F403714

General Info

Members Datasets Scaffolds Average Seq Length
316 186 632 153

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10257202|Ga0207664_102572023
Length 165
Sequence MNISVKSEYALKAVFDLASQTLAKPQGAPASPVKIADIAKRQQIPQKFLELILAGLKQNGFVDSRRGAEGGYALARPADEITLADVIRVIDGPLANVHDLSLSELSYAGPAKRLREVWMAVRASLRSVLETTTLADLAAGHLPDEVKEMASMYQAEERRQRTRRR

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
72 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
98 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
163 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
164 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
165 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
166 2855683550 Micromonospora sp. RP3T Isolate Unclassified
167 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
168 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
169 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
170 2858882152 Micromonospora noduli MED15 Isolate Nodule
171 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
172 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
173 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
174 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
175 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
176 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
177 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
178 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
179 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
180 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
181 649633069 Micromonospora sp. L5 Isolate Unclassified
182 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
183 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
184 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
185 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
186 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.14
Metatranscriptomes 1.27
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 1.58
Rhizoplane 3.48
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 4.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10257202 3300025929 Bacteria 1526
2 JGI24737J22298_10055428 3300001990 Bacteria 1198
3 JGI24735J21928_10169203 3300002067 Bacteria 632
4 rootH2_10248353 3300003320 Bacteria 1048
5 JGI25405J52794_10096338 3300003911 Bacteria 658
6 Ga0070658_10724630 3300005327 Bacteria 864
7 Ga0070673_100394056 3300005364 Bacteria 1237
8 Ga0070713_100159280 3300005436 Unclassified 2014
9 Ga0070662_100613976 3300005457 Bacteria 915
10 Ga0070707_100001564 3300005468 Bacteria 22207
11 Ga0070695_101198917 3300005545 Bacteria 624
12 Ga0070696_101160734 3300005546 Bacteria 651
13 Ga0070665_100031877 3300005548 Bacteria 5305
14 Ga0070665_100041478 3300005548 Bacteria 4626
15 Ga0070665_100072445 3300005548 Bacteria 3453
16 Ga0070665_100172184 3300005548 Bacteria 2166
17 Ga0068855_100008193 3300005563 Bacteria 12633
18 Ga0068855_100024939 3300005563 Bacteria 7156
19 Ga0068855_100040479 3300005563 Bacteria 5531
20 Ga0068854_100053728 3300005578 Bacteria 2894
21 Ga0068854_100137712 3300005578 Bacteria 1870
22 Ga0068856_100004865 3300005614 Bacteria 13303
23 Ga0068856_100077341 3300005614 Bacteria 3297
24 Ga0068856_100145227 3300005614 Bacteria 2380
25 Ga0068856_100160407 3300005614 Bacteria 2259
26 Ga0068852_100011646 3300005616 Bacteria 6633
27 Ga0068852_100039100 3300005616 Bacteria 3992
28 Ga0068852_100628337 3300005616 Bacteria 1080
29 Ga0068859_100003150 3300005617 Bacteria 16776
30 Ga0081455_10011702 3300005937 Bacteria 8796
31 Ga0081538_10127989 3300005981 Bacteria 1201
32 Ga0081540_1117429 3300005983 Bacteria 1111
33 Ga0070717_10251954 3300006028 Unclassified 1560
34 Ga0075428_100141461 3300006844 Bacteria 2616
35 Ga0075428_100394902 3300006844 Bacteria 1482
36 Ga0075430_100152429 3300006846 Bacteria 1924
37 Ga0075431_100083195 3300006847 Bacteria 3304
38 Ga0075431_100117604 3300006847 Bacteria 2743
39 Ga0075433_10274590 3300006852 Bacteria 1494
40 Ga0075434_100171843 3300006871 Bacteria 2187
41 Ga0075434_100339003 3300006871 Bacteria 1524
42 Ga0075429_100124956 3300006880 Bacteria 2250
43 Ga0075436_101245600 3300006914 Bacteria 562
44 Ga0097620_100003150 3300006931 Bacteria 16776
45 Ga0075435_100322600 3300007076 Bacteria 1322
46 Ga0075435_100375947 3300007076 Bacteria 1220
47 Ga0075435_100705986 3300007076 Bacteria 877
48 Ga0105240_10017249 3300009093 Bacteria 9739
49 Ga0105240_10018304 3300009093 Bacteria 9415
50 Ga0105240_10033035 3300009093 Bacteria 6689
51 Ga0105240_10169452 3300009093 Bacteria 2587
52 Ga0111539_10380053 3300009094 Bacteria 1644
53 Ga0111539_12543646 3300009094 Unclassified 594
54 Ga0114129_10162481 3300009147 Bacteria 3049
55 Ga0114129_10709172 3300009147 Bacteria 1292
56 Ga0114129_10755580 3300009147 Unclassified 1244
57 Ga0114129_10869397 3300009147 Bacteria 1145
58 Ga0114129_10964342 3300009147 Bacteria 1076
59 Ga0105241_10000239 3300009174 Bacteria 41568
60 Ga0105241_10177605 3300009174 Bacteria 1763
61 Ga0105241_10371465 3300009174 Bacteria 1247
62 Ga0105237_10005813 3300009545 Bacteria 13836
63 Ga0105237_10029858 3300009545 Bacteria 5537
64 Ga0105237_10266391 3300009545 Bacteria 1716
65 Ga0105238_10074950 3300009551 Bacteria 3376
66 Ga0105238_11354562 3300009551 Unclassified 738
67 Ga0105239_10013580 3300010375 Bacteria 9040
68 Ga0105239_10015148 3300010375 Bacteria 8545
69 Ga0105239_10041965 3300010375 Bacteria 5012
70 Ga0105239_10052673 3300010375 Bacteria 4463
71 Ga0105239_10149577 3300010375 Bacteria 2605
72 Ga0157369_10071780 3300013105 Bacteria 3716
73 Ga0157369_11924889 3300013105 Unclassified 600
74 Ga0157374_10472658 3300013296 Bacteria 1256
75 Ga0163162_10736735 3300013306 Bacteria 1106
76 Ga0157372_11194160 3300013307 Bacteria 879
77 Ga0157372_11627178 3300013307 Bacteria 743
78 Ga0163163_10545127 3300014325 Bacteria 1222
79 Ga0197907_10680835 3300020069 Bacteria 1089
80 Ga0206354_10207205 3300020081 Bacteria 2242
81 Ga0206353_11962019 3300020082 Bacteria 4882
82 Ga0213873_10006995 3300021358 Bacteria 2242
83 Ga0213876_10050434 3300021384 Bacteria 2199
84 Ga0213876_10367626 3300021384 Bacteria 765
85 Ga0224712_10020859 3300022467 Bacteria 2233
86 Ga0207647_10004826 3300025904 Bacteria 9974
87 Ga0207647_10006557 3300025904 Bacteria 8456
88 Ga0207647_10033345 3300025904 Bacteria 3298
89 Ga0207647_10131774 3300025904 Bacteria 1469
90 Ga0207705_10687522 3300025909 Bacteria 795
91 Ga0207705_10752537 3300025909 Bacteria 757
92 Ga0207654_10056150 3300025911 Bacteria 2283
93 Ga0207654_10164869 3300025911 Bacteria 1434
94 Ga0207654_10521989 3300025911 Bacteria 841
95 Ga0207695_10002376 3300025913 Bacteria 27941
96 Ga0207695_10017640 3300025913 Bacteria 8295
97 Ga0207695_10017688 3300025913 Bacteria 8280
98 Ga0207695_10066127 3300025913 Bacteria 3714
99 Ga0207695_10385450 3300025913 Bacteria 1287
100 Ga0207671_10000306 3300025914 Bacteria 72328
101 Ga0207671_10000365 3300025914 Bacteria 64530
102 Ga0207671_10020473 3300025914 Bacteria 5034
103 Ga0207671_10253520 3300025914 Bacteria 1383
104 Ga0207652_10133560 3300025921 Bacteria 2215
105 Ga0207646_10024152 3300025922 Bacteria 5572
106 Ga0207694_10001473 3300025924 Bacteria 20133
107 Ga0207694_10568982 3300025924 Bacteria 952
108 Ga0207700_10320783 3300025928 Unclassified 1342
109 Ga0207664_10179579 3300025929 Bacteria 1816
110 Ga0207661_10522311 3300025944 Bacteria 1086
111 Ga0207667_10006887 3300025949 Bacteria 13734
112 Ga0207667_10017035 3300025949 Bacteria 8197
113 Ga0207667_10056839 3300025949 Bacteria 4108
114 Ga0207667_10100421 3300025949 Bacteria 2985
115 Ga0207667_10107618 3300025949 Bacteria 2877
116 Ga0207651_10865668 3300025960 Bacteria 804
117 Ga0207640_10234987 3300025981 Bacteria 1413
118 Ga0207640_10322070 3300025981 Bacteria 1231
119 Ga0207658_10396633 3300025986 Bacteria 1212
120 Ga0207639_10167540 3300026041 Bacteria 1857
121 Ga0207702_10005011 3300026078 Bacteria 11634
122 Ga0207702_10069121 3300026078 Bacteria 3036
123 Ga0207702_10242813 3300026078 Bacteria 1688
124 Ga0207702_11045604 3300026078 Bacteria 810
125 Ga0207698_10075748 3300026142 Bacteria 2690
126 Ga0207698_10091298 3300026142 Bacteria 2493
127 Ga0268266_10053896 3300028379 Bacteria 3456
128 Ga0268266_10090621 3300028379 Bacteria 2680
129 Ga0268266_10158996 3300028379 Bacteria 2043
130 Ga0268266_11338891 3300028379 Bacteria 691
131 Ga0316576_10750081 3300031727 Unclassified 705
132 Ga0307507_10172615 3300033179 Bacteria 1567
133 Ga0373941_0036144 3300035115 Bacteria 1501
134 Ga0373962_0027133 3300035242 Bacteria 1548
135 Ga0373931_1045456 3300035691 Bacteria 554
136 Ga0373927_0807228 3300035695 Bacteria 620
137 Ga0373937_1025958 3300036401 Bacteria 774
138 Ga0395899_0000614 3300037312 Bacteria 37099
139 Ga0242420_060398 3300038996 Bacteria 755
140 Ga0436365_0020726 3300039437 Bacteria 2206
141 Ga0436365_0786556 3300039437 Unclassified 875
142 Ga0436365_1445525 3300039437 Bacteria 7250
143 Ga0436361_0191581 3300039447 Bacteria 1938
144 Ga0436362_0084096 3300039453 Bacteria 5279
145 Ga0436362_0190322 3300039453 Bacteria 684
146 Ga0436362_0789622 3300039453 Bacteria 999
147 Ga0466969_0005692 3300044656 Bacteria 6624
148 Ga0466972_0015631 3300044658 Bacteria 3796
149 Ga0466972_0164395 3300044658 Bacteria 1042
150 Ga0453683_0281670 3300044673 Bacteria 1062
151 Ga0466965_0024607 3300044683 Bacteria 2913
152 Ga0466966_0004614 3300044684 Bacteria 9076
153 Ga0466966_0190389 3300044684 Bacteria 1243
154 Ga0466961_0056844 3300044693 Bacteria 2492
155 Ga0466961_0113190 3300044693 Bacteria 1706
156 Ga0466961_0138334 3300044693 Bacteria 1525
157 Ga0466961_0404685 3300044693 Bacteria 828
158 Ga0466963_0005098 3300044694 Bacteria 7676
159 Ga0466963_0007434 3300044694 Bacteria 6529
160 Ga0466963_0013415 3300044694 Bacteria 5031
161 Ga0466963_0028454 3300044694 Bacteria 3588
162 Ga0466963_0224946 3300044694 Bacteria 1314
163 Ga0466963_0299479 3300044694 Bacteria 1131
164 Ga0466963_0471925 3300044694 Bacteria 885
165 Ga0466964_0008028 3300044706 Bacteria 3955
166 Ga0466964_0273748 3300044706 Bacteria 841
167 Ga0466964_0331028 3300044706 Bacteria 777
168 Ga0466964_0362985 3300044706 Bacteria 747
169 Ga0466964_0895734 3300044706 Bacteria 507
170 Ga0466971_0061180 3300044719 Bacteria 1702
171 Ga0466971_0061236 3300044719 Bacteria 1701
172 Ga0466968_0063197 3300044735 Bacteria 1600
173 Ga0466968_0191256 3300044735 Bacteria 955
174 Ga0466970_0005327 3300044765 Bacteria 6378
175 Ga0466970_0044157 3300044765 Bacteria 2373
176 Ga0466957_0018616 3300044842 Bacteria 4079
177 Ga0466957_0085921 3300044842 Bacteria 1965
178 Ga0466957_0093805 3300044842 Bacteria 1884
179 Ga0466957_0306703 3300044842 Bacteria 1068
180 Ga0466957_0540257 3300044842 Bacteria 811
181 Ga0466960_0009545 3300044901 Bacteria 4004
182 Ga0466960_0052363 3300044901 Bacteria 1975
183 Ga0466960_0312233 3300044901 Bacteria 888
184 Ga0466960_0911259 3300044901 Bacteria 537
185 Ga0466959_0031756 3300045049 Bacteria 3908
186 Ga0466959_0062901 3300045049 Bacteria 2696
187 Ga0466959_0130086 3300045049 Bacteria 1784
188 Ga0466959_0204342 3300045049 Bacteria 1374
189 Ga0466959_0273557 3300045049 Bacteria 1160
190 Ga0466959_0476054 3300045049 Bacteria 845
191 Ga0466958_0025941 3300045836 Bacteria 3460
192 Ga0466958_0091263 3300045836 Bacteria 1885
193 Ga0466958_0119631 3300045836 Bacteria 1648
194 Ga0466958_0670953 3300045836 Unclassified 675
195 Ga0466967_0006470 3300045976 Bacteria 8295
196 Ga0466967_0012577 3300045976 Bacteria 6484
197 Ga0466967_0069649 3300045976 Bacteria 3144
198 Ga0466967_0088713 3300045976 Bacteria 2807
199 Ga0466967_0605978 3300045976 Bacteria 1081
200 Ga0466967_0689723 3300045976 Bacteria 1011
201 Ga0466967_1330032 3300045976 Bacteria 716
202 Ga0466967_1809296 3300045976 Bacteria 608
203 Ga0466967_2600349 3300045976 Bacteria 501
204 Ga0495592_0000533 3300046454 Bacteria 27280
205 Ga0495592_0564125 3300046454 Bacteria 698
206 Ga0495651_0001903 3300046462 Bacteria 16157
207 Ga0495653_0147301 3300046463 Bacteria 1648
208 Ga0495580_0032862 3300046472 Bacteria 3739
209 Ga0495662_0054736 3300046476 Bacteria 1927
210 Ga0495664_0002661 3300046477 Bacteria 9612
211 Ga0495664_0347122 3300046477 Bacteria 894
212 Ga0495608_0047956 3300046511 Bacteria 2838
213 Ga0495608_0723812 3300046511 Bacteria 591
214 Ga0495618_0216519 3300046514 Bacteria 1209
215 Ga0495628_0000836 3300046516 Bacteria 28499
216 Ga0495630_0059424 3300046517 Bacteria 2868
217 Ga0495666_0002070 3300046526 Bacteria 9935
218 Ga0495652_0004761 3300046529 Bacteria 12911
219 Ga0495665_0017087 3300046531 Bacteria 3903
220 Ga0495640_0075309 3300046533 Bacteria 2254
221 Ga0495586_0024643 3300046535 Bacteria 3218
222 Ga0495587_0006313 3300046536 Bacteria 7730
223 Ga0495645_0005926 3300046543 Bacteria 8443
224 Ga0495645_0157178 3300046543 Bacteria 1574
225 Ga0495622_0033830 3300046557 Bacteria 2385
226 Ga0495634_0051747 3300046642 Bacteria 2755
227 Ga0495657_0020914 3300046675 Bacteria 4702
228 Ga0495623_0015519 3300046679 Bacteria 4924
229 Ga0495646_0001399 3300046680 Bacteria 14340
230 Ga0495658_0059624 3300046683 Bacteria 2186
231 Ga0495613_0007413 3300046689 Bacteria 8175
232 Ga0495600_0011055 3300046809 Bacteria 5616
233 Ga0495581_0121933 3300047315 Bacteria 1517
234 Ga0495581_0253371 3300047315 Bacteria 1029
235 Ga0495604_0002833 3300047317 Bacteria 13914
236 Ga0495604_0584386 3300047317 Bacteria 717
237 Ga0495674_0004715 3300047319 Bacteria 13117
238 Ga0495675_0025426 3300047444 Bacteria 3775
239 Ga0495593_0202317 3300047673 Bacteria 998
240 Ga0496102_0000094 3300048905 Bacteria 125159
241 Ga0496102_1777576 3300048905 Unclassified 534
242 Ga0496103_0000042 3300048906 Bacteria 168701
243 Ga0496104_0369521 3300048907 Bacteria 1347
244 Ga0496104_1154919 3300048907 Bacteria 678
245 Ga0496109_0898076 3300048912 Bacteria 824
246 Ga0496110_0010048 3300048913 Bacteria 7682
247 Ga0496111_0124248 3300048914 Bacteria 1907
248 Ga0496112_0677408 3300048915 Bacteria 960
249 Ga0496114_0147209 3300048917 Bacteria 2042
250 Ga0496115_0051166 3300048918 Bacteria 3312
251 Ga0496118_0019915 3300048921 Bacteria 5973
252 Ga0496119_0080103 3300048922 Bacteria 1884
253 Ga0496121_0249296 3300048924 Bacteria 1232
254 Ga0501031_0008760 3300049568 Bacteria 6581
255 Ga0501032_0008446 3300049569 Bacteria 7507
256 Ga0501033_0510153 3300049570 Bacteria 831
257 Ga0501034_0752181 3300049571 Bacteria 870
258 Ga0501037_0057041 3300049573 Bacteria 2852
259 Ga0501038_0000215 3300049574 Bacteria 49658
260 Ga0501043_0009121 3300049579 Bacteria 7804
261 Ga0501047_0028151 3300049581 Bacteria 5416
262 Ga0501047_1348536 3300049581 Unclassified 528
263 Ga0501048_0000571 3300049582 Bacteria 26167
264 Ga0501067_0130548 3300049583 Bacteria 1398
265 Ga0501070_0070382 3300049586 Bacteria 2897
266 Ga0501070_0183785 3300049586 Bacteria 1720
267 Ga0501070_0214002 3300049586 Bacteria 1581
268 Ga0501081_0631670 3300049743 Bacteria 802
269 Ga0501035_0032313 3300049822 Bacteria 4762
270 Ga0501044_0025594 3300049823 Bacteria 6256
271 nmdc:mga05p37_1312484_c1 3300050507 Bacteria 737
272 nmdc:mga05p37_518072_c1 3300050507 Bacteria 1365
273 nmdc:mga05p37_681665_c1 3300050507 Bacteria 1145
274 nmdc:mga05p37_923475_c1 3300050507 Bacteria 938
275 nmdc:mga09592_60014_c1 3300050508 Bacteria 3215
276 nmdc:mga09592_95557_c1 3300050508 Bacteria 2542
277 nmdc:mga0qj67_320248_c1 3300050509 Bacteria 1255
278 nmdc:mga06r32_62789_c1 3300050510 Bacteria 3579
279 nmdc:mga06r32_73864_c1 3300050510 Bacteria 3304
280 nmdc:mga08y16_1663249_c1 3300050511 Unclassified 594
281 nmdc:mga0n895_102866_c1 3300050512 Bacteria 2867
282 nmdc:mga0n895_81376_c1 3300050512 Bacteria 3227
283 nmdc:mga0rr50_1457549_c1 3300050513 Bacteria 579
284 nmdc:mga0rr50_396541_c1 3300050513 Bacteria 1165
285 nmdc:mga0a205_475668_c1 3300050515 Bacteria 1108
286 Ga0495601_0046168 3300053077 Bacteria 2742
287 Ga0495601_0130277 3300053077 Bacteria 1638
288 Ga0495612_0281714 3300053078 Bacteria 743
289 Ga0466962_0008172 3300061719 Bacteria 5018
290 Ga0466962_0189051 3300061719 Bacteria 1004
291 Ga0466962_0298831 3300061719 Bacteria 796
292 Ga0466962_0387826 3300061719 Bacteria 698
293 2772643762 2772190715 Bacteria 6959372
294 2855672741 2855670206 Bacteria 7120389
295 2855683051 2855676851 Bacteria 7063653
296 2855686126 2855683550 Bacteria 7134265
297 2856861401 2856858025 Bacteria 7255264
298 2857291533 2857288857 Bacteria 7189066
299 2858855371 2858848962 Bacteria 6963058
300 2858885534 2858882152 Bacteria 7230291
301 2858889560 2858888857 Bacteria 7060307
302 2858897975 2858895516 Bacteria 7378898
303 2858904088 2858902515 Bacteria 7086037
304 2869053522 2869048445 Bacteria 6875584
305 2869066006 2869061728 Bacteria 7112407
306 2869069988 2869068681 Bacteria 7205615
307 2880492682 2880489317 Bacteria 7096270
308 2880499636 2880495981 Bacteria 7340502
309 2929221595 2929219909 Bacteria 6984360
310 2929228232 2929226422 Bacteria 7248583
311 649812156 649633069 Bacteria 6962533
312 8003832787 8003830390 Bacteria 6541657
313 8003860904 8003856774 Bacteria 7675274
314 8054706841 8054704163 Bacteria 7247792
315 8054731332 8054727385 Bacteria 7558670
316 8054738703 8054734606 Bacteria 6947278
317 Ga0207664_10257202
318 JGI24737J22298_10055428
319 JGI24735J21928_10169203
320 rootH2_10248353
321 JGI25405J52794_10096338
322 Ga0070658_10724630
323 Ga0070673_100394056
324 Ga0070713_100159280
325 Ga0070662_100613976
326 Ga0070707_100001564
327 Ga0070695_101198917
328 Ga0070696_101160734
329 Ga0070665_100031877
330 Ga0070665_100041478
331 Ga0070665_100072445
332 Ga0070665_100172184
333 Ga0068855_100008193
334 Ga0068855_100024939
335 Ga0068855_100040479
336 Ga0068854_100053728
337 Ga0068854_100137712
338 Ga0068856_100004865
339 Ga0068856_100077341
340 Ga0068856_100145227
341 Ga0068856_100160407
342 Ga0068852_100011646
343 Ga0068852_100039100
344 Ga0068852_100628337
345 Ga0068859_100003150
346 Ga0081455_10011702
347 Ga0081538_10127989
348 Ga0081540_1117429
349 Ga0070717_10251954
350 Ga0075428_100141461
351 Ga0075428_100394902
352 Ga0075430_100152429
353 Ga0075431_100083195
354 Ga0075431_100117604
355 Ga0075433_10274590
356 Ga0075434_100171843
357 Ga0075434_100339003
358 Ga0075429_100124956
359 Ga0075436_101245600
360 Ga0097620_100003150
361 Ga0075435_100322600
362 Ga0075435_100375947
363 Ga0075435_100705986
364 Ga0105240_10017249
365 Ga0105240_10018304
366 Ga0105240_10033035
367 Ga0105240_10169452
368 Ga0111539_10380053
369 Ga0111539_12543646
370 Ga0114129_10162481
371 Ga0114129_10709172
372 Ga0114129_10755580
373 Ga0114129_10869397
374 Ga0114129_10964342
375 Ga0105241_10000239
376 Ga0105241_10177605
377 Ga0105241_10371465
378 Ga0105237_10005813
379 Ga0105237_10029858
380 Ga0105237_10266391
381 Ga0105238_10074950
382 Ga0105238_11354562
383 Ga0105239_10013580
384 Ga0105239_10015148
385 Ga0105239_10041965
386 Ga0105239_10052673
387 Ga0105239_10149577
388 Ga0157369_10071780
389 Ga0157369_11924889
390 Ga0157374_10472658
391 Ga0163162_10736735
392 Ga0157372_11194160
393 Ga0157372_11627178
394 Ga0163163_10545127
395 Ga0197907_10680835
396 Ga0206354_10207205
397 Ga0206353_11962019
398 Ga0213873_10006995
399 Ga0213876_10050434
400 Ga0213876_10367626
401 Ga0224712_10020859
402 Ga0207647_10004826
403 Ga0207647_10006557
404 Ga0207647_10033345
405 Ga0207647_10131774
406 Ga0207705_10687522
407 Ga0207705_10752537
408 Ga0207654_10056150
409 Ga0207654_10164869
410 Ga0207654_10521989
411 Ga0207695_10002376
412 Ga0207695_10017640
413 Ga0207695_10017688
414 Ga0207695_10066127
415 Ga0207695_10385450
416 Ga0207671_10000306
417 Ga0207671_10000365
418 Ga0207671_10020473
419 Ga0207671_10253520
420 Ga0207652_10133560
421 Ga0207646_10024152
422 Ga0207694_10001473
423 Ga0207694_10568982
424 Ga0207700_10320783
425 Ga0207664_10179579
426 Ga0207661_10522311
427 Ga0207667_10006887
428 Ga0207667_10017035
429 Ga0207667_10056839
430 Ga0207667_10100421
431 Ga0207667_10107618
432 Ga0207651_10865668
433 Ga0207640_10234987
434 Ga0207640_10322070
435 Ga0207658_10396633
436 Ga0207639_10167540
437 Ga0207702_10005011
438 Ga0207702_10069121
439 Ga0207702_10242813
440 Ga0207702_11045604
441 Ga0207698_10075748
442 Ga0207698_10091298
443 Ga0268266_10053896
444 Ga0268266_10090621
445 Ga0268266_10158996
446 Ga0268266_11338891
447 Ga0316576_10750081
448 Ga0307507_10172615
449 Ga0373941_0036144
450 Ga0373962_0027133
451 Ga0373931_1045456
452 Ga0373927_0807228
453 Ga0373937_1025958
454 Ga0395899_0000614
455 Ga0242420_060398
456 Ga0436365_0020726
457 Ga0436365_0786556
458 Ga0436365_1445525
459 Ga0436361_0191581
460 Ga0436362_0084096
461 Ga0436362_0190322
462 Ga0436362_0789622
463 Ga0466969_0005692
464 Ga0466972_0015631
465 Ga0466972_0164395
466 Ga0453683_0281670
467 Ga0466965_0024607
468 Ga0466966_0004614
469 Ga0466966_0190389
470 Ga0466961_0056844
471 Ga0466961_0113190
472 Ga0466961_0138334
473 Ga0466961_0404685
474 Ga0466963_0005098
475 Ga0466963_0007434
476 Ga0466963_0013415
477 Ga0466963_0028454
478 Ga0466963_0224946
479 Ga0466963_0299479
480 Ga0466963_0471925
481 Ga0466964_0008028
482 Ga0466964_0273748
483 Ga0466964_0331028
484 Ga0466964_0362985
485 Ga0466964_0895734
486 Ga0466971_0061180
487 Ga0466971_0061236
488 Ga0466968_0063197
489 Ga0466968_0191256
490 Ga0466970_0005327
491 Ga0466970_0044157
492 Ga0466957_0018616
493 Ga0466957_0085921
494 Ga0466957_0093805
495 Ga0466957_0306703
496 Ga0466957_0540257
497 Ga0466960_0009545
498 Ga0466960_0052363
499 Ga0466960_0312233
500 Ga0466960_0911259
501 Ga0466959_0031756
502 Ga0466959_0062901
503 Ga0466959_0130086
504 Ga0466959_0204342
505 Ga0466959_0273557
506 Ga0466959_0476054
507 Ga0466958_0025941
508 Ga0466958_0091263
509 Ga0466958_0119631
510 Ga0466958_0670953
511 Ga0466967_0006470
512 Ga0466967_0012577
513 Ga0466967_0069649
514 Ga0466967_0088713
515 Ga0466967_0605978
516 Ga0466967_0689723
517 Ga0466967_1330032
518 Ga0466967_1809296
519 Ga0466967_2600349
520 Ga0495592_0000533
521 Ga0495592_0564125
522 Ga0495651_0001903
523 Ga0495653_0147301
524 Ga0495580_0032862
525 Ga0495662_0054736
526 Ga0495664_0002661
527 Ga0495664_0347122
528 Ga0495608_0047956
529 Ga0495608_0723812
530 Ga0495618_0216519
531 Ga0495628_0000836
532 Ga0495630_0059424
533 Ga0495666_0002070
534 Ga0495652_0004761
535 Ga0495665_0017087
536 Ga0495640_0075309
537 Ga0495586_0024643
538 Ga0495587_0006313
539 Ga0495645_0005926
540 Ga0495645_0157178
541 Ga0495622_0033830
542 Ga0495634_0051747
543 Ga0495657_0020914
544 Ga0495623_0015519
545 Ga0495646_0001399
546 Ga0495658_0059624
547 Ga0495613_0007413
548 Ga0495600_0011055
549 Ga0495581_0121933
550 Ga0495581_0253371
551 Ga0495604_0002833
552 Ga0495604_0584386
553 Ga0495674_0004715
554 Ga0495675_0025426
555 Ga0495593_0202317
556 Ga0496102_0000094
557 Ga0496102_1777576
558 Ga0496103_0000042
559 Ga0496104_0369521
560 Ga0496104_1154919
561 Ga0496109_0898076
562 Ga0496110_0010048
563 Ga0496111_0124248
564 Ga0496112_0677408
565 Ga0496114_0147209
566 Ga0496115_0051166
567 Ga0496118_0019915
568 Ga0496119_0080103
569 Ga0496121_0249296
570 Ga0501031_0008760
571 Ga0501032_0008446
572 Ga0501033_0510153
573 Ga0501034_0752181
574 Ga0501037_0057041
575 Ga0501038_0000215
576 Ga0501043_0009121
577 Ga0501047_0028151
578 Ga0501047_1348536
579 Ga0501048_0000571
580 Ga0501067_0130548
581 Ga0501070_0070382
582 Ga0501070_0183785
583 Ga0501070_0214002
584 Ga0501081_0631670
585 Ga0501035_0032313
586 Ga0501044_0025594
587 nmdc:mga05p37_1312484_c1
588 nmdc:mga05p37_518072_c1
589 nmdc:mga05p37_681665_c1
590 nmdc:mga05p37_923475_c1
591 nmdc:mga09592_60014_c1
592 nmdc:mga09592_95557_c1
593 nmdc:mga0qj67_320248_c1
594 nmdc:mga06r32_62789_c1
595 nmdc:mga06r32_73864_c1
596 nmdc:mga08y16_1663249_c1
597 nmdc:mga0n895_102866_c1
598 nmdc:mga0n895_81376_c1
599 nmdc:mga0rr50_1457549_c1
600 nmdc:mga0rr50_396541_c1
601 nmdc:mga0a205_475668_c1
602 Ga0495601_0046168
603 Ga0495601_0130277
604 Ga0495612_0281714
605 Ga0466962_0008172
606 Ga0466962_0189051
607 Ga0466962_0298831
608 Ga0466962_0387826
609 2772643762
610 2855672741
611 2855683051
612 2855686126
613 2856861401
614 2857291533
615 2858855371
616 2858885534
617 2858889560
618 2858897975
619 2858904088
620 2869053522
621 2869066006
622 2869069988
623 2880492682
624 2880499636
625 2929221595
626 2929228232
627 649812156
628 8003832787
629 8003860904
630 8054706841
631 8054731332
632 8054738703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

3

140

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.9254 4 66
3f22-assembly2.cif.gz_C crystal structure of zalpha in complex with d(cgtacg) 0.9164 4 68
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9113 25 68
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.9056 8 68
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9039 8 68
ID Description Score Start End Superfamily
af_P9WME3_1_141_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9681 1 139 1.10.10.10
af_P9WME3_1_141_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9481 1 139 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9241 4 66 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9113 25 68 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9039 8 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A522B615-F1-model_v4 Rrf2 family transcriptional regulator 0.9915 1 150 GO:0003700
GO:0005829
AF-A0A6J7J5Y6-F1-model_v4 Unannotated protein 0.9897 1 151 GO:0003700
GO:0005829
AF-A0A3D9V9Q8-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.9893 1 151 GO:0003700
GO:0005829
AF-A0A1H4UDK0-F1-model_v4 Rrf2 family protein 0.9883 1 151 GO:0003700
GO:0005829
AF-A0A3D9UR97-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.9876 1 151 GO:0003700
GO:0005829

Map