F403688

General Info

Members Datasets Scaffolds Average Seq Length
316 173 632 189

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_11143734|Ga0157380_111437341
Length 213
Sequence MTHLTMEQLLALREPGVEPGTASQREHMDACEACRVEFERLEQRSARLRALPTLRPARDQWPRVAGRLNAVRRKRRLRWMTAGAMALAASLALVLLVRQPATPAGATASQQELTSLQQRSRALEAAIGAYDPDARVLDGRTSRVASDLEDRIADVDRRLERTELAGPPGMNGPDVMQLWQERVGLLDALVDVHVTRASNVGGSWTSASPRTLS

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
104 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
116 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
117 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
120 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.34
Rhizosphere 87.66
Stem 0
Stem Tuber 0
Unclassified 22.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_11143734 3300014326 Bacteria 819
2 Ga0058863_10008405 3300004799 Bacteria 2596
3 Ga0058862_10122569 3300004803 Unclassified 1100
4 Ga0058862_10287731 3300004803 Bacteria 2072
5 Ga0065707_10156541 3300005295 Bacteria 1603
6 Ga0070683_100467575 3300005329 Unclassified 1204
7 Ga0070670_100553753 3300005331 Bacteria 1026
8 Ga0070680_100029768 3300005336 Bacteria 4383
9 Ga0070680_100183025 3300005336 Bacteria 1765
10 Ga0070682_100267759 3300005337 Bacteria 1240
11 Ga0070682_100476712 3300005337 Bacteria 961
12 Ga0070660_100141732 3300005339 Unclassified 1929
13 Ga0070691_10098121 3300005341 Bacteria 1452
14 Ga0070661_100446010 3300005344 Unclassified 1029
15 Ga0070668_100016937 3300005347 Bacteria 5451
16 Ga0070675_100013022 3300005354 Bacteria 6532
17 Ga0070675_100089952 3300005354 Bacteria 2571
18 Ga0070675_100426631 3300005354 Bacteria 1186
19 Ga0070675_100434117 3300005354 Bacteria 1176
20 Ga0070671_100028927 3300005355 Bacteria 4567
21 Ga0070674_100960137 3300005356 Unclassified 748
22 Ga0070673_100071775 3300005364 Bacteria 2783
23 Ga0070673_100340458 3300005364 Unclassified 1329
24 Ga0070673_100890733 3300005364 Bacteria 825
25 Ga0070659_100114880 3300005366 Bacteria 2175
26 Ga0070709_10207767 3300005434 Bacteria 1390
27 Ga0070710_10290478 3300005437 Bacteria 1064
28 Ga0070710_10451925 3300005437 Bacteria 871
29 Ga0070711_100000102 3300005439 Bacteria 44792
30 Ga0070711_100471690 3300005439 Unclassified 1030
31 Ga0070705_100012010 3300005440 Bacteria 4387
32 Ga0070705_100602049 3300005440 Bacteria 850
33 Ga0070705_100965931 3300005440 Bacteria 689
34 Ga0070694_100022371 3300005444 Bacteria 4050
35 Ga0070694_100077890 3300005444 Bacteria 2298
36 Ga0070708_100002594 3300005445 Bacteria 13974
37 Ga0070708_100059681 3300005445 Bacteria 3402
38 Ga0070663_100154417 3300005455 Bacteria 1762
39 Ga0070681_10134905 3300005458 Bacteria 2399
40 Ga0070681_10137902 3300005458 Bacteria 2369
41 Ga0070681_10161107 3300005458 Bacteria 2168
42 Ga0070706_100042627 3300005467 Bacteria 4193
43 Ga0070706_100825252 3300005467 Unclassified 858
44 Ga0070707_100002297 3300005468 Bacteria 18268
45 Ga0070707_100039389 3300005468 Bacteria 4517
46 Ga0070699_100003944 3300005518 Bacteria 13109
47 Ga0070699_100072113 3300005518 Unclassified 3004
48 Ga0070679_100063566 3300005530 Bacteria 3679
49 Ga0070679_100117920 3300005530 Bacteria 2639
50 Ga0070684_100597626 3300005535 Bacteria 1026
51 Ga0070697_100049445 3300005536 Bacteria 3413
52 Ga0070697_100146684 3300005536 Bacteria 1987
53 Ga0070697_100438312 3300005536 Unclassified 1137
54 Ga0070672_100141839 3300005543 Bacteria 1982
55 Ga0070686_100143449 3300005544 Unclassified 1665
56 Ga0070695_100098576 3300005545 Bacteria 1964
57 Ga0070695_100130546 3300005545 Bacteria 1731
58 Ga0070696_100002315 3300005546 Bacteria 12568
59 Ga0070696_100055845 3300005546 Unclassified 2754
60 Ga0070696_100565166 3300005546 Bacteria 913
61 Ga0070696_100653016 3300005546 Bacteria 853
62 Ga0070693_100141054 3300005547 Bacteria 1517
63 Ga0070665_100271467 3300005548 Bacteria 1698
64 Ga0070665_101113661 3300005548 Archaea 801
65 Ga0070704_100006919 3300005549 Bacteria 6720
66 Ga0070704_100146661 3300005549 Bacteria 1850
67 Ga0068855_100722718 3300005563 Bacteria 1064
68 Ga0070664_100015342 3300005564 Bacteria 6265
69 Ga0070664_100153547 3300005564 Bacteria 2033
70 Ga0068852_100547901 3300005616 Bacteria 1157
71 Ga0068859_100170847 3300005617 Bacteria 2255
72 Ga0068864_100016288 3300005618 Bacteria 6187
73 Ga0068864_100055400 3300005618 Bacteria 3423
74 Ga0068863_100168876 3300005841 Unclassified 2098
75 Ga0070712_100044684 3300006175 Bacteria 3055
76 Ga0075431_100231657 3300006847 Bacteria 1882
77 Ga0075434_100625743 3300006871 Bacteria 1095
78 Ga0097620_100170858 3300006931 Bacteria 2255
79 Ga0075435_100104673 3300007076 Bacteria 2348
80 Ga0075435_100191962 3300007076 Bacteria 1729
81 Ga0075435_100884119 3300007076 Bacteria 779
82 Ga0111539_10690899 3300009094 Unclassified 1188
83 Ga0105245_11391533 3300009098 Unclassified 751
84 Ga0114129_10088996 3300009147 Bacteria 4280
85 Ga0105243_10266529 3300009148 Bacteria 1536
86 Ga0105248_10031052 3300009177 Bacteria 5970
87 Ga0105248_10215148 3300009177 Unclassified 2165
88 Ga0105249_10212988 3300009553 Unclassified 1897
89 Ga0157375_10070463 3300013308 Bacteria 3506
90 Ga0157375_10222994 3300013308 Bacteria 2044
91 Ga0163163_10026921 3300014325 Bacteria 5501
92 Ga0163163_10090141 3300014325 Unclassified 3079
93 Ga0157379_10122476 3300014968 Bacteria 2340
94 Ga0157379_10149548 3300014968 Unclassified 2106
95 Ga0157376_10048107 3300014969 Bacteria 3524
96 Ga0197907_10193392 3300020069 Bacteria 1272
97 Ga0207699_10126073 3300025906 Unclassified 1662
98 Ga0207645_10199682 3300025907 Bacteria 1315
99 Ga0207684_10026040 3300025910 Bacteria 4985
100 Ga0207707_10028011 3300025912 Unclassified 4925
101 Ga0207707_10243584 3300025912 Bacteria 1563
102 Ga0207693_10062567 3300025915 Unclassified 2915
103 Ga0207693_10071148 3300025915 Unclassified 2722
104 Ga0207663_10064518 3300025916 Bacteria 2337
105 Ga0207660_10041961 3300025917 Bacteria 3209
106 Ga0207660_10172554 3300025917 Bacteria 1675
107 Ga0207657_10200591 3300025919 Unclassified 1605
108 Ga0207649_10428978 3300025920 Unclassified 994
109 Ga0207652_10016876 3300025921 Bacteria 5969
110 Ga0207646_10026635 3300025922 Bacteria 5274
111 Ga0207646_10138277 3300025922 Bacteria 2193
112 Ga0207646_10455443 3300025922 Bacteria 1154
113 Ga0207659_10050023 3300025926 Bacteria 2967
114 Ga0207659_10081037 3300025926 Bacteria 2399
115 Ga0207659_10465814 3300025926 Bacteria 1066
116 Ga0207644_10148016 3300025931 Unclassified 1815
117 Ga0207690_10182437 3300025932 Bacteria 1581
118 Ga0207670_10423803 3300025936 Bacteria 1068
119 Ga0207691_10276187 3300025940 Bacteria 1446
120 Ga0207711_10187429 3300025941 Unclassified 1884
121 Ga0207711_10557931 3300025941 Bacteria 1068
122 Ga0207689_10198466 3300025942 Bacteria 1656
123 Ga0207661_10225974 3300025944 Bacteria 1656
124 Ga0207661_10803305 3300025944 Unclassified 866
125 Ga0207679_10009543 3300025945 Bacteria 6220
126 Ga0207679_10195324 3300025945 Bacteria 1686
127 Ga0207667_10381531 3300025949 Bacteria 1436
128 Ga0207651_10121866 3300025960 Bacteria 1979
129 Ga0207668_10355266 3300025972 Bacteria 1226
130 Ga0207678_10130704 3300026067 Bacteria 2142
131 Ga0207641_10027227 3300026088 Bacteria 4721
132 Ga0207676_10006300 3300026095 Bacteria 8381
133 Ga0207675_100094952 3300026118 Bacteria 2805
134 Ga0209971_1024265 3300027682 Bacteria 1448
135 Ga0209974_10032063 3300027876 Bacteria 1741
136 Ga0268266_10320387 3300028379 Bacteria 1451
137 Ga0307408_100051148 3300031548 Unclassified 2975
138 Ga0307408_100111950 3300031548 Bacteria 2098
139 Ga0307408_100165045 3300031548 Bacteria 1763
140 Ga0307405_10004165 3300031731 Bacteria 6804
141 Ga0307413_10004454 3300031824 Bacteria 6100
142 Ga0307413_10007272 3300031824 Bacteria 5127
143 Ga0307413_10007540 3300031824 Bacteria 5060
144 Ga0307413_10153136 3300031824 Bacteria 1609
145 Ga0307413_10182068 3300031824 Bacteria 1499
146 Ga0307413_10358412 3300031824 Bacteria 1128
147 Ga0307413_10568938 3300031824 Bacteria 922
148 Ga0307410_10002699 3300031852 Bacteria 8663
149 Ga0307410_10037005 3300031852 Bacteria 3184
150 Ga0307410_10062349 3300031852 Bacteria 2554
151 Ga0307410_10070908 3300031852 Bacteria 2415
152 Ga0307410_10455584 3300031852 Unclassified 1044
153 Ga0307406_10039302 3300031901 Bacteria 2935
154 Ga0307406_10139991 3300031901 Unclassified 1711
155 Ga0307407_10005734 3300031903 Bacteria 5425
156 Ga0307407_10018773 3300031903 Unclassified 3506
157 Ga0307407_10033658 3300031903 Bacteria 2798
158 Ga0307407_10224024 3300031903 Bacteria 1273
159 Ga0307407_10238352 3300031903 Bacteria 1240
160 Ga0307407_10271853 3300031903 Bacteria 1170
161 Ga0307407_10359584 3300031903 Bacteria 1033
162 Ga0307412_10011948 3300031911 Bacteria 5045
163 Ga0307409_100002275 3300031995 Bacteria 9945
164 Ga0307409_100013638 3300031995 Bacteria 5243
165 Ga0307409_100044724 3300031995 Bacteria 3337
166 Ga0307409_100160884 3300031995 Bacteria 1963
167 Ga0307416_100029603 3300032002 Bacteria 4094
168 Ga0307416_100068614 3300032002 Bacteria 2930
169 Ga0307416_100291093 3300032002 Bacteria 1617
170 Ga0307414_10006731 3300032004 Bacteria 6429
171 Ga0307414_10009578 3300032004 Bacteria 5573
172 Ga0307414_10101065 3300032004 Bacteria 2170
173 Ga0307411_10012443 3300032005 Unclassified 4644
174 Ga0307411_10024192 3300032005 Unclassified 3616
175 Ga0307411_10040449 3300032005 Bacteria 2957
176 Ga0307411_10063068 3300032005 Bacteria 2475
177 Ga0307415_100011456 3300032126 Bacteria 5076
178 Ga0307415_100118496 3300032126 Unclassified 1980
179 Ga0307415_101151368 3300032126 Bacteria 728
180 Ga0373948_0021761 3300034817 Unclassified 1230
181 Ga0373948_0053353 3300034817 Bacteria 873
182 Ga0373940_0013645 3300035088 Unclassified 1970
183 Ga0373949_0036026 3300035090 Bacteria 1199
184 Ga0373941_0069009 3300035115 Bacteria 1169
185 Ga0373941_0083535 3300035115 Bacteria 1083
186 Ga0373961_0044322 3300035241 Unclassified 1297
187 Ga0373962_0025813 3300035242 Bacteria 1580
188 Ga0373931_0027089 3300035691 Bacteria 2922
189 Ga0373931_0265193 3300035691 Bacteria 1049
190 Ga0373927_0379861 3300035695 Bacteria 932
191 Ga0395899_0578348 3300037312 Bacteria 718
192 Ga0395905_0084365 3300037471 Bacteria 2976
193 Ga0242420_000614 3300038996 Bacteria 4168
194 Ga0242420_025289 3300038996 Bacteria 1078
195 Ga0439436_0065075 3300041404 Unclassified 1018
196 Ga0439439_0000401 3300041406 Bacteria 7230
197 Ga0450923_034597 3300042125 Unclassified 1043
198 Ga0450898_012251 3300042134 Bacteria 1415
199 Ga0439446_0002474 3300042156 Bacteria 4441
200 Ga0439446_0045349 3300042156 Bacteria 1303
201 Ga0439434_0052916 3300042435 Bacteria 1261
202 Ga0439435_0046934 3300042436 Bacteria 1225
203 Ga0451577_0029171 3300042876 Bacteria 4986
204 Ga0495641_0098846 3300046461 Bacteria 1302
205 Ga0495582_0135137 3300046473 Bacteria 1395
206 Ga0495639_0064017 3300046475 Bacteria 1689
207 Ga0495594_0261112 3300046499 Bacteria 986
208 Ga0495630_0008916 3300046517 Bacteria 7201
209 Ga0495666_0012148 3300046526 Bacteria 4299
210 Ga0495640_0055778 3300046533 Bacteria 2702
211 Ga0495586_0020189 3300046535 Bacteria 3548
212 Ga0495586_0095484 3300046535 Unclassified 1645
213 Ga0495634_0003912 3300046642 Bacteria 11827
214 Ga0495680_0018395 3300047322 Bacteria 5934
215 Ga0496100_0020060 3300048903 Bacteria 4002
216 Ga0496101_0104052 3300048904 Unclassified 2129
217 Ga0496101_0241111 3300048904 Bacteria 1407
218 Ga0496102_0041289 3300048905 Unclassified 4176
219 Ga0496102_0044769 3300048905 Unclassified 4017
220 Ga0496102_0155598 3300048905 Bacteria 2149
221 Ga0496102_0266785 3300048905 Unclassified 1614
222 Ga0496103_0017126 3300048906 Bacteria 4333
223 Ga0496103_0238509 3300048906 Bacteria 1170
224 Ga0496103_0352784 3300048906 Bacteria 946
225 Ga0496104_0012154 3300048907 Bacteria 7733
226 Ga0496104_0283525 3300048907 Bacteria 1569
227 Ga0496105_0009978 3300048908 Bacteria 7451
228 Ga0496106_0105265 3300048909 Unclassified 2192
229 Ga0496106_0144630 3300048909 Unclassified 1872
230 Ga0496106_0212424 3300048909 Bacteria 1542
231 Ga0496106_0283625 3300048909 Bacteria 1327
232 Ga0496106_0459999 3300048909 Unclassified 1022
233 Ga0496106_0886201 3300048909 Bacteria 705
234 Ga0496107_0068715 3300048910 Bacteria 2571
235 Ga0496107_0279355 3300048910 Bacteria 1243
236 Ga0496108_0000530 3300048911 Bacteria 29778
237 Ga0496108_0017523 3300048911 Bacteria 5860
238 Ga0496108_0371112 3300048911 Unclassified 1249
239 Ga0496108_0375471 3300048911 Unclassified 1241
240 Ga0496109_0000886 3300048912 Bacteria 25030
241 Ga0496109_0224109 3300048912 Bacteria 1768
242 Ga0496109_0854103 3300048912 Bacteria 848
243 Ga0496110_0095154 3300048913 Unclassified 2667
244 Ga0496110_0369725 3300048913 Bacteria 1306
245 Ga0496111_0017882 3300048914 Bacteria 4904
246 Ga0496112_0000343 3300048915 Bacteria 30294
247 Ga0496112_0006525 3300048915 Bacteria 10259
248 Ga0496112_0025908 3300048915 Bacteria 5635
249 Ga0496113_0000225 3300048916 Bacteria 26482
250 Ga0496113_0001395 3300048916 Bacteria 13437
251 Ga0496113_0008170 3300048916 Bacteria 6799
252 Ga0496114_0130019 3300048917 Unclassified 2174
253 Ga0496115_0238999 3300048918 Unclassified 1497
254 Ga0501034_0044000 3300049571 Bacteria 4516
255 Ga0501034_0114976 3300049571 Bacteria 2679
256 Ga0501036_0257200 3300049572 Bacteria 1463
257 Ga0501067_0005831 3300049583 Bacteria 6831
258 Ga0501067_0009208 3300049583 Bacteria 5468
259 Ga0501067_0051057 3300049583 Bacteria 2293
260 Ga0501067_0261029 3300049583 Bacteria 964
261 Ga0501068_0001812 3300049584 Bacteria 11354
262 Ga0501068_0102951 3300049584 Unclassified 1770
263 Ga0501069_0012776 3300049585 Bacteria 4470
264 Ga0501069_0014049 3300049585 Bacteria 4277
265 Ga0501069_0061873 3300049585 Bacteria 2090
266 Ga0501069_0106809 3300049585 Bacteria 1592
267 Ga0501069_0169511 3300049585 Bacteria 1259
268 Ga0501069_0458807 3300049585 Unclassified 758
269 Ga0501070_0015434 3300049586 Bacteria 6425
270 Ga0501070_0033441 3300049586 Bacteria 4302
271 Ga0501070_0045161 3300049586 Bacteria 3665
272 Ga0501070_0083776 3300049586 Unclassified 2640
273 Ga0501071_0004064 3300049587 Bacteria 9243
274 Ga0501071_0354525 3300049587 Bacteria 1117
275 Ga0501071_0551056 3300049587 Unclassified 886
276 Ga0501071_0769647 3300049587 Bacteria 742
277 Ga0501072_0018594 3300049588 Bacteria 5355
278 Ga0501072_0042841 3300049588 Bacteria 3556
279 Ga0501072_0048033 3300049588 Bacteria 3361
280 Ga0501073_0029915 3300049589 Bacteria 3889
281 Ga0501073_0045950 3300049589 Unclassified 3074
282 Ga0501073_0052803 3300049589 Bacteria 2845
283 Ga0501074_0008030 3300049590 Bacteria 7643
284 Ga0501074_0022454 3300049590 Bacteria 4584
285 Ga0501075_0178679 3300049591 Unclassified 1620
286 Ga0501076_0452722 3300049592 Bacteria 1057
287 Ga0501076_0518935 3300049592 Unclassified 982
288 Ga0501077_0370153 3300049593 Unclassified 915
289 Ga0501079_0026331 3300049741 Bacteria 4460
290 Ga0501079_0260755 3300049741 Bacteria 1355
291 Ga0501080_0032078 3300049742 Bacteria 4897
292 Ga0501080_0047393 3300049742 Unclassified 4000
293 Ga0501080_0071855 3300049742 Bacteria 3219
294 Ga0501080_0210809 3300049742 Bacteria 1780
295 Ga0501081_0012043 3300049743 Bacteria 5669
296 Ga0501083_0004893 3300049744 Bacteria 9472
297 Ga0501083_0084757 3300049744 Bacteria 2097
298 Ga0501083_0384979 3300049744 Bacteria 912
299 nmdc:mga05p37_138024_c1 3300050507 Bacteria 2988
300 nmdc:mga06r32_331248_c1 3300050510 Bacteria 1507
301 nmdc:mga08y16_682979_c1 3300050511 Unclassified 1028
302 nmdc:mga0n895_158408_c1 3300050512 Unclassified 2295
303 nmdc:mga0rr50_252792_c1 3300050513 Bacteria 1464
304 nmdc:mga0a205_488012_c1 3300050515 Unclassified 1090
305 nmdc:mga0a205_59556_c1 3300050515 Bacteria 3688
306 Ga0501084_0078704 3300054114 Unclassified 2763
307 Ga0501084_0116453 3300054114 Bacteria 2246
308 Ga0501084_0180567 3300054114 Bacteria 1781
309 Ga0501084_0188597 3300054114 Bacteria 1740
310 Ga0501084_0625426 3300054114 Unclassified 909
311 Ga0501082_0079964 3300060353 Bacteria 2820
312 Ga0501082_0384574 3300060353 Bacteria 1224
313 Ga0501082_0750828 3300060353 Unclassified 854
314 Ga0501082_0932730 3300060353 Unclassified 759
315 Ga0530510_0144721 3300061734 Unclassified 1753
316 Ga0530510_0705834 3300061734 Unclassified 769
317 Ga0157380_11143734
318 Ga0058863_10008405
319 Ga0058862_10122569
320 Ga0058862_10287731
321 Ga0065707_10156541
322 Ga0070683_100467575
323 Ga0070670_100553753
324 Ga0070680_100029768
325 Ga0070680_100183025
326 Ga0070682_100267759
327 Ga0070682_100476712
328 Ga0070660_100141732
329 Ga0070691_10098121
330 Ga0070661_100446010
331 Ga0070668_100016937
332 Ga0070675_100013022
333 Ga0070675_100089952
334 Ga0070675_100426631
335 Ga0070675_100434117
336 Ga0070671_100028927
337 Ga0070674_100960137
338 Ga0070673_100071775
339 Ga0070673_100340458
340 Ga0070673_100890733
341 Ga0070659_100114880
342 Ga0070709_10207767
343 Ga0070710_10290478
344 Ga0070710_10451925
345 Ga0070711_100000102
346 Ga0070711_100471690
347 Ga0070705_100012010
348 Ga0070705_100602049
349 Ga0070705_100965931
350 Ga0070694_100022371
351 Ga0070694_100077890
352 Ga0070708_100002594
353 Ga0070708_100059681
354 Ga0070663_100154417
355 Ga0070681_10134905
356 Ga0070681_10137902
357 Ga0070681_10161107
358 Ga0070706_100042627
359 Ga0070706_100825252
360 Ga0070707_100002297
361 Ga0070707_100039389
362 Ga0070699_100003944
363 Ga0070699_100072113
364 Ga0070679_100063566
365 Ga0070679_100117920
366 Ga0070684_100597626
367 Ga0070697_100049445
368 Ga0070697_100146684
369 Ga0070697_100438312
370 Ga0070672_100141839
371 Ga0070686_100143449
372 Ga0070695_100098576
373 Ga0070695_100130546
374 Ga0070696_100002315
375 Ga0070696_100055845
376 Ga0070696_100565166
377 Ga0070696_100653016
378 Ga0070693_100141054
379 Ga0070665_100271467
380 Ga0070665_101113661
381 Ga0070704_100006919
382 Ga0070704_100146661
383 Ga0068855_100722718
384 Ga0070664_100015342
385 Ga0070664_100153547
386 Ga0068852_100547901
387 Ga0068859_100170847
388 Ga0068864_100016288
389 Ga0068864_100055400
390 Ga0068863_100168876
391 Ga0070712_100044684
392 Ga0075431_100231657
393 Ga0075434_100625743
394 Ga0097620_100170858
395 Ga0075435_100104673
396 Ga0075435_100191962
397 Ga0075435_100884119
398 Ga0111539_10690899
399 Ga0105245_11391533
400 Ga0114129_10088996
401 Ga0105243_10266529
402 Ga0105248_10031052
403 Ga0105248_10215148
404 Ga0105249_10212988
405 Ga0157375_10070463
406 Ga0157375_10222994
407 Ga0163163_10026921
408 Ga0163163_10090141
409 Ga0157379_10122476
410 Ga0157379_10149548
411 Ga0157376_10048107
412 Ga0197907_10193392
413 Ga0207699_10126073
414 Ga0207645_10199682
415 Ga0207684_10026040
416 Ga0207707_10028011
417 Ga0207707_10243584
418 Ga0207693_10062567
419 Ga0207693_10071148
420 Ga0207663_10064518
421 Ga0207660_10041961
422 Ga0207660_10172554
423 Ga0207657_10200591
424 Ga0207649_10428978
425 Ga0207652_10016876
426 Ga0207646_10026635
427 Ga0207646_10138277
428 Ga0207646_10455443
429 Ga0207659_10050023
430 Ga0207659_10081037
431 Ga0207659_10465814
432 Ga0207644_10148016
433 Ga0207690_10182437
434 Ga0207670_10423803
435 Ga0207691_10276187
436 Ga0207711_10187429
437 Ga0207711_10557931
438 Ga0207689_10198466
439 Ga0207661_10225974
440 Ga0207661_10803305
441 Ga0207679_10009543
442 Ga0207679_10195324
443 Ga0207667_10381531
444 Ga0207651_10121866
445 Ga0207668_10355266
446 Ga0207678_10130704
447 Ga0207641_10027227
448 Ga0207676_10006300
449 Ga0207675_100094952
450 Ga0209971_1024265
451 Ga0209974_10032063
452 Ga0268266_10320387
453 Ga0307408_100051148
454 Ga0307408_100111950
455 Ga0307408_100165045
456 Ga0307405_10004165
457 Ga0307413_10004454
458 Ga0307413_10007272
459 Ga0307413_10007540
460 Ga0307413_10153136
461 Ga0307413_10182068
462 Ga0307413_10358412
463 Ga0307413_10568938
464 Ga0307410_10002699
465 Ga0307410_10037005
466 Ga0307410_10062349
467 Ga0307410_10070908
468 Ga0307410_10455584
469 Ga0307406_10039302
470 Ga0307406_10139991
471 Ga0307407_10005734
472 Ga0307407_10018773
473 Ga0307407_10033658
474 Ga0307407_10224024
475 Ga0307407_10238352
476 Ga0307407_10271853
477 Ga0307407_10359584
478 Ga0307412_10011948
479 Ga0307409_100002275
480 Ga0307409_100013638
481 Ga0307409_100044724
482 Ga0307409_100160884
483 Ga0307416_100029603
484 Ga0307416_100068614
485 Ga0307416_100291093
486 Ga0307414_10006731
487 Ga0307414_10009578
488 Ga0307414_10101065
489 Ga0307411_10012443
490 Ga0307411_10024192
491 Ga0307411_10040449
492 Ga0307411_10063068
493 Ga0307415_100011456
494 Ga0307415_100118496
495 Ga0307415_101151368
496 Ga0373948_0021761
497 Ga0373948_0053353
498 Ga0373940_0013645
499 Ga0373949_0036026
500 Ga0373941_0069009
501 Ga0373941_0083535
502 Ga0373961_0044322
503 Ga0373962_0025813
504 Ga0373931_0027089
505 Ga0373931_0265193
506 Ga0373927_0379861
507 Ga0395899_0578348
508 Ga0395905_0084365
509 Ga0242420_000614
510 Ga0242420_025289
511 Ga0439436_0065075
512 Ga0439439_0000401
513 Ga0450923_034597
514 Ga0450898_012251
515 Ga0439446_0002474
516 Ga0439446_0045349
517 Ga0439434_0052916
518 Ga0439435_0046934
519 Ga0451577_0029171
520 Ga0495641_0098846
521 Ga0495582_0135137
522 Ga0495639_0064017
523 Ga0495594_0261112
524 Ga0495630_0008916
525 Ga0495666_0012148
526 Ga0495640_0055778
527 Ga0495586_0020189
528 Ga0495586_0095484
529 Ga0495634_0003912
530 Ga0495680_0018395
531 Ga0496100_0020060
532 Ga0496101_0104052
533 Ga0496101_0241111
534 Ga0496102_0041289
535 Ga0496102_0044769
536 Ga0496102_0155598
537 Ga0496102_0266785
538 Ga0496103_0017126
539 Ga0496103_0238509
540 Ga0496103_0352784
541 Ga0496104_0012154
542 Ga0496104_0283525
543 Ga0496105_0009978
544 Ga0496106_0105265
545 Ga0496106_0144630
546 Ga0496106_0212424
547 Ga0496106_0283625
548 Ga0496106_0459999
549 Ga0496106_0886201
550 Ga0496107_0068715
551 Ga0496107_0279355
552 Ga0496108_0000530
553 Ga0496108_0017523
554 Ga0496108_0371112
555 Ga0496108_0375471
556 Ga0496109_0000886
557 Ga0496109_0224109
558 Ga0496109_0854103
559 Ga0496110_0095154
560 Ga0496110_0369725
561 Ga0496111_0017882
562 Ga0496112_0000343
563 Ga0496112_0006525
564 Ga0496112_0025908
565 Ga0496113_0000225
566 Ga0496113_0001395
567 Ga0496113_0008170
568 Ga0496114_0130019
569 Ga0496115_0238999
570 Ga0501034_0044000
571 Ga0501034_0114976
572 Ga0501036_0257200
573 Ga0501067_0005831
574 Ga0501067_0009208
575 Ga0501067_0051057
576 Ga0501067_0261029
577 Ga0501068_0001812
578 Ga0501068_0102951
579 Ga0501069_0012776
580 Ga0501069_0014049
581 Ga0501069_0061873
582 Ga0501069_0106809
583 Ga0501069_0169511
584 Ga0501069_0458807
585 Ga0501070_0015434
586 Ga0501070_0033441
587 Ga0501070_0045161
588 Ga0501070_0083776
589 Ga0501071_0004064
590 Ga0501071_0354525
591 Ga0501071_0551056
592 Ga0501071_0769647
593 Ga0501072_0018594
594 Ga0501072_0042841
595 Ga0501072_0048033
596 Ga0501073_0029915
597 Ga0501073_0045950
598 Ga0501073_0052803
599 Ga0501074_0008030
600 Ga0501074_0022454
601 Ga0501075_0178679
602 Ga0501076_0452722
603 Ga0501076_0518935
604 Ga0501077_0370153
605 Ga0501079_0026331
606 Ga0501079_0260755
607 Ga0501080_0032078
608 Ga0501080_0047393
609 Ga0501080_0071855
610 Ga0501080_0210809
611 Ga0501081_0012043
612 Ga0501083_0004893
613 Ga0501083_0084757
614 Ga0501083_0384979
615 nmdc:mga05p37_138024_c1
616 nmdc:mga06r32_331248_c1
617 nmdc:mga08y16_682979_c1
618 nmdc:mga0n895_158408_c1
619 nmdc:mga0rr50_252792_c1
620 nmdc:mga0a205_488012_c1
621 nmdc:mga0a205_59556_c1
622 Ga0501084_0078704
623 Ga0501084_0116453
624 Ga0501084_0180567
625 Ga0501084_0188597
626 Ga0501084_0625426
627 Ga0501082_0079964
628 Ga0501082_0384574
629 Ga0501082_0750828
630 Ga0501082_0932730
631 Ga0530510_0144721
632 Ga0530510_0705834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kub-assembly1.cif.gz_A solution structure of the alpha subdomain of the major non-repeat unit of fap1 fimbriae of streptococcus parasanguis 0.6346 87 170
7cg3-assembly1.cif.gz_E staggered ring conformation of cthsp104 (hsp104 from chaetomium thermophilum) 0.6025 94 175
2kub-assembly1.cif.gz_A solution structure of the alpha subdomain of the major non-repeat unit of fap1 fimbriae of streptococcus parasanguis 0.594 87 170
4yuu-assembly3.cif.gz_Q2 crystal structure of oxygen-evolving photosystem ii from a red alga 0.5906 87 168
4yuu-assembly2.cif.gz_q1 crystal structure of oxygen-evolving photosystem ii from a red alga 0.5905 87 168
ID Description Score Start End Superfamily
3aaiD00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.7736 111 175 1.20.58.1000
3aaiB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.7728 111 175 1.20.58.1000
af_Q57721_6_99_1.20.1270.90 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;AF1782-like 0.7429 85 169 1.20.1270.90
af_Q54K81_438_594_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.6687 92 175 1.20.1420.10
3aaiD00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.6628 111 175 1.20.58.1000
ID Description Score Start End GO Terms
AF-A0A7Y2NWB9-F1-model_v4 Uncharacterized protein 0.8423 77 177 GO:0016020
AF-A0A7W0GZ52-F1-model_v4 Uncharacterized protein 0.8356 79 177
AF-A0A1Q4FMX6-F1-model_v4 Uncharacterized protein 0.7677 78 177 GO:0016020
AF-A0A7W0GZ52-F1-model_v4 Uncharacterized protein 0.7635 79 177
AF-A0A7Y2NWB9-F1-model_v4 Uncharacterized protein 0.6423 77 177 GO:0016020

Map