F404067

General Info

Members Datasets Scaffolds Average Seq Length
317 245 308 258

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100109301|Ga0070697_1001093012
Length 259
Sequence MIDRRTFSTALIAGVATSLFRRPSKAEAQPAVSARHVVLVHGAYADGSSWSEVIGRLQLAGLTATAVQNPLTSLTDDVAATRRILALQDGPTVLVGHSWAGTVISEAGVDPKVSALVYVAARAPDAGEDYAAALAAKFPTPPANAGLVKSGGFAQLSEEAFLQDFAGGVDPAKARVLYAVQGRIADTLFASRTTAAAWKLKPSWYAVSKQDRTTSPELERFLAKRKHAKTVEVDASHLSLVTHPQEITDLILSAAGRRG

Samples

Sample ID Description Type Environment
1 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
2 2738541307 Variovorax sp. GV008 Isolate Unclassified
3 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
4 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
5 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
6 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
7 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
8 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
9 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
99 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
142 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
162 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
233 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
234 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
235 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
236 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
237 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
243 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.16
Metatranscriptomes 0
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.35
Nodule 0.63
Rhizoplane 5.05
Rhizosphere 66.56
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000811 3300002774 Bacteria 10563
2 JGI25151J46595_10024547 3300003187 Bacteria 2465
3 JGI25153J46596_10000055 3300003215 Bacteria 135518
4 rootH2_10160018 3300003320 Bacteria 2547
5 rootL2_10253618 3300003322 Bacteria 3365
6 Ga0055526_1001699 3300003771 Bacteria 15386
7 Ga0055537_1002181 3300003773 Bacteria 6826
8 Ga0055530_10019770 3300003791 Bacteria 2032
9 Ga0055530_10025686 3300003791 Bacteria 1640
10 Ga0055540_1000448 3300003792 Bacteria 32217
11 Ga0055531_10026851 3300003794 Bacteria 2040
12 Ga0055531_10027049 3300003794 Bacteria 2026
13 Ga0065165_1000028 3300005262 Bacteria 224430
14 Ga0070658_10308981 3300005327 Bacteria 1349
15 Ga0070676_10008002 3300005328 Bacteria 5682
16 Ga0068869_100003890 3300005334 Bacteria 9216
17 Ga0070680_100158731 3300005336 Bacteria 1900
18 Ga0070682_100081039 3300005337 Bacteria 2100
19 Ga0070661_100162046 3300005344 Bacteria 1694
20 Ga0070669_100274096 3300005353 Bacteria 1350
21 Ga0070673_100000001 3300005364 Bacteria 239842
22 Ga0070659_100592184 3300005366 Bacteria 952
23 Ga0070714_100711643 3300005435 Bacteria 969
24 Ga0070713_100448412 3300005436 Bacteria 1211
25 Ga0070713_100580400 3300005436 Bacteria 1064
26 Ga0070713_100616698 3300005436 Bacteria 1031
27 Ga0070710_10116517 3300005437 Bacteria 1611
28 Ga0070711_100344548 3300005439 Bacteria 1196
29 Ga0070678_100049359 3300005456 Bacteria 3037
30 Ga0070662_100185052 3300005457 Bacteria 1644
31 Ga0070662_100228053 3300005457 Bacteria 1489
32 Ga0068867_100003261 3300005459 Bacteria 11431
33 Ga0070707_100212237 3300005468 Bacteria 1886
34 Ga0070697_100109301 3300005536 Unclassified 2302
35 Ga0068853_100099907 3300005539 Bacteria 2564
36 Ga0070672_100035397 3300005543 Bacteria 3796
37 Ga0070672_100160063 3300005543 Bacteria 1867
38 Ga0070693_100011275 3300005547 Bacteria 4501
39 Ga0070665_100246581 3300005548 Bacteria 1787
40 Ga0070704_100476587 3300005549 Bacteria 1079
41 Ga0068855_100000007 3300005563 Bacteria 273676
42 Ga0068855_100030458 3300005563 Bacteria 6454
43 Ga0068855_100462197 3300005563 Bacteria 1384
44 Ga0070664_100196956 3300005564 Bacteria 1796
45 Ga0068854_100090636 3300005578 Bacteria 2274
46 Ga0068856_100077073 3300005614 Bacteria 3303
47 Ga0068856_100138112 3300005614 Bacteria 2443
48 Ga0068852_100000987 3300005616 Bacteria 18748
49 Ga0068852_100042519 3300005616 Bacteria 3847
50 Ga0068852_100634885 3300005616 Bacteria 1074
51 Ga0068859_100003209 3300005617 Bacteria 16648
52 Ga0068859_100101019 3300005617 Bacteria 2940
53 Ga0068866_10137914 3300005718 Bacteria 1396
54 Ga0068861_100000029 3300005719 Bacteria 68086
55 Ga0068860_100452039 3300005843 Bacteria 1277
56 Ga0068862_100100219 3300005844 Bacteria 2533
57 Ga0070712_100037150 3300006175 Bacteria 3318
58 Ga0097621_100007946 3300006237 Bacteria 7610
59 Ga0068871_100033566 3300006358 Bacteria 4065
60 Ga0068871_100368063 3300006358 Bacteria 1274
61 Ga0068871_100430377 3300006358 Bacteria 1180
62 Ga0075428_100007997 3300006844 Bacteria 11727
63 Ga0075430_100000038 3300006846 Bacteria 68465
64 Ga0075431_100004413 3300006847 Bacteria 13793
65 Ga0075431_100022577 3300006847 Bacteria 6433
66 Ga0075434_100784906 3300006871 Bacteria 969
67 Ga0075429_100164028 3300006880 Bacteria 1946
68 Ga0075429_100290261 3300006880 Bacteria 1432
69 Ga0068865_100000047 3300006881 Bacteria 68268
70 Ga0097620_100003209 3300006931 Bacteria 16648
71 Ga0097620_100101021 3300006931 Bacteria 2940
72 Ga0099794_10010487 3300007265 Bacteria 3936
73 Ga0099794_10039318 3300007265 Bacteria 2245
74 Ga0099795_10098762 3300007788 Bacteria 1142
75 Ga0099795_10107057 3300007788 Unclassified 1104
76 Ga0105240_10000422 3300009093 Bacteria 78449
77 Ga0105240_10002886 3300009093 Bacteria 27149
78 Ga0105240_10714140 3300009093 Unclassified 1093
79 Ga0111539_10140297 3300009094 Bacteria 2830
80 Ga0105245_10010624 3300009098 Bacteria 8010
81 Ga0105247_10370865 3300009101 Bacteria 1012
82 Ga0114129_10086800 3300009147 Bacteria 4339
83 Ga0114129_10174941 3300009147 Bacteria 2924
84 Ga0105243_10003329 3300009148 Bacteria 13041
85 Ga0105241_10071442 3300009174 Bacteria 2694
86 Ga0105242_10005745 3300009176 Bacteria 9565
87 Ga0105242_10012082 3300009176 Bacteria 6644
88 Ga0105242_10530564 3300009176 Bacteria 1125
89 Ga0105248_10030215 3300009177 Bacteria 6048
90 Ga0105248_10190024 3300009177 Bacteria 2314
91 Ga0105237_10144614 3300009545 Bacteria 2372
92 Ga0105237_10227871 3300009545 Bacteria 1864
93 Ga0105238_10105733 3300009551 Bacteria 2796
94 Ga0105238_10123366 3300009551 Bacteria 2570
95 Ga0105147_103674 3300009982 Bacteria 1286
96 Ga0105239_10420075 3300010375 Bacteria 1515
97 Ga0105246_10005985 3300011119 Bacteria 7427
98 Ga0105246_10135557 3300011119 Bacteria 1845
99 Ga0157373_10026183 3300013100 Bacteria 4215
100 Ga0157373_10047891 3300013100 Bacteria 3048
101 Ga0157370_10000372 3300013104 Bacteria 56499
102 Ga0157369_10104693 3300013105 Bacteria 3013
103 Ga0157374_10008679 3300013296 Bacteria 8693
104 Ga0157378_10009506 3300013297 Bacteria 8466
105 Ga0157372_10088092 3300013307 Bacteria 3524
106 Ga0157375_10026254 3300013308 Bacteria 5425
107 Ga0157380_10326775 3300014326 Bacteria 1424
108 Ga0182008_10023787 3300014497 Bacteria 3123
109 Ga0182008_10162652 3300014497 Bacteria 1124
110 Ga0157377_10001321 3300014745 Bacteria 10611
111 Ga0157379_10061513 3300014968 Bacteria 3357
112 Ga0157376_10001546 3300014969 Bacteria 15174
113 Ga0157376_10073870 3300014969 Bacteria 2905
114 Ga0182006_1023421 3300015261 Bacteria 2557
115 Ga0163161_10004385 3300017792 Bacteria 9838
116 Ga0213875_10008078 3300021388 Bacteria 5407
117 Ga0224572_1013873 3300024225 Bacteria 1538
118 Ga0209437_100072 3300025233 Bacteria 305152
119 Ga0207425_1000005 3300025245 Bacteria 900502
120 Ga0209129_1000753 3300025258 Bacteria 20576
121 Ga0209565_1000052 3300025263 Bacteria 212056
122 Ga0209676_1002721 3300025292 Bacteria 11897
123 Ga0209676_1008804 3300025292 Bacteria 4443
124 Ga0209025_1000128 3300025294 Bacteria 198859
125 Ga0209564_1003609 3300025295 Bacteria 10304
126 Ga0209564_1016260 3300025295 Bacteria 2973
127 Ga0209758_1000002 3300025297 Bacteria 1400310
128 Ga0209758_1000057 3300025297 Bacteria 333111
129 Ga0209758_1034894 3300025297 Bacteria 1992
130 Ga0209050_1000001 3300025298 Bacteria 3563507
131 Ga0209050_1000166 3300025298 Bacteria 152073
132 Ga0209050_1007862 3300025298 Bacteria 5856
133 Ga0207426_1013426 3300025302 Bacteria 3036
134 Ga0209051_1001182 3300025303 Bacteria 23630
135 Ga0209257_1004244 3300025304 Bacteria 11319
136 Ga0209257_1004335 3300025304 Bacteria 11097
137 Ga0209257_1009984 3300025304 Bacteria 4926
138 Ga0209257_1036211 3300025304 Bacteria 1518
139 Ga0207692_10058872 3300025898 Bacteria 1981
140 Ga0207710_10256865 3300025900 Bacteria 875
141 Ga0207645_10012561 3300025907 Bacteria 5743
142 Ga0207643_10182891 3300025908 Bacteria 1269
143 Ga0207695_10047423 3300025913 Bacteria 4547
144 Ga0207671_10201255 3300025914 Bacteria 1555
145 Ga0207693_10072091 3300025915 Bacteria 2705
146 Ga0207693_10134988 3300025915 Bacteria 1940
147 Ga0207681_10352749 3300025923 Bacteria 1178
148 Ga0207694_10427153 3300025924 Bacteria 1104
149 Ga0207687_10314392 3300025927 Bacteria 1266
150 Ga0207700_10128908 3300025928 Bacteria 2062
151 Ga0207664_10022940 3300025929 Bacteria 4669
152 Ga0207644_10076099 3300025931 Bacteria 2468
153 Ga0207706_10135783 3300025933 Bacteria 2164
154 Ga0207686_10015676 3300025934 Bacteria 4242
155 Ga0207709_10001679 3300025935 Bacteria 14921
156 Ga0207704_10000006 3300025938 Bacteria 220005
157 Ga0207665_10003819 3300025939 Bacteria 10070
158 Ga0207711_10005376 3300025941 Bacteria 10837
159 Ga0207689_10002914 3300025942 Bacteria 15792
160 Ga0207679_10319036 3300025945 Bacteria 1345
161 Ga0207667_10000038 3300025949 Bacteria 280720
162 Ga0207667_10039274 3300025949 Bacteria 5046
163 Ga0207651_10000001 3300025960 Bacteria 516823
164 Ga0207712_10067212 3300025961 Bacteria 2564
165 Ga0207678_10057897 3300026067 Bacteria 3335
166 Ga0207702_10042853 3300026078 Bacteria 3798
167 Ga0207702_10162583 3300026078 Bacteria 2040
168 Ga0207676_10114371 3300026095 Bacteria 2264
169 Ga0207675_100000012 3300026118 Bacteria 140594
170 Ga0207683_10037713 3300026121 Bacteria 4210
171 Ga0207698_10000758 3300026142 Bacteria 18760
172 Ga0207698_10005635 3300026142 Bacteria 7750
173 Ga0209371_1000033 3300027312 Bacteria 381084
174 Ga0209588_1012438 3300027671 Bacteria 2584
175 Ga0207428_10053559 3300027907 Bacteria 3217
176 Ga0265357_1007991 3300028023 Bacteria 1032
177 Ga0265355_1001392 3300028036 Bacteria 1562
178 Ga0268266_10175679 3300028379 Bacteria 1947
179 Ga0268264_10281125 3300028381 Bacteria 1559
180 Ga0307517_10037462 3300028786 Bacteria 5414
181 Ga0307515_10019845 3300028794 Bacteria 12051
182 Ga0268256_1002642 3300030500 Bacteria 8882
183 Ga0307513_10008387 3300031456 Bacteria 13230
184 Ga0307513_10062297 3300031456 Bacteria 3943
185 Ga0307513_10073308 3300031456 Unclassified 3565
186 Ga0307509_10000061 3300031507 Bacteria 143863
187 Ga0307516_10024269 3300031730 Bacteria 6196
188 Ga0307412_10003407 3300031911 Bacteria 8831
189 Ga0307510_10095008 3300033180 Bacteria 2804
190 Ga0373927_0281713 3300035695 Bacteria 1093
191 Ga0436364_1159000 3300037853 Bacteria 5676
192 Ga0436360_0157384 3300039438 Bacteria 2909
193 Ga0436363_1336023 3300039450 Bacteria 1420
194 Ga0439465_0004261 3300041413 Bacteria 4652
195 Ga0451793_1181267 3300041452 Bacteria 1361
196 Ga0451806_801162 3300041462 Bacteria 1543
197 Ga0451804_0851009 3300041463 Bacteria 2876
198 Ga0439449_0102804 3300042007 Bacteria 1057
199 Ga0439455_0048735 3300042012 Bacteria 1102
200 Ga0466972_0003938 3300044658 Bacteria 7409
201 Ga0466966_0000800 3300044684 Bacteria 20010
202 Ga0466961_0001911 3300044693 Bacteria 12985
203 Ga0466964_0069327 3300044706 Bacteria 1487
204 Ga0466971_0089019 3300044719 Bacteria 1412
205 Ga0466959_0007687 3300045049 Bacteria 7577
206 Ga0466958_0046119 3300045836 Bacteria 2630
207 Ga0495627_000443 3300046453 Bacteria 36101
208 Ga0495627_014435 3300046453 Bacteria 2757
209 Ga0495650_0000196 3300046471 Bacteria 131306
210 Ga0495585_0042667 3300046492 Bacteria 2539
211 Ga0495607_0013260 3300046501 Bacteria 5408
212 Ga0495607_0015998 3300046501 Bacteria 4848
213 Ga0495616_0001979 3300046513 Bacteria 13788
214 Ga0495620_0029442 3300046515 Bacteria 2540
215 Ga0495632_0000642 3300046519 Bacteria 32043
216 Ga0495648_0010351 3300046524 Bacteria 7106
217 Ga0495587_0013979 3300046536 Bacteria 5039
218 Ga0495622_0002767 3300046557 Bacteria 8383
219 Ga0495633_0014672 3300046558 Bacteria 4085
220 Ga0495656_0046068 3300046615 Bacteria 1844
221 Ga0495668_0014178 3300046616 Bacteria 4683
222 Ga0495625_0000126 3300046660 Bacteria 119900
223 Ga0495625_0003689 3300046660 Bacteria 14980
224 Ga0495625_0004912 3300046660 Bacteria 12445
225 Ga0495625_0012514 3300046660 Bacteria 6871
226 Ga0495625_0016269 3300046660 Bacteria 5858
227 Ga0495625_0130653 3300046660 Bacteria 1701
228 Ga0495659_0144532 3300046664 Bacteria 952
229 Ga0495661_0115541 3300046665 Bacteria 1490
230 Ga0495588_0133824 3300046674 Bacteria 1308
231 Ga0495669_0043225 3300046684 Bacteria 2005
232 Ga0495613_0001318 3300046689 Bacteria 18954
233 Ga0495671_0001461 3300046692 Bacteria 15856
234 Ga0495649_0010814 3300046694 Bacteria 5375
235 Ga0495600_0000460 3300046809 Bacteria 21142
236 Ga0495600_0244475 3300046809 Bacteria 1143
237 Ga0495581_0049855 3300047315 Bacteria 2418
238 Ga0495636_0202431 3300047318 Bacteria 907
239 Ga0495672_0011085 3300047320 Bacteria 6381
240 Ga0495672_0023057 3300047320 Bacteria 4036
241 Ga0495683_0107110 3300047323 Bacteria 1338
242 Ga0495677_0026020 3300047445 Bacteria 2123
243 Ga0495686_0021210 3300047472 Bacteria 4319
244 Ga0496100_0584457 3300048903 Bacteria 866
245 Ga0496101_0069838 3300048904 Bacteria 2571
246 Ga0496102_0020612 3300048905 Bacteria 5826
247 Ga0496104_0001388 3300048907 Bacteria 20943
248 Ga0496105_0071789 3300048908 Bacteria 2861
249 Ga0496107_0317144 3300048910 Bacteria 1160
250 Ga0496108_0030371 3300048911 Bacteria 4478
251 Ga0496109_0324795 3300048912 Bacteria 1452
252 Ga0496111_0196443 3300048914 Bacteria 1500
253 Ga0496112_0019629 3300048915 Bacteria 6383
254 Ga0496112_0454017 3300048915 Bacteria 1219
255 Ga0496115_0000050 3300048918 Bacteria 109402
256 Ga0496115_0031899 3300048918 Bacteria 4154
257 Ga0496116_0020292 3300048919 Bacteria 5051
258 Ga0496118_0090584 3300048921 Bacteria 2107
259 Ga0496121_0002740 3300048924 Bacteria 26193
260 Ga0496121_0012469 3300048924 Bacteria 9260
261 Ga0496121_0152584 3300048924 Bacteria 1698
262 Ga0496122_0000121 3300048925 Bacteria 181589
263 Ga0496122_0032739 3300048925 Bacteria 4292
264 Ga0496123_0000040 3300048926 Bacteria 258569
265 Ga0496123_0015118 3300048926 Bacteria 6351
266 Ga0496123_0133391 3300048926 Bacteria 1371
267 Ga0496124_0161770 3300048927 Bacteria 1744
268 Ga0496125_0000204 3300048928 Bacteria 125062
269 Ga0496125_0047851 3300048928 Bacteria 3571
270 Ga0496125_0128402 3300048928 Bacteria 1790
271 Ga0496126_0002767 3300048929 Bacteria 23109
272 Ga0501033_0198979 3300049570 Bacteria 1432
273 Ga0501043_0220579 3300049579 Bacteria 1467
274 Ga0501047_0474180 3300049581 Bacteria 1079
275 nmdc:mga03n38_43672_c1 3300050490 Bacteria 1965
276 nmdc:mga06z11_304421_c1 3300050494 Unclassified 948
277 nmdc:mga05p37_68856_c1 3300050507 Bacteria 4352
278 nmdc:mga05p37_74331_c1 3300050507 Bacteria 4183
279 nmdc:mga09592_95384_c1 3300050508 Bacteria 2545
280 nmdc:mga0qj67_1780_c1 3300050509 Bacteria 15248
281 nmdc:mga06r32_53304_c1 3300050510 Bacteria 3875
282 nmdc:mga06r32_78339_c1 3300050510 Bacteria 3213
283 nmdc:mga08y16_52013_c1 3300050511 Bacteria 4286
284 nmdc:mga0rr50_226544_c1 3300050513 Bacteria 1545
285 nmdc:mga0a205_120323_c1 3300050515 Bacteria 2525
286 nmdc:mga0a205_40358_c1 3300050515 Bacteria 4493
287 nmdc:mga0sz30_75814_c1 3300050516 Bacteria 1451
288 Ga0500610_0004424 3300053079 Bacteria 5577
289 Ga0500610_0004702 3300053079 Bacteria 5473
290 Ga0500578_0175326 3300053086 Bacteria 1324
291 Ga0500643_000014 3300053087 Bacteria 318249
292 Ga0500643_000727 3300053087 Bacteria 21619
293 Ga0500643_018903 3300053087 Bacteria 2278
294 Ga0500647_0111068 3300053091 Bacteria 1303
295 Ga0500651_0104394 3300053093 Bacteria 1735
296 Ga0500555_000157 3300053103 Bacteria 32176
297 Ga0500562_026697 3300053108 Bacteria 1514
298 Ga0500562_032141 3300053108 Bacteria 1385
299 Ga0500593_042428 3300053117 Bacteria 2031
300 Ga0500595_001959 3300053119 Bacteria 10581
301 Ga0500607_001189 3300053121 Bacteria 23935
302 Ga0500568_0051735 3300053139 Bacteria 1615
303 Ga0500568_0091135 3300053139 Bacteria 1149
304 Ga0500616_0059582 3300053153 Bacteria 1982
305 Ga0500619_008369 3300053154 Bacteria 2508
306 Ga0500627_0000079 3300053158 Bacteria 35871
307 Ga0500634_0068722 3300053161 Bacteria 1860
308 Ga0466962_0000922 3300061719 Bacteria 13320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0454017 Ga0496112_0454017_606_1205 194
2 3300048914 Ga0496111_0196443 Ga0496111_0196443_740_1450 221
3 3300024225 Ga0224572_1013873 Ga0224572_10138731 227
4 3300025915 Ga0207693_10072091 Ga0207693_100720913 228
5 3300028023 Ga0265357_1007991 Ga0265357_10079911 228
6 3300025908 Ga0207643_10182891 Ga0207643_101828912 235
7 3300003773 Ga0055537_1002181 Ga0055537_10021816 236
8 3300005336 Ga0070680_100158731 Ga0070680_1001587312 236
9 3300005337 Ga0070682_100081039 Ga0070682_1000810392 236
10 3300005435 Ga0070714_100711643 Ga0070714_1007116431 236
11 3300005436 Ga0070713_100448412 Ga0070713_1004484122 236
12 3300005437 Ga0070710_10116517 Ga0070710_101165171 236
13 3300005439 Ga0070711_100344548 Ga0070711_1003445481 236
14 3300005456 Ga0070678_100049359 Ga0070678_1000493592 236
15 3300005547 Ga0070693_100011275 Ga0070693_1000112752 236
16 3300005564 Ga0070664_100196956 Ga0070664_1001969562 236
17 3300005614 Ga0068856_100077073 Ga0068856_1000770733 236
18 3300006175 Ga0070712_100037150 Ga0070712_1000371503 236
19 3300006237 Ga0097621_100007946 Ga0097621_1000079464 236
20 3300006358 Ga0068871_100033566 Ga0068871_1000335664 236
21 3300009101 Ga0105247_10370865 Ga0105247_103708651 236
22 3300009174 Ga0105241_10071442 Ga0105241_100714424 236
23 3300009545 Ga0105237_10144614 Ga0105237_101446142 236
24 3300009551 Ga0105238_10123366 Ga0105238_101233663 236
25 3300010375 Ga0105239_10420075 Ga0105239_104200752 236
26 3300013105 Ga0157369_10104693 Ga0157369_101046932 236
27 3300013307 Ga0157372_10088092 Ga0157372_100880922 236
28 3300014968 Ga0157379_10061513 Ga0157379_100615134 236
29 3300014969 Ga0157376_10073870 Ga0157376_100738704 236
30 3300025263 Ga0209565_1000052 Ga0209565_100005213 236
31 3300025295 Ga0209564_1016260 Ga0209564_10162601 236
32 3300025898 Ga0207692_10058872 Ga0207692_100588722 236
33 3300025900 Ga0207710_10256865 Ga0207710_102568651 236
34 3300025924 Ga0207694_10427153 Ga0207694_104271532 236
35 3300025928 Ga0207700_10128908 Ga0207700_101289082 236
36 3300025929 Ga0207664_10022940 Ga0207664_100229404 236
37 3300025939 Ga0207665_10003819 Ga0207665_100038196 236
38 3300025945 Ga0207679_10319036 Ga0207679_103190362 236
39 3300026078 Ga0207702_10042853 Ga0207702_100428532 236
40 3300026121 Ga0207683_10037713 Ga0207683_100377137 236
41 3300048904 Ga0496101_0069838 Ga0496101_0069838_725_1489 236
42 3300048905 Ga0496102_0020612 Ga0496102_0020612_2904_3668 236
43 3300048910 Ga0496107_0317144 Ga0496107_0317144_359_1123 236
44 3300048911 Ga0496108_0030371 Ga0496108_0030371_2383_3147 236
45 3300048912 Ga0496109_0324795 Ga0496109_0324795_248_1012 236
46 3300048915 Ga0496112_0019629 Ga0496112_0019629_1141_1905 236
47 3300009177 Ga0105248_10190024 Ga0105248_101900242 238
48 3300048918 Ga0496115_0000050 Ga0496115_0000050_104235_105005 238
49 3300013100 Ga0157373_10047891 Ga0157373_100478912 239
50 3300041452 Ga0451793_1181267 Ga0451793_1181267_585_1313 240
51 3300041462 Ga0451806_801162 Ga0451806_801162_251_979 240
52 3300041463 Ga0451804_0851009 Ga0451804_0851009_1821_2549 240
53 3300005543 Ga0070672_100160063 Ga0070672_1001600632 242
54 3300005719 Ga0068861_100000029 Ga0068861_10000002940 242
55 3300026118 Ga0207675_100000012 Ga0207675_10000001221 242
56 3300046660 Ga0495625_0000126 Ga0495625_0000126_32817_33593 243
57 3300050494 nmdc:mga06z11_304421_c1 nmdc:mga06z11_304421_c1_115_870 243
58 3300006844 Ga0075428_100007997 Ga0075428_1000079972 244
59 3300007265 Ga0099794_10010487 Ga0099794_100104873 245
60 3300047472 Ga0495686_0021210 Ga0495686_0021210_3335_4120 245
61 3300005563 Ga0068855_100462197 Ga0068855_1004621972 246
62 3300005616 Ga0068852_100634885 Ga0068852_1006348851 246
63 3300005366 Ga0070659_100592184 Ga0070659_1005921841 247
64 3300046501 Ga0495607_0015998 Ga0495607_0015998_577_1329 247
65 3300046519 Ga0495632_0000642 Ga0495632_0000642_8631_9416 247
66 3300046616 Ga0495668_0014178 Ga0495668_0014178_1259_2044 247
67 3300047320 Ga0495672_0011085 Ga0495672_0011085_5023_5775 247
68 iso_pu_bacteria 2945909444 2945912839 247
69 iso_pu_bacteria 2945984333 2945984895 247
70 iso_pu_bacteria 2738541307 2738885753 248
71 3300006358 Ga0068871_100368063 Ga0068871_1003680632 249
72 3300025915 Ga0207693_10134988 Ga0207693_101349881 249
73 3300031456 Ga0307513_10073308 Ga0307513_100733082 249
74 iso_pu_bacteria 2932801729 2932801772 249
75 3300005844 Ga0068862_100100219 Ga0068862_1001002193 250
76 3300021388 Ga0213875_10008078 Ga0213875_100080786 250
77 3300027312 Ga0209371_1000033 Ga0209371_1000033366 250
78 3300027671 Ga0209588_1012438 Ga0209588_10124381 250
79 3300030500 Ga0268256_1002642 Ga0268256_10026427 250
80 3300037853 Ga0436364_1159000 Ga0436364_1159000_3940_4701 250
81 3300046453 Ga0495627_000443 Ga0495627_000443_24737_25522 250
82 3300047320 Ga0495672_0023057 Ga0495672_0023057_1772_2560 250
83 3300047323 Ga0495683_0107110 Ga0495683_0107110_294_1076 250
84 3300048918 Ga0496115_0031899 Ga0496115_0031899_196_960 250
85 iso_pu_bacteria 2884811622 2884813966 250
86 iso_pu_bacteria 2884836552 2884837834 250
87 iso_pu_bacteria 2884852848 2884854126 250
88 iso_pu_bacteria 2896154374 2896154757 250
89 3300005617 Ga0068859_100003209 Ga0068859_10000320915 251
90 3300005617 Ga0068859_100101019 Ga0068859_1001010192 251
91 3300006931 Ga0097620_100003209 Ga0097620_1000032095 251
92 3300006931 Ga0097620_100101021 Ga0097620_1001010213 251
93 3300009177 Ga0105248_10030215 Ga0105248_100302156 251
94 3300013104 Ga0157370_10000372 Ga0157370_1000037229 251
95 3300014497 Ga0182008_10023787 Ga0182008_100237873 251
96 3300025297 Ga0209758_1000057 Ga0209758_1000057146 251
97 3300025941 Ga0207711_10005376 Ga0207711_1000537610 251
98 3300026067 Ga0207678_10057897 Ga0207678_100578972 251
99 3300026095 Ga0207676_10114371 Ga0207676_101143713 251
100 3300028036 Ga0265355_1001392 Ga0265355_10013921 251
101 3300028379 Ga0268266_10175679 Ga0268266_101756792 251
102 3300028794 Ga0307515_10019845 Ga0307515_1001984510 251
103 3300031456 Ga0307513_10008387 Ga0307513_100083876 251
104 3300031507 Ga0307509_10000061 Ga0307509_1000006199 251
105 3300031730 Ga0307516_10024269 Ga0307516_100242696 251
106 3300031911 Ga0307412_10003407 Ga0307412_100034077 251
107 3300039450 Ga0436363_1336023 Ga0436363_1336023_163_966 251
108 3300044684 Ga0466966_0000800 Ga0466966_0000800_16938_17705 251
109 3300044693 Ga0466961_0001911 Ga0466961_0001911_2369_3136 251
110 3300045049 Ga0466959_0007687 Ga0466959_0007687_2659_3426 251
111 3300046492 Ga0495585_0042667 Ga0495585_0042667_626_1402 251
112 3300046515 Ga0495620_0029442 Ga0495620_0029442_1549_2322 251
113 3300046660 Ga0495625_0003689 Ga0495625_0003689_7773_8540 251
114 3300046664 Ga0495659_0144532 Ga0495659_0144532_84_851 251
115 3300046674 Ga0495588_0133824 Ga0495588_0133824_87_860 251
116 3300046684 Ga0495669_0043225 Ga0495669_0043225_933_1706 251
117 3300046692 Ga0495671_0001461 Ga0495671_0001461_13898_14671 251
118 3300047315 Ga0495581_0049855 Ga0495581_0049855_1597_2370 251
119 3300053079 Ga0500610_0004424 Ga0500610_0004424_2166_2939 251
120 3300053079 Ga0500610_0004702 Ga0500610_0004702_2100_2873 251
121 3300053087 Ga0500643_000014 Ga0500643_000014_101922_102686 251
122 3300053093 Ga0500651_0104394 Ga0500651_0104394_192_971 251
123 3300053103 Ga0500555_000157 Ga0500555_000157_5801_6613 251
124 3300053117 Ga0500593_042428 Ga0500593_042428_1181_1954 251
125 3300053121 Ga0500607_001189 Ga0500607_001189_21995_22768 251
126 3300053139 Ga0500568_0091135 Ga0500568_0091135_116_880 251
127 3300053158 Ga0500627_0000079 Ga0500627_0000079_33852_34625 251
128 3300053161 Ga0500634_0068722 Ga0500634_0068722_284_1057 251
129 iso_pu_bacteria 2643221622 2644126293 251
130 3300003320 rootH2_10160018 rootH2_101600181 252
131 3300005262 Ga0065165_1000028 Ga0065165_1000028204 252
132 3300005328 Ga0070676_10008002 Ga0070676_100080026 252
133 3300005334 Ga0068869_100003890 Ga0068869_1000038907 252
134 3300005364 Ga0070673_100000001 Ga0070673_100000001216 252
135 3300005459 Ga0068867_100003261 Ga0068867_1000032618 252
136 3300005563 Ga0068855_100000007 Ga0068855_10000000786 252
137 3300005578 Ga0068854_100090636 Ga0068854_1000906363 252
138 3300005718 Ga0068866_10137914 Ga0068866_101379142 252
139 3300006358 Ga0068871_100430377 Ga0068871_1004303771 252
140 3300006846 Ga0075430_100000038 Ga0075430_1000000387 252
141 3300006847 Ga0075431_100004413 Ga0075431_1000044132 252
142 3300006880 Ga0075429_100290261 Ga0075429_1002902611 252
143 3300006881 Ga0068865_100000047 Ga0068865_10000004748 252
144 3300009093 Ga0105240_10714140 Ga0105240_107141402 252
145 3300009098 Ga0105245_10010624 Ga0105245_100106247 252
146 3300009147 Ga0114129_10086800 Ga0114129_100868002 252
147 3300009148 Ga0105243_10003329 Ga0105243_100033297 252
148 3300009176 Ga0105242_10005745 Ga0105242_100057453 252
149 3300011119 Ga0105246_10005985 Ga0105246_100059857 252
150 3300013296 Ga0157374_10008679 Ga0157374_100086798 252
151 3300013297 Ga0157378_10009506 Ga0157378_100095062 252
152 3300013308 Ga0157375_10026254 Ga0157375_100262542 252
153 3300014745 Ga0157377_10001321 Ga0157377_100013214 252
154 3300014969 Ga0157376_10001546 Ga0157376_100015467 252
155 3300017792 Ga0163161_10004385 Ga0163161_1000438511 252
156 3300025302 Ga0207426_1013426 Ga0207426_10134262 252
157 3300025907 Ga0207645_10012561 Ga0207645_100125616 252
158 3300025927 Ga0207687_10314392 Ga0207687_103143922 252
159 3300025935 Ga0207709_10001679 Ga0207709_100016792 252
160 3300025938 Ga0207704_10000006 Ga0207704_1000000619 252
161 3300025942 Ga0207689_10002914 Ga0207689_1000291410 252
162 3300025949 Ga0207667_10000038 Ga0207667_1000003884 252
163 3300025960 Ga0207651_10000001 Ga0207651_10000001256 252
164 3300025961 Ga0207712_10067212 Ga0207712_100672123 252
165 3300031456 Ga0307513_10062297 Ga0307513_100622974 252
166 3300041413 Ga0439465_0004261 Ga0439465_0004261_2549_3331 252
167 3300046453 Ga0495627_014435 Ga0495627_014435_1725_2531 252
168 3300046501 Ga0495607_0013260 Ga0495607_0013260_599_1399 252
169 3300046513 Ga0495616_0001979 Ga0495616_0001979_6221_7024 252
170 3300046660 Ga0495625_0004912 Ga0495625_0004912_22_798 252
171 3300046689 Ga0495613_0001318 Ga0495613_0001318_15973_16743 252
172 3300046809 Ga0495600_0244475 Ga0495600_0244475_338_1108 252
173 3300047445 Ga0495677_0026020 Ga0495677_0026020_478_1254 252
174 3300048925 Ga0496122_0032739 Ga0496122_0032739_2250_3065 252
175 3300048926 Ga0496123_0015118 Ga0496123_0015118_4802_5617 252
176 3300050490 nmdc:mga03n38_43672_c1 nmdc:mga03n38_43672_c1_495_1286 252
177 3300050507 nmdc:mga05p37_68856_c1 nmdc:mga05p37_68856_c1_2266_3033 252
178 3300050509 nmdc:mga0qj67_1780_c1 nmdc:mga0qj67_1780_c1_7044_7811 252
179 3300050510 nmdc:mga06r32_78339_c1 nmdc:mga06r32_78339_c1_1890_2657 252
180 3300050515 nmdc:mga0a205_40358_c1 nmdc:mga0a205_40358_c1_1596_2363 252
181 3300053087 Ga0500643_000727 Ga0500643_000727_15053_15826 252
182 3300053108 Ga0500562_026697 Ga0500562_026697_561_1364 252
183 3300005353 Ga0070669_100274096 Ga0070669_1002740961 253
184 3300005436 Ga0070713_100616698 Ga0070713_1006166981 253
185 3300005457 Ga0070662_100228053 Ga0070662_1002280533 253
186 3300005468 Ga0070707_100212237 Ga0070707_1002122371 253
187 3300005536 Ga0070697_100109301 Ga0070697_1001093012 253
188 3300005543 Ga0070672_100035397 Ga0070672_1000353974 253
189 3300005549 Ga0070704_100476587 Ga0070704_1004765872 253
190 3300005616 Ga0068852_100000987 Ga0068852_10000098714 253
191 3300005843 Ga0068860_100452039 Ga0068860_1004520391 253
192 3300006847 Ga0075431_100022577 Ga0075431_1000225775 253
193 3300006871 Ga0075434_100784906 Ga0075434_1007849061 253
194 3300006880 Ga0075429_100164028 Ga0075429_1001640281 253
195 3300007788 Ga0099795_10098762 Ga0099795_100987621 253
196 3300009147 Ga0114129_10174941 Ga0114129_101749413 253
197 3300009176 Ga0105242_10012082 Ga0105242_100120824 253
198 3300009176 Ga0105242_10530564 Ga0105242_105305642 253
199 3300009545 Ga0105237_10227871 Ga0105237_102278711 253
200 3300009982 Ga0105147_103674 Ga0105147_1036742 253
201 3300011119 Ga0105246_10135557 Ga0105246_101355571 253
202 3300014326 Ga0157380_10326775 Ga0157380_103267752 253
203 3300025914 Ga0207671_10201255 Ga0207671_102012552 253
204 3300025923 Ga0207681_10352749 Ga0207681_103527492 253
205 3300025934 Ga0207686_10015676 Ga0207686_100156762 253
206 3300026142 Ga0207698_10000758 Ga0207698_1000075814 253
207 3300027907 Ga0207428_10053559 Ga0207428_100535591 253
208 3300028381 Ga0268264_10281125 Ga0268264_102811251 253
209 3300035695 Ga0373927_0281713 Ga0373927_0281713_309_1076 253
210 3300039438 Ga0436360_0157384 Ga0436360_0157384_1662_2495 253
211 3300044658 Ga0466972_0003938 Ga0466972_0003938_1015_1788 253
212 3300044706 Ga0466964_0069327 Ga0466964_0069327_516_1289 253
213 3300044719 Ga0466971_0089019 Ga0466971_0089019_318_1091 253
214 3300045836 Ga0466958_0046119 Ga0466958_0046119_1385_2158 253
215 3300046615 Ga0495656_0046068 Ga0495656_0046068_752_1522 253
216 3300050507 nmdc:mga05p37_74331_c1 nmdc:mga05p37_74331_c1_2556_3332 253
217 3300050510 nmdc:mga06r32_53304_c1 nmdc:mga06r32_53304_c1_1887_2663 253
218 3300050511 nmdc:mga08y16_52013_c1 nmdc:mga08y16_52013_c1_3124_3936 253
219 3300050513 nmdc:mga0rr50_226544_c1 nmdc:mga0rr50_226544_c1_380_1156 253
220 3300050515 nmdc:mga0a205_120323_c1 nmdc:mga0a205_120323_c1_1164_1940 253
221 3300053087 Ga0500643_018903 Ga0500643_018903_504_1283 253
222 3300061719 Ga0466962_0000922 Ga0466962_0000922_11305_12078 253
223 3300003322 rootL2_10253618 rootL2_102536184 254
224 3300005327 Ga0070658_10308981 Ga0070658_103089812 254
225 3300005563 Ga0068855_100030458 Ga0068855_1000304584 254
226 3300005614 Ga0068856_100138112 Ga0068856_1001381122 254
227 3300005616 Ga0068852_100042519 Ga0068852_1000425194 254
228 3300007788 Ga0099795_10107057 Ga0099795_101070571 254
229 3300009093 Ga0105240_10000422 Ga0105240_1000042239 254
230 3300009093 Ga0105240_10002886 Ga0105240_1000288612 254
231 3300009094 Ga0111539_10140297 Ga0111539_101402972 254
232 3300009551 Ga0105238_10105733 Ga0105238_101057332 254
233 3300013100 Ga0157373_10026183 Ga0157373_100261833 254
234 3300025233 Ga0209437_100072 Ga0209437_100072147 254
235 3300025304 Ga0209257_1036211 Ga0209257_10362112 254
236 3300025913 Ga0207695_10047423 Ga0207695_100474231 254
237 3300025949 Ga0207667_10039274 Ga0207667_100392744 254
238 3300026078 Ga0207702_10162583 Ga0207702_101625832 254
239 3300026142 Ga0207698_10005635 Ga0207698_100056353 254
240 3300042007 Ga0439449_0102804 Ga0439449_0102804_131_913 254
241 3300046660 Ga0495625_0016269 Ga0495625_0016269_281_1138 254
242 3300047318 Ga0495636_0202431 Ga0495636_0202431_40_831 254
243 3300048919 Ga0496116_0020292 Ga0496116_0020292_2612_3403 254
244 3300048924 Ga0496121_0152584 Ga0496121_0152584_73_864 254
245 3300048925 Ga0496122_0000121 Ga0496122_0000121_92767_93558 254
246 3300048926 Ga0496123_0000040 Ga0496123_0000040_93067_93858 254
247 3300048926 Ga0496123_0133391 Ga0496123_0133391_351_1208 254
248 3300048927 Ga0496124_0161770 Ga0496124_0161770_17_808 254
249 3300048928 Ga0496125_0000204 Ga0496125_0000204_16422_17204 254
250 3300048928 Ga0496125_0047851 Ga0496125_0047851_736_1527 254
251 3300049570 Ga0501033_0198979 Ga0501033_0198979_180_965 254
252 3300049579 Ga0501043_0220579 Ga0501043_0220579_488_1273 254
253 3300049581 Ga0501047_0474180 Ga0501047_0474180_45_830 254
254 3300050508 nmdc:mga09592_95384_c1 nmdc:mga09592_95384_c1_190_972 254
255 3300050516 nmdc:mga0sz30_75814_c1 nmdc:mga0sz30_75814_c1_249_1178 254
256 3300053139 Ga0500568_0051735 Ga0500568_0051735_465_1322 254
257 3300005344 Ga0070661_100162046 Ga0070661_1001620462 255
258 3300005436 Ga0070713_100580400 Ga0070713_1005804001 255
259 3300005457 Ga0070662_100185052 Ga0070662_1001850522 255
260 3300005548 Ga0070665_100246581 Ga0070665_1002465811 255
261 3300014497 Ga0182008_10162652 Ga0182008_101626522 255
262 3300015261 Ga0182006_1023421 Ga0182006_10234211 255
263 3300025304 Ga0209257_1009984 Ga0209257_10099842 255
264 3300025931 Ga0207644_10076099 Ga0207644_100760992 255
265 3300025933 Ga0207706_10135783 Ga0207706_101357831 255
266 3300028786 Ga0307517_10037462 Ga0307517_100374625 255
267 3300033180 Ga0307510_10095008 Ga0307510_100950084 255
268 3300042012 Ga0439455_0048735 Ga0439455_0048735_195_971 255
269 3300046471 Ga0495650_0000196 Ga0495650_0000196_32042_32818 255
270 3300046524 Ga0495648_0010351 Ga0495648_0010351_2055_2834 255
271 3300046536 Ga0495587_0013979 Ga0495587_0013979_168_944 255
272 3300046557 Ga0495622_0002767 Ga0495622_0002767_3553_4329 255
273 3300046558 Ga0495633_0014672 Ga0495633_0014672_3261_4037 255
274 3300046660 Ga0495625_0012514 Ga0495625_0012514_3827_4720 255
275 3300046660 Ga0495625_0130653 Ga0495625_0130653_498_1277 255
276 3300046665 Ga0495661_0115541 Ga0495661_0115541_94_870 255
277 3300046694 Ga0495649_0010814 Ga0495649_0010814_2233_3012 255
278 3300046809 Ga0495600_0000460 Ga0495600_0000460_18479_19255 255
279 3300048921 Ga0496118_0090584 Ga0496118_0090584_27_875 255
280 3300048924 Ga0496121_0002740 Ga0496121_0002740_9887_10684 255
281 3300048924 Ga0496121_0012469 Ga0496121_0012469_2549_3325 255
282 3300048928 Ga0496125_0128402 Ga0496125_0128402_345_1142 255
283 3300048929 Ga0496126_0002767 Ga0496126_0002767_6416_7213 255
284 3300053086 Ga0500578_0175326 Ga0500578_0175326_101_994 255
285 3300053091 Ga0500647_0111068 Ga0500647_0111068_434_1210 255
286 3300053108 Ga0500562_032141 Ga0500562_032141_500_1276 255
287 3300053119 Ga0500595_001959 Ga0500595_001959_9634_10410 255
288 3300053153 Ga0500616_0059582 Ga0500616_0059582_1056_1832 255
289 3300053154 Ga0500619_008369 Ga0500619_008369_250_1026 255
290 3300002774 JGI25150J39212_1000811 JGI25150J39212_10008116 256
291 3300003187 JGI25151J46595_10024547 JGI25151J46595_100245473 256
292 3300003215 JGI25153J46596_10000055 JGI25153J46596_10000055139 256
293 3300003771 Ga0055526_1001699 Ga0055526_100169913 256
294 3300003791 Ga0055530_10019770 Ga0055530_100197703 256
295 3300003791 Ga0055530_10025686 Ga0055530_100256862 256
296 3300003792 Ga0055540_1000448 Ga0055540_100044821 256
297 3300003794 Ga0055531_10026851 Ga0055531_100268513 256
298 3300003794 Ga0055531_10027049 Ga0055531_100270493 256
299 3300005539 Ga0068853_100099907 Ga0068853_1000999072 256
300 3300007265 Ga0099794_10039318 Ga0099794_100393181 256
301 3300025245 Ga0207425_1000005 Ga0207425_1000005562 256
302 3300025258 Ga0209129_1000753 Ga0209129_100075311 256
303 3300025292 Ga0209676_1002721 Ga0209676_100272113 256
304 3300025292 Ga0209676_1008804 Ga0209676_10088042 256
305 3300025294 Ga0209025_1000128 Ga0209025_100012820 256
306 3300025295 Ga0209564_1003609 Ga0209564_10036098 256
307 3300025297 Ga0209758_1000002 Ga0209758_1000002782 256
308 3300025297 Ga0209758_1034894 Ga0209758_10348941 256
309 3300025298 Ga0209050_1000001 Ga0209050_1000001766 256
310 3300025298 Ga0209050_1000166 Ga0209050_100016671 256
311 3300025298 Ga0209050_1007862 Ga0209050_10078625 256
312 3300025303 Ga0209051_1001182 Ga0209051_10011829 256
313 3300025304 Ga0209257_1004244 Ga0209257_10042446 256
314 3300025304 Ga0209257_1004335 Ga0209257_10043356 256
315 3300048903 Ga0496100_0584457 Ga0496100_0584457_52_843 256
316 3300048907 Ga0496104_0001388 Ga0496104_0001388_11423_12268 256
317 3300048908 Ga0496105_0071789 Ga0496105_0071789_1955_2800 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

37

250

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.9161 35 255
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8922 35 255
1xkl-assembly1.cif.gz_D crystal structure of salicylic acid-binding protein 2 (sabp2) from nicotiana tabacum, nesg target ar2241 0.8758 33 254
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8728 35 256
3dqz-assembly2.cif.gz_D structure of the hydroxynitrile lyase from arabidopsis thaliana 0.8696 33 254
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9692 35 254 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9279 35 254 3.40.50.1820
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8933 33 127 3.40.50.1820
af_I1JYD1_9_266_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8781 33 254 3.40.50.1820
af_F4IMK2_5_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8657 33 254 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1B5EVM5-F1-model_v4 deleted 0.998 93 255
AF-A0A829XW30-F1-model_v4 deleted 0.9963 31 255
AF-A0A7X2RQG8-F1-model_v4 Alpha/beta fold hydrolase 0.9961 33 254 GO:0016787
AF-A0A7Y9P351-F1-model_v4 deleted 0.9942 93 256
AF-A0A527W588-F1-model_v4 Alpha/beta hydrolase 0.9941 106 256 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.18 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map