potassium-selective channel tmem175 homolog from chamaesiphon minutus 0.8244 3 179
6w8p-assembly1.cif.gz_B structure of membrane protein with ions 0.7924 1 179
6w8p-assembly1.cif.gz_A structure of membrane protein with ions 0.7893 1 179
7lf6-assembly1.cif.gz_B structure of lysosomal membrane protein 0.7866 1 181
ID Description Score Start End Superfamily
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.6876 1 126 1.20.930.20
af_A0A0R0HUX5_50_167_1.20.930.20 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Adaptor protein Cbl, N-terminal domain 0.678 1 126 1.20.930.20
af_Q8MZ67_1_133_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6145 41 178 1.20.140.150
af_A0A0R0HFK2_1_219_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.5981 7 128 1.20.1420.10
af_A0A1D6Q0X7_1_285_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.5841 1 176 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A2U3QFG1-F1-model_v4 DUF1211 domain-containing protein 0.9928 1 185 GO:0005267
GO:0015252
GO:0016020
AF-A0A0K8Q9U3-F1-model_v4 Transmembrane protein 175 0.9893 3 184 GO:0005267
GO:0015252
GO:0016020
AF-A0A7V8XUC2-F1-model_v4 DUF1211 domain-containing protein 0.9882 1 185 GO:0005267
GO:0015252
GO:0016020
AF-V4P709-F1-model_v4 DUF1211 domain-containing protein 0.988 1 184 GO:0005267
GO:0015252
GO:0016020
AF-A0A2V5PTR6-F1-model_v4 DUF1211 domain-containing protein 0.986 1 175 GO:0005267
GO:0015252
GO:0016020

Feature Viewer

pLDDT pTM Quality
87.24 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map