F404162

General Info

Members Datasets Scaffolds Average Seq Length
317 160 634 174

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10027777|Ga0157380_100277773
Length 192
Sequence MLKQVQHDGTGDHMRLIVTLGALFLSTPASAAVLSAGDNGFEVQQTVNLVVAQPEAYNSFGRIGQWWNSEHSYSGDASRMTLQLRSGGCFCEPLDNGGGIEHMRVTFVQPGERIVLTGSLGPLLYEATAGVMDVKFERIAGGTRVTMNYRAAGFAKGGAAAMAPIVDQVLGDQMKRYRAYAAAAPKTDTLKP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
122 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
123 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
124 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
125 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
126 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
127 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
128 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
136 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
157 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.99
Rhizosphere 93.38
Stem 0
Stem Tuber 0.32
Unclassified 7.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10027777 3300014326 Bacteria 4306
2 MBSR1b_contig_2987166 2162886012 Bacteria 1276
3 MBSR1b_contig_8739678 2162886012 Bacteria 1055
4 JGI24741J21665_1001366 3300001915 Bacteria 7050
5 JGI24740J21852_10003053 3300001979 Bacteria 7401
6 JGI24737J22298_10011180 3300001990 Bacteria 2945
7 JGI24735J21928_10007957 3300002067 Bacteria 3443
8 Ga0065712_10257148 3300005290 Unclassified 945
9 Ga0065715_10103029 3300005293 Bacteria 3065
10 Ga0065715_10106682 3300005293 Bacteria 2815
11 Ga0065715_10170368 3300005293 Bacteria 1535
12 Ga0070658_10051375 3300005327 Bacteria 3341
13 Ga0070658_10986983 3300005327 Unclassified 732
14 Ga0070676_10058417 3300005328 Bacteria 2286
15 Ga0070683_100023332 3300005329 Bacteria 5534
16 Ga0070670_100122984 3300005331 Bacteria 2239
17 Ga0070670_100195479 3300005331 Bacteria 1757
18 Ga0070670_100566955 3300005331 Bacteria 1014
19 Ga0070670_101043186 3300005331 Unclassified 744
20 Ga0070677_10170957 3300005333 Bacteria 1027
21 Ga0070666_10303215 3300005335 Bacteria 1138
22 Ga0070680_100017196 3300005336 Bacteria 5698
23 Ga0070680_100976305 3300005336 Bacteria 731
24 Ga0070682_100003890 3300005337 Bacteria 8289
25 Ga0070660_100143944 3300005339 Bacteria 1914
26 Ga0070660_100332062 3300005339 Bacteria 1250
27 Ga0070660_100459342 3300005339 Bacteria 1057
28 Ga0070661_100099010 3300005344 Bacteria 2166
29 Ga0070692_10015668 3300005345 Bacteria 3590
30 Ga0070669_100019732 3300005353 Bacteria 4816
31 Ga0070669_100398814 3300005353 Bacteria 1125
32 Ga0070675_100052719 3300005354 Bacteria 3344
33 Ga0070675_100716682 3300005354 Unclassified 912
34 Ga0070671_100020526 3300005355 Bacteria 5389
35 Ga0070671_100024937 3300005355 Bacteria 4900
36 Ga0070671_100034289 3300005355 Bacteria 4202
37 Ga0070671_100070317 3300005355 Bacteria 2920
38 Ga0070659_100002734 3300005366 Bacteria 12548
39 Ga0070659_100058458 3300005366 Bacteria 3043
40 Ga0070659_100169484 3300005366 Bacteria 1788
41 Ga0070659_100288927 3300005366 Bacteria 1365
42 Ga0070659_100988033 3300005366 Unclassified 738
43 Ga0070667_100059440 3300005367 Bacteria 3233
44 Ga0070667_100617267 3300005367 Bacteria 1000
45 Ga0070714_100017293 3300005435 Bacteria 5839
46 Ga0070694_100027966 3300005444 Bacteria 3666
47 Ga0070663_100027619 3300005455 Bacteria 3855
48 Ga0070663_100058095 3300005455 Bacteria 2777
49 Ga0070663_100706453 3300005455 Unclassified 857
50 Ga0070678_100488756 3300005456 Bacteria 1084
51 Ga0070662_100007065 3300005457 Bacteria 7264
52 Ga0070662_100023385 3300005457 Bacteria 4244
53 Ga0070662_100051344 3300005457 Bacteria 2977
54 Ga0070662_100175883 3300005457 Bacteria 1684
55 Ga0070662_100180290 3300005457 Bacteria 1665
56 Ga0070662_100230588 3300005457 Bacteria 1481
57 Ga0070662_101085348 3300005457 Unclassified 686
58 Ga0070681_10103408 3300005458 Bacteria 2792
59 Ga0070681_10140056 3300005458 Bacteria 2349
60 Ga0070681_10199731 3300005458 Bacteria 1918
61 Ga0070681_11122461 3300005458 Bacteria 707
62 Ga0068867_100193233 3300005459 Bacteria 1625
63 Ga0070684_100338594 3300005535 Bacteria 1383
64 Ga0068853_100103228 3300005539 Bacteria 2523
65 Ga0070672_100139595 3300005543 Bacteria 1998
66 Ga0070686_100491869 3300005544 Bacteria 950
67 Ga0070696_100019277 3300005546 Bacteria 4618
68 Ga0070693_100077022 3300005547 Bacteria 1978
69 Ga0070693_100152694 3300005547 Bacteria 1464
70 Ga0070693_100470698 3300005547 Unclassified 886
71 Ga0070665_100048745 3300005548 Bacteria 4252
72 Ga0070704_100338444 3300005549 Bacteria 1266
73 Ga0070664_100783660 3300005564 Bacteria 891
74 Ga0068857_100034034 3300005577 Bacteria 4508
75 Ga0068854_100018571 3300005578 Bacteria 4671
76 Ga0068852_100183920 3300005616 Bacteria 1967
77 Ga0068852_100222408 3300005616 Bacteria 1796
78 Ga0068852_100675634 3300005616 Unclassified 1042
79 Ga0068864_100014693 3300005618 Bacteria 6503
80 Ga0068866_10079609 3300005718 Bacteria 1756
81 Ga0068861_100608175 3300005719 Bacteria 1004
82 Ga0068870_10065451 3300005840 Bacteria 1966
83 Ga0068863_100027764 3300005841 Bacteria 5401
84 Ga0068858_100621942 3300005842 Bacteria 1048
85 Ga0068858_101038151 3300005842 Unclassified 804
86 Ga0068862_100106655 3300005844 Bacteria 2456
87 Ga0081539_10019920 3300005985 Bacteria 4566
88 Ga0070717_10007362 3300006028 Bacteria 8173
89 Ga0111539_10104174 3300009094 Bacteria 3329
90 Ga0111539_10357496 3300009094 Bacteria 1700
91 Ga0105243_10165695 3300009148 Bacteria 1910
92 Ga0105248_10024003 3300009177 Bacteria 6778
93 Ga0105248_10043820 3300009177 Bacteria 5018
94 Ga0105248_10073028 3300009177 Bacteria 3856
95 Ga0105248_10576253 3300009177 Bacteria 1270
96 Ga0105248_11419476 3300009177 Unclassified 786
97 Ga0157373_10082279 3300013100 Bacteria 2269
98 Ga0157373_10183598 3300013100 Bacteria 1473
99 Ga0157370_10161216 3300013104 Bacteria 2086
100 Ga0157369_10711010 3300013105 Bacteria 1034
101 Ga0157374_10457937 3300013296 Bacteria 1277
102 Ga0163162_10709172 3300013306 Bacteria 1127
103 Ga0157372_10066145 3300013307 Bacteria 4061
104 Ga0157372_10599183 3300013307 Bacteria 1284
105 Ga0157375_10032482 3300013308 Bacteria 4951
106 Ga0157375_12108049 3300013308 Unclassified 671
107 Ga0157380_10023673 3300014326 Bacteria 4636
108 Ga0163161_10031851 3300017792 Bacteria 3760
109 Ga0207697_10080160 3300025315 Bacteria 1375
110 Ga0207656_10012178 3300025321 Bacteria 3266
111 Ga0207682_10013748 3300025893 Bacteria 3151
112 Ga0207688_10628322 3300025901 Unclassified 678
113 Ga0207647_10025948 3300025904 Bacteria 3840
114 Ga0207645_10162158 3300025907 Bacteria 1463
115 Ga0207645_10310254 3300025907 Bacteria 1051
116 Ga0207643_10074757 3300025908 Bacteria 1954
117 Ga0207705_10012492 3300025909 Bacteria 6135
118 Ga0207705_10019294 3300025909 Bacteria 4875
119 Ga0207705_10102053 3300025909 Bacteria 2111
120 Ga0207707_10015540 3300025912 Bacteria 6630
121 Ga0207707_10183943 3300025912 Bacteria 1824
122 Ga0207707_10497360 3300025912 Bacteria 1040
123 Ga0207707_10953072 3300025912 Bacteria 707
124 Ga0207660_10015389 3300025917 Bacteria 5047
125 Ga0207660_10116485 3300025917 Bacteria 2018
126 Ga0207660_10535766 3300025917 Bacteria 952
127 Ga0207660_10837261 3300025917 Bacteria 751
128 Ga0207657_10005799 3300025919 Bacteria 12867
129 Ga0207657_10273069 3300025919 Bacteria 1344
130 Ga0207649_10027392 3300025920 Bacteria 3343
131 Ga0207649_10545220 3300025920 Bacteria 887
132 Ga0207652_10016611 3300025921 Bacteria 6013
133 Ga0207652_10697154 3300025921 Bacteria 906
134 Ga0207681_10066425 3300025923 Bacteria 2497
135 Ga0207681_10370958 3300025923 Bacteria 1150
136 Ga0207650_10196699 3300025925 Bacteria 1613
137 Ga0207650_10315955 3300025925 Bacteria 1278
138 Ga0207650_10745697 3300025925 Unclassified 828
139 Ga0207659_10075369 3300025926 Bacteria 2475
140 Ga0207700_10029283 3300025928 Bacteria 3883
141 Ga0207664_10121321 3300025929 Bacteria 2188
142 Ga0207664_10121865 3300025929 Bacteria 2183
143 Ga0207644_10002343 3300025931 Bacteria 12231
144 Ga0207644_10017018 3300025931 Bacteria 4901
145 Ga0207644_10170882 3300025931 Bacteria 1697
146 Ga0207644_10280660 3300025931 Bacteria 1337
147 Ga0207690_10002874 3300025932 Bacteria 10374
148 Ga0207690_10020755 3300025932 Bacteria 4063
149 Ga0207690_10357975 3300025932 Bacteria 1155
150 Ga0207690_10753510 3300025932 Unclassified 803
151 Ga0207706_10025922 3300025933 Bacteria 5250
152 Ga0207706_10059135 3300025933 Bacteria 3375
153 Ga0207706_10060415 3300025933 Bacteria 3338
154 Ga0207706_10295040 3300025933 Bacteria 1413
155 Ga0207669_10009252 3300025937 Bacteria 4680
156 Ga0207691_10279360 3300025940 Bacteria 1437
157 Ga0207711_10004929 3300025941 Bacteria 11336
158 Ga0207711_10051893 3300025941 Bacteria 3514
159 Ga0207661_10008889 3300025944 Bacteria 7192
160 Ga0207679_10049553 3300025945 Bacteria 3065
161 Ga0207679_10107946 3300025945 Bacteria 2191
162 Ga0207667_10040812 3300025949 Bacteria 4939
163 Ga0207668_10352299 3300025972 Bacteria 1231
164 Ga0207668_10575700 3300025972 Bacteria 978
165 Ga0207640_10018880 3300025981 Bacteria 4060
166 Ga0207658_10014744 3300025986 Bacteria 5355
167 Ga0207658_10963379 3300025986 Unclassified 778
168 Ga0207639_10017359 3300026041 Bacteria 5101
169 Ga0207678_10055716 3300026067 Bacteria 3405
170 Ga0207678_10265732 3300026067 Bacteria 1471
171 Ga0207678_10680409 3300026067 Unclassified 905
172 Ga0207641_10069461 3300026088 Bacteria 3024
173 Ga0207676_10010620 3300026095 Bacteria 6564
174 Ga0207676_10570966 3300026095 Bacteria 1083
175 Ga0207675_100138506 3300026118 Bacteria 2311
176 Ga0207675_100639868 3300026118 Bacteria 1069
177 Ga0207698_10097058 3300026142 Bacteria 2431
178 Ga0207698_10149300 3300026142 Bacteria 2026
179 Ga0207698_10804031 3300026142 Bacteria 943
180 Ga0207698_11351773 3300026142 Unclassified 727
181 Ga0209974_10071487 3300027876 Unclassified 1184
182 Ga0268266_10027292 3300028379 Bacteria 4855
183 Ga0268266_10292794 3300028379 Bacteria 1516
184 Ga0307408_100145765 3300031548 Bacteria 1863
185 Ga0307405_10228495 3300031731 Bacteria 1370
186 Ga0307405_10457560 3300031731 Bacteria 1013
187 Ga0307405_10531277 3300031731 Bacteria 948
188 Ga0307413_10004416 3300031824 Bacteria 6117
189 Ga0307413_10014276 3300031824 Bacteria 4027
190 Ga0307413_10048679 3300031824 Bacteria 2536
191 Ga0307413_10113569 3300031824 Bacteria 1818
192 Ga0307413_11530313 3300031824 Unclassified 590
193 Ga0307410_10002931 3300031852 Bacteria 8413
194 Ga0307410_10003803 3300031852 Bacteria 7662
195 Ga0307410_10004779 3300031852 Bacteria 7069
196 Ga0307410_10166642 3300031852 Bacteria 1656
197 Ga0307410_10179874 3300031852 Bacteria 1600
198 Ga0307410_10580340 3300031852 Bacteria 933
199 Ga0307410_10636522 3300031852 Bacteria 893
200 Ga0307410_10760414 3300031852 Bacteria 821
201 Ga0307406_10015733 3300031901 Bacteria 4384
202 Ga0307406_10017301 3300031901 Bacteria 4198
203 Ga0307406_10341402 3300031901 Bacteria 1167
204 Ga0307407_10007392 3300031903 Bacteria 4972
205 Ga0307407_10034480 3300031903 Bacteria 2771
206 Ga0307407_10738284 3300031903 Unclassified 744
207 Ga0307412_10024013 3300031911 Bacteria 3759
208 Ga0307412_10084853 3300031911 Bacteria 2200
209 Ga0307412_10427508 3300031911 Bacteria 1085
210 Ga0307412_10556393 3300031911 Bacteria 964
211 Ga0307412_10843264 3300031911 Bacteria 799
212 Ga0307412_11004120 3300031911 Bacteria 737
213 Ga0307412_11422145 3300031911 Unclassified 628
214 Ga0307409_100064651 3300031995 Bacteria 2875
215 Ga0307409_100104349 3300031995 Bacteria 2360
216 Ga0307409_100108557 3300031995 Bacteria 2321
217 Ga0307409_100185883 3300031995 Bacteria 1844
218 Ga0307409_100237508 3300031995 Bacteria 1657
219 Ga0307409_100733281 3300031995 Bacteria 990
220 Ga0307416_100003354 3300032002 Bacteria 9377
221 Ga0307416_100023631 3300032002 Bacteria 4466
222 Ga0307416_100036569 3300032002 Bacteria 3767
223 Ga0307416_100123783 3300032002 Bacteria 2312
224 Ga0307416_100486530 3300032002 Bacteria 1295
225 Ga0307416_101002449 3300032002 Bacteria 938
226 Ga0307414_10011560 3300032004 Bacteria 5182
227 Ga0307414_10067139 3300032004 Bacteria 2567
228 Ga0307414_10152779 3300032004 Bacteria 1823
229 Ga0307411_10012883 3300032005 Bacteria 4585
230 Ga0307411_10017521 3300032005 Bacteria 4084
231 Ga0307411_10030283 3300032005 Bacteria 3315
232 Ga0307411_10155860 3300032005 Bacteria 1703
233 Ga0307411_10188724 3300032005 Bacteria 1572
234 Ga0307411_10560629 3300032005 Bacteria 976
235 Ga0307411_10642080 3300032005 Bacteria 918
236 Ga0307411_11044982 3300032005 Bacteria 733
237 Ga0307415_100001689 3300032126 Bacteria 10719
238 Ga0307415_100002843 3300032126 Bacteria 8667
239 Ga0307415_100285997 3300032126 Bacteria 1358
240 Ga0307415_100539612 3300032126 Bacteria 1027
241 Ga0307415_101068312 3300032126 Bacteria 754
242 Ga0307415_101079056 3300032126 Bacteria 751
243 Ga0395899_0051933 3300037312 Bacteria 3041
244 Ga0395900_0017794 3300037418 Bacteria 7256
245 Ga0395900_0019486 3300037418 Bacteria 6917
246 Ga0395900_0108155 3300037418 Bacteria 2857
247 Ga0395900_0316992 3300037418 Bacteria 1541
248 Ga0395900_0429662 3300037418 Bacteria 1280
249 Ga0395898_0084958 3300037466 Bacteria 3051
250 Ga0395898_0475577 3300037466 Bacteria 1189
251 Ga0395898_1016246 3300037466 Bacteria 764
252 Ga0395905_0011337 3300037471 Bacteria 8620
253 Ga0395905_0021621 3300037471 Bacteria 6084
254 Ga0395905_0374449 3300037471 Bacteria 1317
255 Ga0395905_0434213 3300037471 Bacteria 1210
256 Ga0395901_0063949 3300038443 Bacteria 3829
257 Ga0395901_0102425 3300038443 Bacteria 3005
258 Ga0395901_0281663 3300038443 Bacteria 1727
259 Ga0395901_0410462 3300038443 Bacteria 1390
260 Ga0395901_0579355 3300038443 Bacteria 1134
261 Ga0395901_0641071 3300038443 Bacteria 1067
262 Ga0439465_0183952 3300041413 Bacteria 757
263 Ga0451841_0950211 3300041498 Bacteria 1723
264 Ga0439437_020630 3300042000 Unclassified 796
265 Ga0439449_0071550 3300042007 Bacteria 1278
266 Ga0450912_017276 3300042116 Unclassified 674
267 Ga0450917_004634 3300042120 Bacteria 1008
268 Ga0450920_007810 3300042122 Bacteria 1943
269 Ga0450892_003849 3300042130 Bacteria 1229
270 Ga0450905_002327 3300042142 Bacteria 2438
271 Ga0450889_000192 3300042144 Bacteria 6656
272 Ga0439446_0015273 3300042156 Bacteria 2129
273 Ga0439458_0013843 3300042157 Bacteria 1817
274 Ga0466972_0069645 3300044658 Bacteria 1679
275 Ga0466965_0043965 3300044683 Bacteria 2207
276 Ga0466963_0042545 3300044694 Bacteria 2983
277 Ga0466963_0481574 3300044694 Bacteria 876
278 Ga0466964_0002092 3300044706 Bacteria 7025
279 Ga0466971_0242072 3300044719 Unclassified 858
280 Ga0466968_0002403 3300044735 Bacteria 6863
281 Ga0466970_0003469 3300044765 Bacteria 7681
282 Ga0466970_0259926 3300044765 Bacteria 974
283 Ga0466957_0062922 3300044842 Bacteria 2280
284 Ga0466957_0291067 3300044842 Bacteria 1095
285 Ga0466959_0076377 3300045049 Bacteria 2419
286 Ga0466958_0002338 3300045836 Bacteria 9475
287 Ga0466958_0016057 3300045836 Bacteria 4306
288 Ga0466967_0042289 3300045976 Bacteria 3936
289 Ga0466967_0081980 3300045976 Bacteria 2914
290 Ga0466967_0109064 3300045976 Bacteria 2541
291 Ga0495598_0069428 3300046537 Bacteria 1106
292 Ga0495669_0518320 3300046684 Bacteria 580
293 Ga0496100_0337267 3300048903 Bacteria 1136
294 Ga0496101_0076668 3300048904 Bacteria 2463
295 Ga0496101_0221690 3300048904 Bacteria 1468
296 Ga0496106_0999592 3300048909 Bacteria 658
297 Ga0496107_0231202 3300048910 Bacteria 1376
298 Ga0496108_0029105 3300048911 Bacteria 4572
299 Ga0496109_0013454 3300048912 Bacteria 7098
300 Ga0496109_0061944 3300048912 Bacteria 3421
301 Ga0496109_0206436 3300048912 Bacteria 1847
302 Ga0496110_0037730 3300048913 Bacteria 4201
303 Ga0496110_0341819 3300048913 Bacteria 1363
304 Ga0496112_0010644 3300048915 Bacteria 8355
305 Ga0496112_0169449 3300048915 Bacteria 2149
306 Ga0496112_0205508 3300048915 Bacteria 1928
307 Ga0496113_0013267 3300048916 Bacteria 5576
308 Ga0496113_0194045 3300048916 Bacteria 1613
309 Ga0496114_0036970 3300048917 Bacteria 4037
310 Ga0496114_0230694 3300048917 Bacteria 1626
311 Ga0496115_0034866 3300048918 Bacteria 3977
312 Ga0501069_0042599 3300049585 Bacteria 2512
313 Ga0501263_040778 3300049760 Bacteria 682
314 Ga0501268_013895 3300049765 Bacteria 1306
315 nmdc:mga08y16_92087_c1 3300050511 Bacteria 3159
316 Ga0466962_0139892 3300061719 Bacteria 1172
317 2885427592 2885427238 Bacteria 2291351
318 Ga0157380_10027777
319 MBSR1b_contig_2987166
320 MBSR1b_contig_8739678
321 JGI24741J21665_1001366
322 JGI24740J21852_10003053
323 JGI24737J22298_10011180
324 JGI24735J21928_10007957
325 Ga0065712_10257148
326 Ga0065715_10103029
327 Ga0065715_10106682
328 Ga0065715_10170368
329 Ga0070658_10051375
330 Ga0070658_10986983
331 Ga0070676_10058417
332 Ga0070683_100023332
333 Ga0070670_100122984
334 Ga0070670_100195479
335 Ga0070670_100566955
336 Ga0070670_101043186
337 Ga0070677_10170957
338 Ga0070666_10303215
339 Ga0070680_100017196
340 Ga0070680_100976305
341 Ga0070682_100003890
342 Ga0070660_100143944
343 Ga0070660_100332062
344 Ga0070660_100459342
345 Ga0070661_100099010
346 Ga0070692_10015668
347 Ga0070669_100019732
348 Ga0070669_100398814
349 Ga0070675_100052719
350 Ga0070675_100716682
351 Ga0070671_100020526
352 Ga0070671_100024937
353 Ga0070671_100034289
354 Ga0070671_100070317
355 Ga0070659_100002734
356 Ga0070659_100058458
357 Ga0070659_100169484
358 Ga0070659_100288927
359 Ga0070659_100988033
360 Ga0070667_100059440
361 Ga0070667_100617267
362 Ga0070714_100017293
363 Ga0070694_100027966
364 Ga0070663_100027619
365 Ga0070663_100058095
366 Ga0070663_100706453
367 Ga0070678_100488756
368 Ga0070662_100007065
369 Ga0070662_100023385
370 Ga0070662_100051344
371 Ga0070662_100175883
372 Ga0070662_100180290
373 Ga0070662_100230588
374 Ga0070662_101085348
375 Ga0070681_10103408
376 Ga0070681_10140056
377 Ga0070681_10199731
378 Ga0070681_11122461
379 Ga0068867_100193233
380 Ga0070684_100338594
381 Ga0068853_100103228
382 Ga0070672_100139595
383 Ga0070686_100491869
384 Ga0070696_100019277
385 Ga0070693_100077022
386 Ga0070693_100152694
387 Ga0070693_100470698
388 Ga0070665_100048745
389 Ga0070704_100338444
390 Ga0070664_100783660
391 Ga0068857_100034034
392 Ga0068854_100018571
393 Ga0068852_100183920
394 Ga0068852_100222408
395 Ga0068852_100675634
396 Ga0068864_100014693
397 Ga0068866_10079609
398 Ga0068861_100608175
399 Ga0068870_10065451
400 Ga0068863_100027764
401 Ga0068858_100621942
402 Ga0068858_101038151
403 Ga0068862_100106655
404 Ga0081539_10019920
405 Ga0070717_10007362
406 Ga0111539_10104174
407 Ga0111539_10357496
408 Ga0105243_10165695
409 Ga0105248_10024003
410 Ga0105248_10043820
411 Ga0105248_10073028
412 Ga0105248_10576253
413 Ga0105248_11419476
414 Ga0157373_10082279
415 Ga0157373_10183598
416 Ga0157370_10161216
417 Ga0157369_10711010
418 Ga0157374_10457937
419 Ga0163162_10709172
420 Ga0157372_10066145
421 Ga0157372_10599183
422 Ga0157375_10032482
423 Ga0157375_12108049
424 Ga0157380_10023673
425 Ga0163161_10031851
426 Ga0207697_10080160
427 Ga0207656_10012178
428 Ga0207682_10013748
429 Ga0207688_10628322
430 Ga0207647_10025948
431 Ga0207645_10162158
432 Ga0207645_10310254
433 Ga0207643_10074757
434 Ga0207705_10012492
435 Ga0207705_10019294
436 Ga0207705_10102053
437 Ga0207707_10015540
438 Ga0207707_10183943
439 Ga0207707_10497360
440 Ga0207707_10953072
441 Ga0207660_10015389
442 Ga0207660_10116485
443 Ga0207660_10535766
444 Ga0207660_10837261
445 Ga0207657_10005799
446 Ga0207657_10273069
447 Ga0207649_10027392
448 Ga0207649_10545220
449 Ga0207652_10016611
450 Ga0207652_10697154
451 Ga0207681_10066425
452 Ga0207681_10370958
453 Ga0207650_10196699
454 Ga0207650_10315955
455 Ga0207650_10745697
456 Ga0207659_10075369
457 Ga0207700_10029283
458 Ga0207664_10121321
459 Ga0207664_10121865
460 Ga0207644_10002343
461 Ga0207644_10017018
462 Ga0207644_10170882
463 Ga0207644_10280660
464 Ga0207690_10002874
465 Ga0207690_10020755
466 Ga0207690_10357975
467 Ga0207690_10753510
468 Ga0207706_10025922
469 Ga0207706_10059135
470 Ga0207706_10060415
471 Ga0207706_10295040
472 Ga0207669_10009252
473 Ga0207691_10279360
474 Ga0207711_10004929
475 Ga0207711_10051893
476 Ga0207661_10008889
477 Ga0207679_10049553
478 Ga0207679_10107946
479 Ga0207667_10040812
480 Ga0207668_10352299
481 Ga0207668_10575700
482 Ga0207640_10018880
483 Ga0207658_10014744
484 Ga0207658_10963379
485 Ga0207639_10017359
486 Ga0207678_10055716
487 Ga0207678_10265732
488 Ga0207678_10680409
489 Ga0207641_10069461
490 Ga0207676_10010620
491 Ga0207676_10570966
492 Ga0207675_100138506
493 Ga0207675_100639868
494 Ga0207698_10097058
495 Ga0207698_10149300
496 Ga0207698_10804031
497 Ga0207698_11351773
498 Ga0209974_10071487
499 Ga0268266_10027292
500 Ga0268266_10292794
501 Ga0307408_100145765
502 Ga0307405_10228495
503 Ga0307405_10457560
504 Ga0307405_10531277
505 Ga0307413_10004416
506 Ga0307413_10014276
507 Ga0307413_10048679
508 Ga0307413_10113569
509 Ga0307413_11530313
510 Ga0307410_10002931
511 Ga0307410_10003803
512 Ga0307410_10004779
513 Ga0307410_10166642
514 Ga0307410_10179874
515 Ga0307410_10580340
516 Ga0307410_10636522
517 Ga0307410_10760414
518 Ga0307406_10015733
519 Ga0307406_10017301
520 Ga0307406_10341402
521 Ga0307407_10007392
522 Ga0307407_10034480
523 Ga0307407_10738284
524 Ga0307412_10024013
525 Ga0307412_10084853
526 Ga0307412_10427508
527 Ga0307412_10556393
528 Ga0307412_10843264
529 Ga0307412_11004120
530 Ga0307412_11422145
531 Ga0307409_100064651
532 Ga0307409_100104349
533 Ga0307409_100108557
534 Ga0307409_100185883
535 Ga0307409_100237508
536 Ga0307409_100733281
537 Ga0307416_100003354
538 Ga0307416_100023631
539 Ga0307416_100036569
540 Ga0307416_100123783
541 Ga0307416_100486530
542 Ga0307416_101002449
543 Ga0307414_10011560
544 Ga0307414_10067139
545 Ga0307414_10152779
546 Ga0307411_10012883
547 Ga0307411_10017521
548 Ga0307411_10030283
549 Ga0307411_10155860
550 Ga0307411_10188724
551 Ga0307411_10560629
552 Ga0307411_10642080
553 Ga0307411_11044982
554 Ga0307415_100001689
555 Ga0307415_100002843
556 Ga0307415_100285997
557 Ga0307415_100539612
558 Ga0307415_101068312
559 Ga0307415_101079056
560 Ga0395899_0051933
561 Ga0395900_0017794
562 Ga0395900_0019486
563 Ga0395900_0108155
564 Ga0395900_0316992
565 Ga0395900_0429662
566 Ga0395898_0084958
567 Ga0395898_0475577
568 Ga0395898_1016246
569 Ga0395905_0011337
570 Ga0395905_0021621
571 Ga0395905_0374449
572 Ga0395905_0434213
573 Ga0395901_0063949
574 Ga0395901_0102425
575 Ga0395901_0281663
576 Ga0395901_0410462
577 Ga0395901_0579355
578 Ga0395901_0641071
579 Ga0439465_0183952
580 Ga0451841_0950211
581 Ga0439437_020630
582 Ga0439449_0071550
583 Ga0450912_017276
584 Ga0450917_004634
585 Ga0450920_007810
586 Ga0450892_003849
587 Ga0450905_002327
588 Ga0450889_000192
589 Ga0439446_0015273
590 Ga0439458_0013843
591 Ga0466972_0069645
592 Ga0466965_0043965
593 Ga0466963_0042545
594 Ga0466963_0481574
595 Ga0466964_0002092
596 Ga0466971_0242072
597 Ga0466968_0002403
598 Ga0466970_0003469
599 Ga0466970_0259926
600 Ga0466957_0062922
601 Ga0466957_0291067
602 Ga0466959_0076377
603 Ga0466958_0002338
604 Ga0466958_0016057
605 Ga0466967_0042289
606 Ga0466967_0081980
607 Ga0466967_0109064
608 Ga0495598_0069428
609 Ga0495669_0518320
610 Ga0496100_0337267
611 Ga0496101_0076668
612 Ga0496101_0221690
613 Ga0496106_0999592
614 Ga0496107_0231202
615 Ga0496108_0029105
616 Ga0496109_0013454
617 Ga0496109_0061944
618 Ga0496109_0206436
619 Ga0496110_0037730
620 Ga0496110_0341819
621 Ga0496112_0010644
622 Ga0496112_0169449
623 Ga0496112_0205508
624 Ga0496113_0013267
625 Ga0496113_0194045
626 Ga0496114_0036970
627 Ga0496114_0230694
628 Ga0496115_0034866
629 Ga0501069_0042599
630 Ga0501263_040778
631 Ga0501268_013895
632 nmdc:mga08y16_92087_c1
633 Ga0466962_0139892
634 2885427592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.7692 29 168
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7548 29 168
2nn5-assembly1.cif.gz_A structure of conserved protein of unknown function ef2215 from enterococcus faecalis 0.7241 16 173
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.7201 29 168
6y3k-assembly1.cif.gz_A nmr solution structure of the hazelnut allergen cor a 1.0403 0.7177 27 168
ID Description Score Start End Superfamily
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7338 26 167 3.30.530.20
af_O45741_121_385_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.7209 100 141 3.80.10.10
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7189 29 164 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.71 26 168 3.30.530.20
2nn5A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7047 16 173 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A258B7I4-F1-model_v4 ATPase 0.9651 12 168
AF-A0A059WUS9-F1-model_v4 ATPase 0.9598 11 175
AF-A0A7Y1W0W9-F1-model_v4 SRPBCC family protein 0.9581 12 168
AF-A0A059WUS9-F1-model_v4 ATPase 0.9541 11 175
AF-A0A1E4JW88-F1-model_v4 Polyketide cyclase/dehydrase 0.9523 15 164

Map