F404093

General Info

Members Datasets Scaffolds Average Seq Length
317 198 634 189

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10048682|Ga0081539_100486822
Length 221
Sequence MVPRGHADAGRAGLAARRSTTDTGGRHRLRYMTSPPAGPAAFTRAVEGLRAEAPRPEILLEEIPPPRKPAPYSYALSATMLRAGTEVATGRLILLHDPAGHDAWRGDLRLVTLVSAELEADLAGDPLLPAVAWTWLTDGLDQHGAAYTAIGGTITQTASVGFGELAGPPPAADLEIRASWTPVSEDLRAHLYGWCAMLSSTAGLPPPGVTAIADRHRAGAG

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
130 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
154 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
157 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
158 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
159 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
160 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
161 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
163 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
164 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
165 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
166 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
167 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
168 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
169 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
170 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
171 2855683550 Micromonospora sp. RP3T Isolate Unclassified
172 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
173 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
174 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
175 2858868258 Micromonospora sp. MH33 Isolate Unclassified
176 2858882152 Micromonospora noduli MED15 Isolate Nodule
177 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
178 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
179 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
180 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
181 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
182 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
183 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
184 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
185 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
186 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
187 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
188 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
189 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
190 2902582711 Micromonospora sp. AP08 Isolate Unclassified
191 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
192 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
193 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
194 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
195 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
196 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
197 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
198 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 0.95
Isolates 11.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.15
Nodule 1.89
Rhizoplane 1.58
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10048682 3300005985 Bacteria 2409
2 JGI25406J46586_10035009 3300003203 Bacteria 1836
3 rootH1_10003834 3300003316 Bacteria 2279
4 Ga0070658_10835668 3300005327 Bacteria 800
5 Ga0070683_100038959 3300005329 Bacteria 4360
6 Ga0070683_100783058 3300005329 Bacteria 914
7 Ga0070680_100072443 3300005336 Bacteria 2832
8 Ga0070682_100051155 3300005337 Bacteria 2581
9 Ga0068868_100003069 3300005338 Bacteria 11630
10 Ga0070660_100405886 3300005339 Bacteria 1127
11 Ga0070660_100771364 3300005339 Bacteria 808
12 Ga0070661_100030351 3300005344 Bacteria 3904
13 Ga0070692_10043808 3300005345 Bacteria 2303
14 Ga0070692_10056618 3300005345 Bacteria 2053
15 Ga0070668_100017919 3300005347 Bacteria 5312
16 Ga0070668_100031899 3300005347 Bacteria 4009
17 Ga0070675_100011765 3300005354 Bacteria 6854
18 Ga0070659_100027761 3300005366 Bacteria 4364
19 Ga0070659_100088811 3300005366 Bacteria 2476
20 Ga0070667_100674883 3300005367 Bacteria 955
21 Ga0070713_100030398 3300005436 Bacteria 4289
22 Ga0070700_100002393 3300005441 Bacteria 9562
23 Ga0070663_100002028 3300005455 Bacteria 11312
24 Ga0070662_100004615 3300005457 Bacteria 8729
25 Ga0070681_10260153 3300005458 Bacteria 1647
26 Ga0068867_100210824 3300005459 Bacteria 1560
27 Ga0068867_100752555 3300005459 Bacteria 865
28 Ga0070679_100401418 3300005530 Bacteria 1317
29 Ga0070679_100724848 3300005530 Bacteria 937
30 Ga0070679_100881103 3300005530 Bacteria 838
31 Ga0070684_100004407 3300005535 Bacteria 10714
32 Ga0070684_100051880 3300005535 Bacteria 3564
33 Ga0068853_100497163 3300005539 Bacteria 1151
34 Ga0068853_100672951 3300005539 Bacteria 986
35 Ga0070665_100033928 3300005548 Bacteria 5134
36 Ga0070665_100197622 3300005548 Bacteria 2012
37 Ga0070665_100617061 3300005548 Bacteria 1098
38 Ga0070664_100002495 3300005564 Bacteria 14832
39 Ga0070664_100067087 3300005564 Bacteria 3066
40 Ga0070664_100160689 3300005564 Bacteria 1987
41 Ga0070664_100267945 3300005564 Bacteria 1538
42 Ga0068857_100034363 3300005577 Bacteria 4485
43 Ga0068857_100111847 3300005577 Bacteria 2455
44 Ga0068856_100331577 3300005614 Bacteria 1539
45 Ga0070702_101231050 3300005615 Bacteria 605
46 Ga0068859_100247971 3300005617 Bacteria 1871
47 Ga0068859_100462839 3300005617 Bacteria 1364
48 Ga0068864_100225226 3300005618 Bacteria 1732
49 Ga0068863_100044752 3300005841 Bacteria 4200
50 Ga0068863_101177957 3300005841 Bacteria 772
51 Ga0068858_100009655 3300005842 Bacteria 9193
52 Ga0068860_100172444 3300005843 Bacteria 2090
53 Ga0068860_100531900 3300005843 Bacteria 1176
54 Ga0068862_100085334 3300005844 Bacteria 2744
55 Ga0068862_100311392 3300005844 Bacteria 1451
56 Ga0081540_1001960 3300005983 Bacteria 17184
57 Ga0081540_1031007 3300005983 Bacteria 2949
58 Ga0081539_10000168 3300005985 Bacteria 153724
59 Ga0081539_10001076 3300005985 Bacteria 49708
60 Ga0081539_10008276 3300005985 Bacteria 9117
61 Ga0081539_10073032 3300005985 Bacteria 1831
62 Ga0097621_101375830 3300006237 Bacteria 668
63 Ga0075428_100015940 3300006844 Bacteria 8316
64 Ga0075428_100069415 3300006844 Bacteria 3852
65 Ga0075428_100222112 3300006844 Bacteria 2040
66 Ga0075428_100802422 3300006844 Bacteria 1000
67 Ga0075430_100007719 3300006846 Bacteria 9089
68 Ga0075430_100014536 3300006846 Bacteria 6706
69 Ga0075430_100042247 3300006846 Bacteria 3856
70 Ga0075430_100674893 3300006846 Bacteria 852
71 Ga0075431_100012154 3300006847 Bacteria 8685
72 Ga0075431_100190446 3300006847 Bacteria 2102
73 Ga0075431_100386294 3300006847 Bacteria 1403
74 Ga0075431_100593479 3300006847 Bacteria 1092
75 Ga0075433_10509162 3300006852 Bacteria 1059
76 Ga0075429_100003629 3300006880 Bacteria 13147
77 Ga0075429_100048947 3300006880 Bacteria 3675
78 Ga0075429_100162429 3300006880 Bacteria 1956
79 Ga0075429_100567937 3300006880 Bacteria 994
80 Ga0075429_100615488 3300006880 Bacteria 951
81 Ga0068865_100057898 3300006881 Bacteria 2705
82 Ga0097620_100247971 3300006931 Bacteria 1871
83 Ga0097620_100462808 3300006931 Bacteria 1364
84 Ga0111539_10005673 3300009094 Bacteria 16148
85 Ga0111539_10464063 3300009094 Bacteria 1474
86 Ga0105245_10024923 3300009098 Bacteria 5257
87 Ga0114129_10044501 3300009147 Bacteria 6245
88 Ga0114129_10184879 3300009147 Bacteria 2833
89 Ga0114129_10427567 3300009147 Bacteria 1741
90 Ga0114129_12318986 3300009147 Bacteria 644
91 Ga0105243_10269598 3300009148 Bacteria 1528
92 Ga0105248_10116939 3300009177 Bacteria 3007
93 Ga0105249_10739528 3300009553 Bacteria 1045
94 Ga0105239_10093860 3300010375 Bacteria 3314
95 Ga0105239_10146420 3300010375 Bacteria 2634
96 Ga0105239_10543159 3300010375 Bacteria 1323
97 Ga0157371_10922519 3300013102 Bacteria 663
98 Ga0157369_10040801 3300013105 Bacteria 5067
99 Ga0157369_10988926 3300013105 Bacteria 861
100 Ga0157372_10579515 3300013307 Bacteria 1308
101 Ga0157372_10763156 3300013307 Bacteria 1124
102 Ga0157372_11289243 3300013307 Bacteria 843
103 Ga0157372_11364858 3300013307 Bacteria 817
104 Ga0157375_10802318 3300013308 Bacteria 1090
105 Ga0157380_10583207 3300014326 Bacteria 1103
106 Ga0206356_10235897 3300020070 Bacteria 2375
107 Ga0206354_10006195 3300020081 Bacteria 1502
108 Ga0206353_10640245 3300020082 Bacteria 1490
109 Ga0207645_10044742 3300025907 Bacteria 2832
110 Ga0207705_10024082 3300025909 Bacteria 4344
111 Ga0207705_10682590 3300025909 Bacteria 799
112 Ga0207707_10198347 3300025912 Bacteria 1750
113 Ga0207660_10071625 3300025917 Bacteria 2522
114 Ga0207657_10534565 3300025919 Bacteria 917
115 Ga0207649_10009452 3300025920 Bacteria 5335
116 Ga0207681_10161174 3300025923 Bacteria 1691
117 Ga0207694_10075468 3300025924 Bacteria 2639
118 Ga0207659_10005799 3300025926 Bacteria 7525
119 Ga0207687_10023213 3300025927 Bacteria 4133
120 Ga0207700_10120602 3300025928 Bacteria 2126
121 Ga0207700_11346824 3300025928 Bacteria 635
122 Ga0207644_10255086 3300025931 Bacteria 1401
123 Ga0207644_10624653 3300025931 Bacteria 896
124 Ga0207644_10739067 3300025931 Bacteria 822
125 Ga0207690_10013372 3300025932 Bacteria 4932
126 Ga0207690_10238079 3300025932 Bacteria 1401
127 Ga0207690_10428463 3300025932 Bacteria 1059
128 Ga0207706_10012356 3300025933 Bacteria 7779
129 Ga0207709_10492327 3300025935 Bacteria 955
130 Ga0207691_10628757 3300025940 Bacteria 908
131 Ga0207711_10182747 3300025941 Bacteria 1908
132 Ga0207689_10564851 3300025942 Bacteria 956
133 Ga0207661_10003466 3300025944 Bacteria 10956
134 Ga0207661_10006140 3300025944 Bacteria 8491
135 Ga0207661_10006211 3300025944 Bacteria 8450
136 Ga0207679_10002731 3300025945 Bacteria 10911
137 Ga0207679_10023080 3300025945 Bacteria 4248
138 Ga0207679_10306131 3300025945 Bacteria 1371
139 Ga0207679_10401214 3300025945 Bacteria 1206
140 Ga0207679_10572008 3300025945 Bacteria 1016
141 Ga0207668_10004794 3300025972 Bacteria 7961
142 Ga0207668_10014471 3300025972 Bacteria 4883
143 Ga0207668_10075570 3300025972 Bacteria 2422
144 Ga0207658_10538834 3300025986 Bacteria 1043
145 Ga0207677_10009767 3300026023 Bacteria 5406
146 Ga0207703_10050962 3300026035 Bacteria 3352
147 Ga0207639_10190432 3300026041 Bacteria 1752
148 Ga0207678_10018498 3300026067 Bacteria 6119
149 Ga0207708_10005009 3300026075 Bacteria 9762
150 Ga0207702_10058115 3300026078 Bacteria 3291
151 Ga0207702_10996885 3300026078 Bacteria 831
152 Ga0207674_10054439 3300026116 Bacteria 4073
153 Ga0207674_10268031 3300026116 Bacteria 1655
154 Ga0207698_11167500 3300026142 Bacteria 784
155 Ga0207428_10067316 3300027907 Bacteria 2820
156 Ga0268266_10036769 3300028379 Bacteria 4171
157 Ga0268266_10215060 3300028379 Bacteria 1764
158 Ga0268266_10428236 3300028379 Bacteria 1255
159 Ga0268266_11408005 3300028379 Bacteria 673
160 Ga0268265_10047251 3300028380 Bacteria 3224
161 Ga0268264_10160637 3300028381 Bacteria 2024
162 Ga0307517_10175901 3300028786 Bacteria 1394
163 Ga0307515_10000146 3300028794 Bacteria 170674
164 Ga0307515_10005869 3300028794 Bacteria 24767
165 Ga0307515_10047653 3300028794 Bacteria 6506
166 Ga0307515_10135416 3300028794 Bacteria 2682
167 Ga0307512_10002709 3300030522 Bacteria 21746
168 Ga0307512_10011089 3300030522 Bacteria 8554
169 Ga0307513_10071385 3300031456 Bacteria 3624
170 Ga0307513_10084372 3300031456 Bacteria 3263
171 Ga0307509_10024095 3300031507 Bacteria 6821
172 Ga0307408_100018741 3300031548 Bacteria 4651
173 Ga0307408_100340140 3300031548 Bacteria 1270
174 Ga0307408_100479522 3300031548 Bacteria 1085
175 Ga0307508_10000877 3300031616 Bacteria 35003
176 Ga0307508_10003704 3300031616 Bacteria 15321
177 Ga0307508_10086042 3300031616 Bacteria 2727
178 Ga0307508_10367737 3300031616 Bacteria 1029
179 Ga0307516_10010193 3300031730 Bacteria 10370
180 Ga0307516_10105518 3300031730 Bacteria 2629
181 Ga0307516_10431882 3300031730 Bacteria 974
182 Ga0307405_10012103 3300031731 Bacteria 4552
183 Ga0307405_10078657 3300031731 Bacteria 2147
184 Ga0307405_10170306 3300031731 Bacteria 1553
185 Ga0307413_10365808 3300031824 Bacteria 1118
186 Ga0307410_10016915 3300031852 Bacteria 4363
187 Ga0307410_10069985 3300031852 Bacteria 2429
188 Ga0326468_10001328 3300031889 Bacteria 2166
189 Ga0307406_10024120 3300031901 Bacteria 3629
190 Ga0307406_10026590 3300031901 Bacteria 3477
191 Ga0307406_10248307 3300031901 Bacteria 1339
192 Ga0307406_10425283 3300031901 Bacteria 1059
193 Ga0307406_10498449 3300031901 Bacteria 987
194 Ga0307407_10088176 3300031903 Bacteria 1895
195 Ga0307407_10465549 3300031903 Bacteria 920
196 Ga0307409_100037308 3300031995 Bacteria 3582
197 Ga0307409_100042780 3300031995 Bacteria 3395
198 Ga0307409_101569642 3300031995 Bacteria 686
199 Ga0307416_100041751 3300032002 Bacteria 3575
200 Ga0307416_100054296 3300032002 Bacteria 3220
201 Ga0307416_100266618 3300032002 Bacteria 1678
202 Ga0307416_100427077 3300032002 Bacteria 1371
203 Ga0307416_101439087 3300032002 Bacteria 795
204 Ga0307414_10101207 3300032004 Bacteria 2169
205 Ga0307411_10226186 3300032005 Bacteria 1455
206 Ga0307415_100059729 3300032126 Bacteria 2631
207 Ga0307415_100097294 3300032126 Bacteria 2148
208 Ga0307415_100130174 3300032126 Bacteria 1903
209 Ga0307415_100351094 3300032126 Bacteria 1242
210 Ga0307415_100369569 3300032126 Bacteria 1214
211 Ga0307415_100566451 3300032126 Bacteria 1005
212 Ga0307415_100896464 3300032126 Bacteria 817
213 Ga0307507_10043170 3300033179 Bacteria 4479
214 Ga0373938_0081259 3300034957 Bacteria 789
215 Ga0373951_0000141 3300035091 Bacteria 26805
216 Ga0373932_0044379 3300035112 Bacteria 1296
217 Ga0373941_0048770 3300035115 Bacteria 1338
218 Ga0373955_0046448 3300035172 Bacteria 2348
219 Ga0373942_0000058 3300035207 Bacteria 22888
220 Ga0373962_0002011 3300035242 Bacteria 4845
221 Ga0373935_0006342 3300035692 Bacteria 7054
222 Ga0373935_0290600 3300035692 Bacteria 1153
223 Ga0395899_0038669 3300037312 Bacteria 3573
224 Ga0395899_0088222 3300037312 Bacteria 2251
225 Ga0395900_0003120 3300037418 Bacteria 17993
226 Ga0395898_0004039 3300037466 Bacteria 16140
227 Ga0395898_0197516 3300037466 Bacteria 1921
228 Ga0395905_0051735 3300037471 Bacteria 3847
229 Ga0395901_0087440 3300038443 Bacteria 3258
230 Ga0451791_1847311 3300041451 Bacteria 1000
231 Ga0451841_0016784 3300041498 Bacteria 1045
232 Ga0451849_0632794 3300041505 Bacteria 872
233 Ga0451853_2074372 3300041512 Bacteria 2708
234 Ga0451853_3129818 3300041512 Bacteria 913
235 Ga0466967_0064687 3300045976 Bacteria 3253
236 Ga0495594_0020867 3300046499 Bacteria 3493
237 Ga0495594_0411739 3300046499 Bacteria 769
238 Ga0495632_0051691 3300046519 Bacteria 2022
239 Ga0495667_0433224 3300046559 Bacteria 827
240 Ga0495604_0424780 3300047317 Bacteria 872
241 Ga0496104_0141523 3300048907 Bacteria 2311
242 Ga0496108_0000198 3300048911 Bacteria 55637
243 Ga0496109_0842146 3300048912 Bacteria 855
244 Ga0496112_0050979 3300048915 Bacteria 4059
245 Ga0501038_0030336 3300049574 Bacteria 4785
246 Ga0501043_0292386 3300049579 Bacteria 1247
247 Ga0501047_0074865 3300049581 Bacteria 3259
248 Ga0501048_0445281 3300049582 Bacteria 927
249 Ga0501073_0420271 3300049589 Bacteria 924
250 Ga0501035_0533332 3300049822 Bacteria 963
251 Ga0501044_0211842 3300049823 Bacteria 1891
252 nmdc:mga05p37_107414_c1 3300050507 Bacteria 3434
253 nmdc:mga05p37_125539_c1 3300050507 Bacteria 3152
254 nmdc:mga05p37_24_c1 3300050507 Bacteria 118187
255 nmdc:mga09592_11110_c1 3300050508 Bacteria 7325
256 nmdc:mga09592_124163_c1 3300050508 Bacteria 2219
257 nmdc:mga09592_369664_c1 3300050508 Bacteria 1240
258 nmdc:mga09592_549649_c1 3300050508 Bacteria 992
259 nmdc:mga09592_96902_c1 3300050508 Bacteria 2524
260 nmdc:mga0qj67_124854_c1 3300050509 Bacteria 2083
261 nmdc:mga0qj67_256_c1 3300050509 Bacteria 36383
262 nmdc:mga0qj67_57_c2 3300050509 Bacteria 38742
263 nmdc:mga06r32_1077202_c1 3300050510 Bacteria 754
264 nmdc:mga06r32_1198194_c1 3300050510 Bacteria 706
265 nmdc:mga06r32_22_c1 3300050510 Bacteria 54748
266 nmdc:mga06r32_246241_c1 3300050510 Bacteria 1775
267 nmdc:mga06r32_467391_c1 3300050510 Bacteria 1240
268 nmdc:mga06r32_577052_c1 3300050510 Bacteria 1097
269 nmdc:mga08y16_3784_c1 3300050511 Bacteria 15760
270 nmdc:mga08y16_521296_c1 3300050511 Bacteria 1205
271 Ga0500646_0013052 3300053090 Bacteria 2149
272 Ga0500651_0084641 3300053093 Bacteria 1961
273 Ga0500650_0057904 3300053098 Bacteria 1807
274 Ga0500569_004735 3300053109 Bacteria 2880
275 Ga0500594_0005145 3300053118 Bacteria 2893
276 Ga0500614_090161 3300053123 Bacteria 870
277 Ga0500579_134953 3300053143 Bacteria 1138
278 Ga0500588_0096707 3300053146 Bacteria 1012
279 Ga0500600_0083291 3300053149 Bacteria 1724
280 Ga0500630_050755 3300053159 Bacteria 2006
281 Ga0530510_0042367 3300061734 Bacteria 3289
282 2515758150 2515154137 Bacteria 5711575
283 2516085690 2515154202 Bacteria 5471270
284 2516090519 2515154203 Bacteria 5458536
285 2676482002 2675903059 Bacteria 8644972
286 2831938115 2831935698 Bacteria 5963223
287 2832010926 2832004796 Bacteria 6538017
288 2855672885 2855670206 Bacteria 7120389
289 2855677341 2855676851 Bacteria 7063653
290 2855686095 2855683550 Bacteria 7134265
291 2856861289 2856858025 Bacteria 7255264
292 2857290079 2857288857 Bacteria 7189066
293 2858855518 2858848962 Bacteria 6963058
294 2858870805 2858868258 Bacteria 7683772
295 2858885389 2858882152 Bacteria 7230291
296 2858892287 2858888857 Bacteria 7060307
297 2858902124 2858895516 Bacteria 7378898
298 2858903992 2858902515 Bacteria 7086037
299 2866068499 2866065130 Bacteria 6518152
300 2867305772 2867302475 Bacteria 7087181
301 2867315435 2867312974 Bacteria 7058875
302 2867325563 2867319477 Bacteria 7069771
303 2867510302 2867507094 Bacteria 6506033
304 2869050312 2869048445 Bacteria 6875584
305 2869063139 2869061728 Bacteria 7112407
306 2869072367 2869068681 Bacteria 7205615
307 2880492816 2880489317 Bacteria 7096270
308 2880499493 2880495981 Bacteria 7340502
309 2902587782 2902582711 Bacteria 6187705
310 2929221463 2929219909 Bacteria 6984360
311 2929228094 2929226422 Bacteria 7248583
312 2996226809 2996221748 Bacteria 6799777
313 8003877976 8003870546 Bacteria 7396674
314 8054706042 8054704163 Bacteria 7247792
315 8054732141 8054727385 Bacteria 7558670
316 8054740988 8054734606 Bacteria 6947278
317 8055417493 8055412473 Bacteria 6257500
318 Ga0081539_10048682
319 JGI25406J46586_10035009
320 rootH1_10003834
321 Ga0070658_10835668
322 Ga0070683_100038959
323 Ga0070683_100783058
324 Ga0070680_100072443
325 Ga0070682_100051155
326 Ga0068868_100003069
327 Ga0070660_100405886
328 Ga0070660_100771364
329 Ga0070661_100030351
330 Ga0070692_10043808
331 Ga0070692_10056618
332 Ga0070668_100017919
333 Ga0070668_100031899
334 Ga0070675_100011765
335 Ga0070659_100027761
336 Ga0070659_100088811
337 Ga0070667_100674883
338 Ga0070713_100030398
339 Ga0070700_100002393
340 Ga0070663_100002028
341 Ga0070662_100004615
342 Ga0070681_10260153
343 Ga0068867_100210824
344 Ga0068867_100752555
345 Ga0070679_100401418
346 Ga0070679_100724848
347 Ga0070679_100881103
348 Ga0070684_100004407
349 Ga0070684_100051880
350 Ga0068853_100497163
351 Ga0068853_100672951
352 Ga0070665_100033928
353 Ga0070665_100197622
354 Ga0070665_100617061
355 Ga0070664_100002495
356 Ga0070664_100067087
357 Ga0070664_100160689
358 Ga0070664_100267945
359 Ga0068857_100034363
360 Ga0068857_100111847
361 Ga0068856_100331577
362 Ga0070702_101231050
363 Ga0068859_100247971
364 Ga0068859_100462839
365 Ga0068864_100225226
366 Ga0068863_100044752
367 Ga0068863_101177957
368 Ga0068858_100009655
369 Ga0068860_100172444
370 Ga0068860_100531900
371 Ga0068862_100085334
372 Ga0068862_100311392
373 Ga0081540_1001960
374 Ga0081540_1031007
375 Ga0081539_10000168
376 Ga0081539_10001076
377 Ga0081539_10008276
378 Ga0081539_10073032
379 Ga0097621_101375830
380 Ga0075428_100015940
381 Ga0075428_100069415
382 Ga0075428_100222112
383 Ga0075428_100802422
384 Ga0075430_100007719
385 Ga0075430_100014536
386 Ga0075430_100042247
387 Ga0075430_100674893
388 Ga0075431_100012154
389 Ga0075431_100190446
390 Ga0075431_100386294
391 Ga0075431_100593479
392 Ga0075433_10509162
393 Ga0075429_100003629
394 Ga0075429_100048947
395 Ga0075429_100162429
396 Ga0075429_100567937
397 Ga0075429_100615488
398 Ga0068865_100057898
399 Ga0097620_100247971
400 Ga0097620_100462808
401 Ga0111539_10005673
402 Ga0111539_10464063
403 Ga0105245_10024923
404 Ga0114129_10044501
405 Ga0114129_10184879
406 Ga0114129_10427567
407 Ga0114129_12318986
408 Ga0105243_10269598
409 Ga0105248_10116939
410 Ga0105249_10739528
411 Ga0105239_10093860
412 Ga0105239_10146420
413 Ga0105239_10543159
414 Ga0157371_10922519
415 Ga0157369_10040801
416 Ga0157369_10988926
417 Ga0157372_10579515
418 Ga0157372_10763156
419 Ga0157372_11289243
420 Ga0157372_11364858
421 Ga0157375_10802318
422 Ga0157380_10583207
423 Ga0206356_10235897
424 Ga0206354_10006195
425 Ga0206353_10640245
426 Ga0207645_10044742
427 Ga0207705_10024082
428 Ga0207705_10682590
429 Ga0207707_10198347
430 Ga0207660_10071625
431 Ga0207657_10534565
432 Ga0207649_10009452
433 Ga0207681_10161174
434 Ga0207694_10075468
435 Ga0207659_10005799
436 Ga0207687_10023213
437 Ga0207700_10120602
438 Ga0207700_11346824
439 Ga0207644_10255086
440 Ga0207644_10624653
441 Ga0207644_10739067
442 Ga0207690_10013372
443 Ga0207690_10238079
444 Ga0207690_10428463
445 Ga0207706_10012356
446 Ga0207709_10492327
447 Ga0207691_10628757
448 Ga0207711_10182747
449 Ga0207689_10564851
450 Ga0207661_10003466
451 Ga0207661_10006140
452 Ga0207661_10006211
453 Ga0207679_10002731
454 Ga0207679_10023080
455 Ga0207679_10306131
456 Ga0207679_10401214
457 Ga0207679_10572008
458 Ga0207668_10004794
459 Ga0207668_10014471
460 Ga0207668_10075570
461 Ga0207658_10538834
462 Ga0207677_10009767
463 Ga0207703_10050962
464 Ga0207639_10190432
465 Ga0207678_10018498
466 Ga0207708_10005009
467 Ga0207702_10058115
468 Ga0207702_10996885
469 Ga0207674_10054439
470 Ga0207674_10268031
471 Ga0207698_11167500
472 Ga0207428_10067316
473 Ga0268266_10036769
474 Ga0268266_10215060
475 Ga0268266_10428236
476 Ga0268266_11408005
477 Ga0268265_10047251
478 Ga0268264_10160637
479 Ga0307517_10175901
480 Ga0307515_10000146
481 Ga0307515_10005869
482 Ga0307515_10047653
483 Ga0307515_10135416
484 Ga0307512_10002709
485 Ga0307512_10011089
486 Ga0307513_10071385
487 Ga0307513_10084372
488 Ga0307509_10024095
489 Ga0307408_100018741
490 Ga0307408_100340140
491 Ga0307408_100479522
492 Ga0307508_10000877
493 Ga0307508_10003704
494 Ga0307508_10086042
495 Ga0307508_10367737
496 Ga0307516_10010193
497 Ga0307516_10105518
498 Ga0307516_10431882
499 Ga0307405_10012103
500 Ga0307405_10078657
501 Ga0307405_10170306
502 Ga0307413_10365808
503 Ga0307410_10016915
504 Ga0307410_10069985
505 Ga0326468_10001328
506 Ga0307406_10024120
507 Ga0307406_10026590
508 Ga0307406_10248307
509 Ga0307406_10425283
510 Ga0307406_10498449
511 Ga0307407_10088176
512 Ga0307407_10465549
513 Ga0307409_100037308
514 Ga0307409_100042780
515 Ga0307409_101569642
516 Ga0307416_100041751
517 Ga0307416_100054296
518 Ga0307416_100266618
519 Ga0307416_100427077
520 Ga0307416_101439087
521 Ga0307414_10101207
522 Ga0307411_10226186
523 Ga0307415_100059729
524 Ga0307415_100097294
525 Ga0307415_100130174
526 Ga0307415_100351094
527 Ga0307415_100369569
528 Ga0307415_100566451
529 Ga0307415_100896464
530 Ga0307507_10043170
531 Ga0373938_0081259
532 Ga0373951_0000141
533 Ga0373932_0044379
534 Ga0373941_0048770
535 Ga0373955_0046448
536 Ga0373942_0000058
537 Ga0373962_0002011
538 Ga0373935_0006342
539 Ga0373935_0290600
540 Ga0395899_0038669
541 Ga0395899_0088222
542 Ga0395900_0003120
543 Ga0395898_0004039
544 Ga0395898_0197516
545 Ga0395905_0051735
546 Ga0395901_0087440
547 Ga0451791_1847311
548 Ga0451841_0016784
549 Ga0451849_0632794
550 Ga0451853_2074372
551 Ga0451853_3129818
552 Ga0466967_0064687
553 Ga0495594_0020867
554 Ga0495594_0411739
555 Ga0495632_0051691
556 Ga0495667_0433224
557 Ga0495604_0424780
558 Ga0496104_0141523
559 Ga0496108_0000198
560 Ga0496109_0842146
561 Ga0496112_0050979
562 Ga0501038_0030336
563 Ga0501043_0292386
564 Ga0501047_0074865
565 Ga0501048_0445281
566 Ga0501073_0420271
567 Ga0501035_0533332
568 Ga0501044_0211842
569 nmdc:mga05p37_107414_c1
570 nmdc:mga05p37_125539_c1
571 nmdc:mga05p37_24_c1
572 nmdc:mga09592_11110_c1
573 nmdc:mga09592_124163_c1
574 nmdc:mga09592_369664_c1
575 nmdc:mga09592_549649_c1
576 nmdc:mga09592_96902_c1
577 nmdc:mga0qj67_124854_c1
578 nmdc:mga0qj67_256_c1
579 nmdc:mga0qj67_57_c2
580 nmdc:mga06r32_1077202_c1
581 nmdc:mga06r32_1198194_c1
582 nmdc:mga06r32_22_c1
583 nmdc:mga06r32_246241_c1
584 nmdc:mga06r32_467391_c1
585 nmdc:mga06r32_577052_c1
586 nmdc:mga08y16_3784_c1
587 nmdc:mga08y16_521296_c1
588 Ga0500646_0013052
589 Ga0500651_0084641
590 Ga0500650_0057904
591 Ga0500569_004735
592 Ga0500594_0005145
593 Ga0500614_090161
594 Ga0500579_134953
595 Ga0500588_0096707
596 Ga0500600_0083291
597 Ga0500630_050755
598 Ga0530510_0042367
599 2515758150
600 2516085690
601 2516090519
602 2676482002
603 2831938115
604 2832010926
605 2855672885
606 2855677341
607 2855686095
608 2856861289
609 2857290079
610 2858855518
611 2858870805
612 2858885389
613 2858892287
614 2858902124
615 2858903992
616 2866068499
617 2867305772
618 2867315435
619 2867325563
620 2867510302
621 2869050312
622 2869063139
623 2869072367
624 2880492816
625 2880499493
626 2902587782
627 2929221463
628 2929228094
629 2996226809
630 8003877976
631 8054706042
632 8054732141
633 8054740988
634 8055417493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11452

DUF3000

Protein of unknown function (DUF3000)

38

210

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgh-assembly1.cif.gz_A solution structure of the chloroplast outer envelope channel oep21 0.6791 27 83
8bk2-assembly1.cif.gz_A x-ray structure of meningococcal factor h binding protein variant 2 in complex with a specific and bactericidal human monoclonal antibody 1b1 0.6542 43 87
6w3g-assembly2.cif.gz_B rd1ntf2_04 with long sheet 0.5805 25 68
5nqx-assembly3.cif.gz_B structure of a fhbp(v1.1):pora(p1.16) chimera. fusion at fhbp position 294. 0.5085 30 85
6drv-assembly1.cif.gz_A beta-galactosidase 0.4951 3 90
ID Description Score Start End Superfamily
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9151 7 179 3.30.1460.10
af_O86317_22_202_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8711 7 179 3.30.1460.10
af_Q94F00_84_227_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.6865 42 85 3.30.540.10
af_F1QC72_481_588_3.30.300.330 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.6458 78 166 3.30.300.330
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.6338 98 131 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A286ET11-F1-model_v4 DUF3000 family protein 0.9597 8 181
AF-A0A3N6CNU3-F1-model_v4 deleted 0.9572 5 177
AF-A0A3G4W2N6-F1-model_v4 DUF3000 domain-containing protein 0.9569 5 177
AF-A0A656TK20-F1-model_v4 deleted 0.9549 4 66
AF-A0A1C5E7Q5-F1-model_v4 DUF3000 domain-containing protein 0.952 16 177

Map