F403687

General Info

Members Datasets Scaffolds Average Seq Length
316 187 632 199

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10064821|Ga0163163_100648212
Length 237
Sequence MRKRVLIVGASGTIGSAVARALESEHEVLRASRRKSEIAVDLTSSDAIRAMFARAGAVDAVVCAAGDARFKPFAELTDEDFAFSIRHKLMGQVDLTRIALGLVRPGGSVTLTSGILAREPMPGSGAISLVNAALEGFTRAAALEAPNGIRVNVVSPPWVTETLAALGMDTSAGLPADVVARAYVASVTGSQSGAVIDPRAEGLPGNRPGRLRNLWRRGLVTINVSLSATRTRPNRIP

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
137 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 1.58
Rhizosphere 96.52
Stem 0
Stem Tuber 0
Unclassified 12.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10064821 3300014325 Archaea 3625
2 Ga0070658_10017214 3300005327 Bacteria 5784
3 Ga0070658_10066701 3300005327 Bacteria 2940
4 Ga0070658_10072732 3300005327 Bacteria 2818
5 Ga0070658_10385524 3300005327 Bacteria 1203
6 Ga0070658_10578875 3300005327 Unclassified 972
7 Ga0070676_10410601 3300005328 Bacteria 944
8 Ga0070676_10563340 3300005328 Bacteria 817
9 Ga0070690_100249015 3300005330 Bacteria 1256
10 Ga0070666_10007305 3300005335 Bacteria 6806
11 Ga0070680_100000588 3300005336 Bacteria 25079
12 Ga0070680_101035989 3300005336 Bacteria 709
13 Ga0070660_100001864 3300005339 Bacteria 14512
14 Ga0070660_100018640 3300005339 Bacteria 5074
15 Ga0070687_100006067 3300005343 Bacteria 4930
16 Ga0070687_100020979 3300005343 Bacteria 3064
17 Ga0070687_100063521 3300005343 Bacteria 1958
18 Ga0070661_100032650 3300005344 Bacteria 3768
19 Ga0070669_100000032 3300005353 Bacteria 153549
20 Ga0070675_100000042 3300005354 Bacteria 78277
21 Ga0070671_100060059 3300005355 Plasmid 3165
22 Ga0070671_100405895 3300005355 Bacteria 1166
23 Ga0070673_100035656 3300005364 Bacteria 3773
24 Ga0070688_100272684 3300005365 Unclassified 1213
25 Ga0070659_100052081 3300005366 Bacteria 3219
26 Ga0070709_10008273 3300005434 Bacteria 5713
27 Ga0070714_100001580 3300005435 Bacteria 16550
28 Ga0070713_100300111 3300005436 Bacteria 1478
29 Ga0070711_100000083 3300005439 Bacteria 52216
30 Ga0070700_100000076 3300005441 Bacteria 67387
31 Ga0070694_100017455 3300005444 Bacteria 4537
32 Ga0070694_100680939 3300005444 Bacteria 835
33 Ga0070663_100095269 3300005455 Bacteria 2212
34 Ga0070663_100851990 3300005455 Bacteria 784
35 Ga0070678_100279797 3300005456 Bacteria 1410
36 Ga0070662_100000099 3300005457 Bacteria 47948
37 Ga0070681_10017251 3300005458 Bacteria 7216
38 Ga0070681_10255263 3300005458 Bacteria 1665
39 Ga0070681_10337032 3300005458 Bacteria 1418
40 Ga0070685_10006305 3300005466 Bacteria 6046
41 Ga0070685_10051742 3300005466 Bacteria 2375
42 Ga0070706_100007600 3300005467 Bacteria 10144
43 Ga0070706_100092266 3300005467 Bacteria 2809
44 Ga0070706_100256118 3300005467 Bacteria 1634
45 Ga0070706_100330556 3300005467 Bacteria 1421
46 Ga0070698_100005627 3300005471 Bacteria 13708
47 Ga0070698_100318053 3300005471 Bacteria 1487
48 Ga0070679_100002844 3300005530 Bacteria 15730
49 Ga0070679_100087193 3300005530 Bacteria 3108
50 Ga0070679_100394700 3300005530 Bacteria 1330
51 Ga0070684_100049567 3300005535 Bacteria 3645
52 Ga0070684_100833216 3300005535 Bacteria 863
53 Ga0070697_100002363 3300005536 Bacteria 14507
54 Ga0070697_100090057 3300005536 Unclassified 2535
55 Ga0070697_100123795 3300005536 Unclassified 2164
56 Ga0068853_100001941 3300005539 Bacteria 15255
57 Ga0070686_100000005 3300005544 Bacteria 248346
58 Ga0070686_100585668 3300005544 Bacteria 877
59 Ga0070695_100169193 3300005545 Bacteria 1540
60 Ga0070695_100229270 3300005545 Unclassified 1342
61 Ga0070665_100001280 3300005548 Bacteria 30114
62 Ga0070665_100037634 3300005548 Bacteria 4864
63 Ga0070665_100061460 3300005548 Bacteria 3766
64 Ga0070665_100063280 3300005548 Bacteria 3709
65 Ga0070665_100290789 3300005548 Bacteria 1636
66 Ga0070704_100029483 3300005549 Bacteria 3664
67 Ga0070704_100089672 3300005549 Unclassified 2288
68 Ga0068855_100121537 3300005563 Bacteria 2988
69 Ga0068855_100275544 3300005563 Bacteria 1870
70 Ga0068855_100362705 3300005563 Bacteria 1594
71 Ga0070664_100658962 3300005564 Bacteria 973
72 Ga0068854_100013728 3300005578 Bacteria 5324
73 Ga0068856_100436280 3300005614 Bacteria 1330
74 Ga0068856_100537218 3300005614 Bacteria 1190
75 Ga0070702_100004361 3300005615 Bacteria 6451
76 Ga0070702_100581569 3300005615 Bacteria 836
77 Ga0068852_100039001 3300005616 Bacteria 3996
78 Ga0068852_100061253 3300005616 Bacteria 3270
79 Ga0068852_100441689 3300005616 Bacteria 1286
80 Ga0068852_100774792 3300005616 Bacteria 972
81 Ga0068859_100683213 3300005617 Bacteria 1118
82 Ga0068864_100119984 3300005618 Unclassified 2350
83 Ga0068851_10029315 3300005834 Unclassified 2724
84 Ga0068851_10160638 3300005834 Bacteria 1234
85 Ga0097621_100146479 3300006237 Bacteria 2022
86 Ga0068871_100088109 3300006358 Unclassified 2582
87 Ga0075436_100019767 3300006914 Bacteria 4618
88 Ga0097620_100683204 3300006931 Bacteria 1118
89 Ga0099794_10006278 3300007265 Bacteria 4800
90 Ga0105244_10010320 3300009036 Bacteria 5670
91 Ga0105240_10157281 3300009093 Bacteria 2702
92 Ga0105240_11022665 3300009093 Unclassified 883
93 Ga0111539_10000004 3300009094 Bacteria 751278
94 Ga0105245_10051827 3300009098 Unclassified 3679
95 Ga0105245_10138696 3300009098 Bacteria 2288
96 Ga0105241_10100253 3300009174 Bacteria 2301
97 Ga0105248_10006585 3300009177 Bacteria 12737
98 Ga0105248_10485401 3300009177 Bacteria 1393
99 Ga0105237_10000045 3300009545 Bacteria 171156
100 Ga0105238_10001108 3300009551 Bacteria 27204
101 Ga0105238_10227678 3300009551 Bacteria 1841
102 Ga0157373_10652383 3300013100 Bacteria 769
103 Ga0157371_10164715 3300013102 Bacteria 1583
104 Ga0157370_10111854 3300013104 Bacteria 2553
105 Ga0157370_10170389 3300013104 Bacteria 2024
106 Ga0157369_10134283 3300013105 Bacteria 2621
107 Ga0157369_10235484 3300013105 Bacteria 1913
108 Ga0157369_10469087 3300013105 Bacteria 1303
109 Ga0157374_10037708 3300013296 Bacteria 4439
110 Ga0157378_10076722 3300013297 Bacteria 3012
111 Ga0157378_10612272 3300013297 Bacteria 1101
112 Ga0157372_10068350 3300013307 Bacteria 3994
113 Ga0157372_10345761 3300013307 Bacteria 1733
114 Ga0157372_10351865 3300013307 Bacteria 1716
115 Ga0157372_10453018 3300013307 Unclassified 1495
116 Ga0157380_10764920 3300014326 Bacteria 979
117 Ga0157380_11530281 3300014326 Unclassified 721
118 Ga0157376_10321131 3300014969 Bacteria 1472
119 Ga0157376_10432264 3300014969 Bacteria 1280
120 Ga0157376_10439546 3300014969 Bacteria 1270
121 Ga0157376_10505975 3300014969 Unclassified 1188
122 Ga0157376_10749181 3300014969 Bacteria 986
123 Ga0206353_10302360 3300020082 Bacteria 737
124 Ga0213872_10001838 3300021361 Bacteria 13150
125 Ga0213875_10007276 3300021388 Bacteria 5731
126 Ga0207656_10191916 3300025321 Bacteria 984
127 Ga0207655_1031538 3300025728 Bacteria 2440
128 Ga0207680_10047529 3300025903 Bacteria 2543
129 Ga0207699_10004327 3300025906 Bacteria 6794
130 Ga0207645_10558203 3300025907 Bacteria 777
131 Ga0207705_10044588 3300025909 Bacteria 3187
132 Ga0207705_10173242 3300025909 Viruses 1625
133 Ga0207684_10005473 3300025910 Bacteria 11694
134 Ga0207684_10077457 3300025910 Bacteria 2827
135 Ga0207684_10250352 3300025910 Bacteria 1529
136 Ga0207654_10057874 3300025911 Bacteria 2254
137 Ga0207707_10066066 3300025912 Bacteria 3150
138 Ga0207707_10113831 3300025912 Bacteria 2364
139 Ga0207707_10458511 3300025912 Bacteria 1090
140 Ga0207707_10588199 3300025912 Unclassified 943
141 Ga0207707_10671246 3300025912 Unclassified 872
142 Ga0207695_10247644 3300025913 Bacteria 1682
143 Ga0207695_10277705 3300025913 Bacteria 1569
144 Ga0207671_10000217 3300025914 Bacteria 86111
145 Ga0207660_10098458 3300025917 Bacteria 2181
146 Ga0207662_10011297 3300025918 Bacteria 4946
147 Ga0207662_10099023 3300025918 Bacteria 1804
148 Ga0207662_10102766 3300025918 Unclassified 1773
149 Ga0207657_10004486 3300025919 Bacteria 14755
150 Ga0207657_10040706 3300025919 Bacteria 4115
151 Ga0207649_10326955 3300025920 Bacteria 1128
152 Ga0207652_10009634 3300025921 Bacteria 7769
153 Ga0207652_10262447 3300025921 Bacteria 1558
154 Ga0207652_10341780 3300025921 Bacteria 1351
155 Ga0207652_10349530 3300025921 Bacteria 1334
156 Ga0207652_10474102 3300025921 Bacteria 1127
157 Ga0207652_10714414 3300025921 Bacteria 893
158 Ga0207646_10116493 3300025922 Bacteria 2400
159 Ga0207681_10000052 3300025923 Bacteria 112273
160 Ga0207694_10009924 3300025924 Bacteria 7184
161 Ga0207694_10052711 3300025924 Bacteria 3153
162 Ga0207659_10000045 3300025926 Bacteria 88264
163 Ga0207687_10029194 3300025927 Unclassified 3708
164 Ga0207664_10127718 3300025929 Bacteria 2136
165 Ga0207664_10818293 3300025929 Bacteria 838
166 Ga0207664_10954525 3300025929 Bacteria 769
167 Ga0207644_10239693 3300025931 Bacteria 1444
168 Ga0207690_10070059 3300025932 Bacteria 2414
169 Ga0207706_10000436 3300025933 Bacteria 44676
170 Ga0207711_10030967 3300025941 Bacteria 4513
171 Ga0207711_10907285 3300025941 Bacteria 819
172 Ga0207667_10160265 3300025949 Bacteria 2314
173 Ga0207667_10227589 3300025949 Bacteria 1910
174 Ga0207667_10320754 3300025949 Bacteria 1582
175 Ga0207651_10009687 3300025960 Bacteria 5295
176 Ga0207651_10557026 3300025960 Bacteria 998
177 Ga0207658_11015842 3300025986 Bacteria 757
178 Ga0207703_10988101 3300026035 Unclassified 807
179 Ga0207639_10073314 3300026041 Bacteria 2683
180 Ga0207678_10035074 3300026067 Bacteria 4368
181 Ga0207678_10151123 3300026067 Bacteria 1983
182 Ga0207708_10000010 3300026075 Bacteria 227178
183 Ga0207683_10278677 3300026121 Bacteria 1528
184 Ga0207683_10302142 3300026121 Bacteria 1464
185 Ga0207698_10033368 3300026142 Bacteria 3740
186 Ga0207698_10036669 3300026142 Plasmid 3602
187 Ga0207698_10046213 3300026142 Bacteria 3286
188 Ga0209588_1142590 3300027671 Unclassified 761
189 Ga0207428_10000006 3300027907 Bacteria 491716
190 Ga0268266_10000525 3300028379 Bacteria 53447
191 Ga0268266_10017954 3300028379 Bacteria 6031
192 Ga0268266_10069676 3300028379 Bacteria 3048
193 Ga0268266_10230227 3300028379 Bacteria 1707
194 Ga0268266_10352216 3300028379 Bacteria 1384
195 Ga0268266_10419182 3300028379 Bacteria 1268
196 Ga0268264_11227527 3300028381 Bacteria 759
197 Ga0265334_10102104 3300028573 Bacteria 1037
198 Ga0265336_10045675 3300028666 Bacteria 1332
199 Ga0265338_10027312 3300028800 Bacteria 5729
200 Ga0265320_10269000 3300031240 Bacteria 755
201 Ga0265316_10143191 3300031344 Bacteria 1794
202 Ga0265316_10389290 3300031344 Bacteria 1005
203 Ga0265314_10120023 3300031711 Unclassified 1657
204 Ga0265342_10068972 3300031712 Unclassified 2066
205 Ga0307405_10013537 3300031731 Bacteria 4355
206 Ga0307413_10036908 3300031824 Bacteria 2818
207 Ga0307413_10138487 3300031824 Bacteria 1678
208 Ga0307413_10204651 3300031824 Unclassified 1428
209 Ga0307410_10136282 3300031852 Bacteria 1810
210 Ga0307410_10154269 3300031852 Bacteria 1713
211 Ga0307410_10335653 3300031852 Unclassified 1203
212 Ga0307406_10476793 3300031901 Unclassified 1007
213 Ga0307407_10232832 3300031903 Bacteria 1252
214 Ga0307412_10367083 3300031911 Unclassified 1161
215 Ga0307409_100078880 3300031995 Unclassified 2651
216 Ga0307409_100084458 3300031995 Bacteria 2578
217 Ga0307416_101907912 3300032002 Unclassified 697
218 Ga0307414_10150743 3300032004 Bacteria 1834
219 Ga0307415_100352607 3300032126 Bacteria 1239
220 Ga0373929_0000001 3300035085 Bacteria 956023
221 Ga0373929_0023097 3300035085 Bacteria 1275
222 Ga0373961_0000252 3300035241 Bacteria 24909
223 Ga0373931_0284069 3300035691 Unclassified 1017
224 Ga0395898_0054848 3300037466 Bacteria 3888
225 Ga0395905_0082749 3300037471 Bacteria 3007
226 Ga0395905_0471009 3300037471 Bacteria 1155
227 Ga0395905_0746256 3300037471 Bacteria 881
228 Ga0436364_0436556 3300037853 Bacteria 1160
229 Ga0436364_0465566 3300037853 Bacteria 15323
230 Ga0395901_0051729 3300038443 Bacteria 4271
231 Ga0436365_1669934 3300039437 Bacteria 6076
232 Ga0436361_0293247 3300039447 Unclassified 1252
233 Ga0451839_0298065 3300041496 Bacteria 959
234 Ga0439435_0169536 3300042436 Unclassified 709
235 Ga0451577_0057288 3300042876 Bacteria 3474
236 Ga0451577_0347447 3300042876 Bacteria 1346
237 Ga0451577_1567950 3300042876 Bacteria 581
238 Ga0453683_0185746 3300044673 Bacteria 1319
239 Ga0466966_0038750 3300044684 Bacteria 3070
240 Ga0466961_0001047 3300044693 Bacteria 17027
241 Ga0453684_0000714 3300044712 Bacteria 117450
242 Ga0453684_0001209 3300044712 Bacteria 79474
243 Ga0453684_0002240 3300044712 Bacteria 47976
244 Ga0453684_0047994 3300044712 Bacteria 5653
245 Ga0453684_0050385 3300044712 Bacteria 5478
246 Ga0453684_0338531 3300044712 Unclassified 1699
247 Ga0453684_0440274 3300044712 Archaea 1452
248 Ga0453684_0462591 3300044712 Bacteria 1410
249 Ga0466971_0057348 3300044719 Bacteria 1757
250 Ga0466959_0055629 3300045049 Unclassified 2888
251 Ga0466959_0211517 3300045049 Bacteria 1347
252 Ga0451576_0000163 3300045051 Bacteria 170072
253 Ga0451576_0001452 3300045051 Bacteria 40291
254 Ga0451576_0639757 3300045051 Bacteria 1117
255 Ga0451576_1047381 3300045051 Unclassified 854
256 Ga0451576_1532850 3300045051 Unclassified 692
257 Ga0466958_0157154 3300045836 Bacteria 1435
258 Ga0466958_0170768 3300045836 Bacteria 1377
259 Ga0466958_0200269 3300045836 Bacteria 1271
260 Ga0466967_0077797 3300045976 Bacteria 2987
261 Ga0495620_0004919 3300046515 Bacteria 7493
262 Ga0495643_0000008 3300046522 Bacteria 367010
263 Ga0496104_0185866 3300048907 Bacteria 1989
264 Ga0496109_0161218 3300048912 Bacteria 2101
265 Ga0496111_0774714 3300048914 Bacteria 695
266 Ga0496112_1052305 3300048915 Archaea 733
267 Ga0496114_0000013 3300048917 Bacteria 317623
268 Ga0501031_0649059 3300049568 Bacteria 678
269 Ga0501032_0032820 3300049569 Bacteria 3558
270 Ga0501033_0090007 3300049570 Bacteria 2245
271 Ga0501033_0321680 3300049570 Bacteria 1087
272 Ga0501034_0411104 3300049571 Bacteria 1275
273 Ga0501036_0052166 3300049572 Unclassified 3464
274 Ga0501036_0292814 3300049572 Bacteria 1362
275 Ga0501037_0279989 3300049573 Bacteria 1162
276 Ga0501039_0017880 3300049575 Bacteria 5439
277 Ga0501039_0678528 3300049575 Bacteria 806
278 Ga0501041_0021840 3300049577 Bacteria 3834
279 Ga0501042_0019498 3300049578 Bacteria 4711
280 Ga0501042_0548315 3300049578 Bacteria 840
281 Ga0501046_0342208 3300049580 Unclassified 1087
282 Ga0501047_0000940 3300049581 Bacteria 29506
283 Ga0501047_0112434 3300049581 Bacteria 2605
284 Ga0501047_0392783 3300049581 Bacteria 1220
285 Ga0501067_0016545 3300049583 Bacteria 4075
286 Ga0501067_0193000 3300049583 Bacteria 1134
287 Ga0501068_0030968 3300049584 Bacteria 3176
288 Ga0501068_0353336 3300049584 Unclassified 945
289 Ga0501070_0037995 3300049586 Bacteria 4018
290 Ga0501070_0058210 3300049586 Bacteria 3203
291 Ga0501070_0214142 3300049586 Bacteria 1581
292 Ga0501071_0104342 3300049587 Bacteria 2092
293 Ga0501071_0137010 3300049587 Bacteria 1822
294 Ga0501072_0063152 3300049588 Bacteria 2921
295 Ga0501074_0080609 3300049590 Bacteria 2335
296 Ga0501075_0006699 3300049591 Bacteria 7946
297 Ga0501075_0049125 3300049591 Bacteria 3171
298 Ga0501076_0131332 3300049592 Bacteria 2031
299 Ga0501077_0000822 3300049593 Bacteria 18806
300 Ga0501077_0084011 3300049593 Bacteria 2018
301 Ga0501249_041367 3300049679 Bacteria 1046
302 Ga0501080_0782722 3300049742 Bacteria 837
303 Ga0501081_0158108 3300049743 Bacteria 1631
304 Ga0501083_0044179 3300049744 Bacteria 3016
305 Ga0501035_0000390 3300049822 Bacteria 50364
306 Ga0501035_0726475 3300049822 Bacteria 799
307 Ga0501044_0012140 3300049823 Bacteria 9329
308 Ga0501044_0108360 3300049823 Bacteria 2788
309 Ga0501044_0363286 3300049823 Bacteria 1365
310 Ga0501045_0353019 3300049824 Bacteria 1094
311 nmdc:mga08y16_5_c1 3300050511 Bacteria 751284
312 nmdc:mga08x19_62713_c1 3300050514 Bacteria 2411
313 Ga0495655_0085117 3300053083 Bacteria 911
314 Ga0500628_000880 3300053129 Bacteria 5299
315 Ga0501082_0000736 3300060353 Bacteria 28805
316 Ga0530510_0049235 3300061734 Bacteria 3045
317 Ga0163163_10064821
318 Ga0070658_10017214
319 Ga0070658_10066701
320 Ga0070658_10072732
321 Ga0070658_10385524
322 Ga0070658_10578875
323 Ga0070676_10410601
324 Ga0070676_10563340
325 Ga0070690_100249015
326 Ga0070666_10007305
327 Ga0070680_100000588
328 Ga0070680_101035989
329 Ga0070660_100001864
330 Ga0070660_100018640
331 Ga0070687_100006067
332 Ga0070687_100020979
333 Ga0070687_100063521
334 Ga0070661_100032650
335 Ga0070669_100000032
336 Ga0070675_100000042
337 Ga0070671_100060059
338 Ga0070671_100405895
339 Ga0070673_100035656
340 Ga0070688_100272684
341 Ga0070659_100052081
342 Ga0070709_10008273
343 Ga0070714_100001580
344 Ga0070713_100300111
345 Ga0070711_100000083
346 Ga0070700_100000076
347 Ga0070694_100017455
348 Ga0070694_100680939
349 Ga0070663_100095269
350 Ga0070663_100851990
351 Ga0070678_100279797
352 Ga0070662_100000099
353 Ga0070681_10017251
354 Ga0070681_10255263
355 Ga0070681_10337032
356 Ga0070685_10006305
357 Ga0070685_10051742
358 Ga0070706_100007600
359 Ga0070706_100092266
360 Ga0070706_100256118
361 Ga0070706_100330556
362 Ga0070698_100005627
363 Ga0070698_100318053
364 Ga0070679_100002844
365 Ga0070679_100087193
366 Ga0070679_100394700
367 Ga0070684_100049567
368 Ga0070684_100833216
369 Ga0070697_100002363
370 Ga0070697_100090057
371 Ga0070697_100123795
372 Ga0068853_100001941
373 Ga0070686_100000005
374 Ga0070686_100585668
375 Ga0070695_100169193
376 Ga0070695_100229270
377 Ga0070665_100001280
378 Ga0070665_100037634
379 Ga0070665_100061460
380 Ga0070665_100063280
381 Ga0070665_100290789
382 Ga0070704_100029483
383 Ga0070704_100089672
384 Ga0068855_100121537
385 Ga0068855_100275544
386 Ga0068855_100362705
387 Ga0070664_100658962
388 Ga0068854_100013728
389 Ga0068856_100436280
390 Ga0068856_100537218
391 Ga0070702_100004361
392 Ga0070702_100581569
393 Ga0068852_100039001
394 Ga0068852_100061253
395 Ga0068852_100441689
396 Ga0068852_100774792
397 Ga0068859_100683213
398 Ga0068864_100119984
399 Ga0068851_10029315
400 Ga0068851_10160638
401 Ga0097621_100146479
402 Ga0068871_100088109
403 Ga0075436_100019767
404 Ga0097620_100683204
405 Ga0099794_10006278
406 Ga0105244_10010320
407 Ga0105240_10157281
408 Ga0105240_11022665
409 Ga0111539_10000004
410 Ga0105245_10051827
411 Ga0105245_10138696
412 Ga0105241_10100253
413 Ga0105248_10006585
414 Ga0105248_10485401
415 Ga0105237_10000045
416 Ga0105238_10001108
417 Ga0105238_10227678
418 Ga0157373_10652383
419 Ga0157371_10164715
420 Ga0157370_10111854
421 Ga0157370_10170389
422 Ga0157369_10134283
423 Ga0157369_10235484
424 Ga0157369_10469087
425 Ga0157374_10037708
426 Ga0157378_10076722
427 Ga0157378_10612272
428 Ga0157372_10068350
429 Ga0157372_10345761
430 Ga0157372_10351865
431 Ga0157372_10453018
432 Ga0157380_10764920
433 Ga0157380_11530281
434 Ga0157376_10321131
435 Ga0157376_10432264
436 Ga0157376_10439546
437 Ga0157376_10505975
438 Ga0157376_10749181
439 Ga0206353_10302360
440 Ga0213872_10001838
441 Ga0213875_10007276
442 Ga0207656_10191916
443 Ga0207655_1031538
444 Ga0207680_10047529
445 Ga0207699_10004327
446 Ga0207645_10558203
447 Ga0207705_10044588
448 Ga0207705_10173242
449 Ga0207684_10005473
450 Ga0207684_10077457
451 Ga0207684_10250352
452 Ga0207654_10057874
453 Ga0207707_10066066
454 Ga0207707_10113831
455 Ga0207707_10458511
456 Ga0207707_10588199
457 Ga0207707_10671246
458 Ga0207695_10247644
459 Ga0207695_10277705
460 Ga0207671_10000217
461 Ga0207660_10098458
462 Ga0207662_10011297
463 Ga0207662_10099023
464 Ga0207662_10102766
465 Ga0207657_10004486
466 Ga0207657_10040706
467 Ga0207649_10326955
468 Ga0207652_10009634
469 Ga0207652_10262447
470 Ga0207652_10341780
471 Ga0207652_10349530
472 Ga0207652_10474102
473 Ga0207652_10714414
474 Ga0207646_10116493
475 Ga0207681_10000052
476 Ga0207694_10009924
477 Ga0207694_10052711
478 Ga0207659_10000045
479 Ga0207687_10029194
480 Ga0207664_10127718
481 Ga0207664_10818293
482 Ga0207664_10954525
483 Ga0207644_10239693
484 Ga0207690_10070059
485 Ga0207706_10000436
486 Ga0207711_10030967
487 Ga0207711_10907285
488 Ga0207667_10160265
489 Ga0207667_10227589
490 Ga0207667_10320754
491 Ga0207651_10009687
492 Ga0207651_10557026
493 Ga0207658_11015842
494 Ga0207703_10988101
495 Ga0207639_10073314
496 Ga0207678_10035074
497 Ga0207678_10151123
498 Ga0207708_10000010
499 Ga0207683_10278677
500 Ga0207683_10302142
501 Ga0207698_10033368
502 Ga0207698_10036669
503 Ga0207698_10046213
504 Ga0209588_1142590
505 Ga0207428_10000006
506 Ga0268266_10000525
507 Ga0268266_10017954
508 Ga0268266_10069676
509 Ga0268266_10230227
510 Ga0268266_10352216
511 Ga0268266_10419182
512 Ga0268264_11227527
513 Ga0265334_10102104
514 Ga0265336_10045675
515 Ga0265338_10027312
516 Ga0265320_10269000
517 Ga0265316_10143191
518 Ga0265316_10389290
519 Ga0265314_10120023
520 Ga0265342_10068972
521 Ga0307405_10013537
522 Ga0307413_10036908
523 Ga0307413_10138487
524 Ga0307413_10204651
525 Ga0307410_10136282
526 Ga0307410_10154269
527 Ga0307410_10335653
528 Ga0307406_10476793
529 Ga0307407_10232832
530 Ga0307412_10367083
531 Ga0307409_100078880
532 Ga0307409_100084458
533 Ga0307416_101907912
534 Ga0307414_10150743
535 Ga0307415_100352607
536 Ga0373929_0000001
537 Ga0373929_0023097
538 Ga0373961_0000252
539 Ga0373931_0284069
540 Ga0395898_0054848
541 Ga0395905_0082749
542 Ga0395905_0471009
543 Ga0395905_0746256
544 Ga0436364_0436556
545 Ga0436364_0465566
546 Ga0395901_0051729
547 Ga0436365_1669934
548 Ga0436361_0293247
549 Ga0451839_0298065
550 Ga0439435_0169536
551 Ga0451577_0057288
552 Ga0451577_0347447
553 Ga0451577_1567950
554 Ga0453683_0185746
555 Ga0466966_0038750
556 Ga0466961_0001047
557 Ga0453684_0000714
558 Ga0453684_0001209
559 Ga0453684_0002240
560 Ga0453684_0047994
561 Ga0453684_0050385
562 Ga0453684_0338531
563 Ga0453684_0440274
564 Ga0453684_0462591
565 Ga0466971_0057348
566 Ga0466959_0055629
567 Ga0466959_0211517
568 Ga0451576_0000163
569 Ga0451576_0001452
570 Ga0451576_0639757
571 Ga0451576_1047381
572 Ga0451576_1532850
573 Ga0466958_0157154
574 Ga0466958_0170768
575 Ga0466958_0200269
576 Ga0466967_0077797
577 Ga0495620_0004919
578 Ga0495643_0000008
579 Ga0496104_0185866
580 Ga0496109_0161218
581 Ga0496111_0774714
582 Ga0496112_1052305
583 Ga0496114_0000013
584 Ga0501031_0649059
585 Ga0501032_0032820
586 Ga0501033_0090007
587 Ga0501033_0321680
588 Ga0501034_0411104
589 Ga0501036_0052166
590 Ga0501036_0292814
591 Ga0501037_0279989
592 Ga0501039_0017880
593 Ga0501039_0678528
594 Ga0501041_0021840
595 Ga0501042_0019498
596 Ga0501042_0548315
597 Ga0501046_0342208
598 Ga0501047_0000940
599 Ga0501047_0112434
600 Ga0501047_0392783
601 Ga0501067_0016545
602 Ga0501067_0193000
603 Ga0501068_0030968
604 Ga0501068_0353336
605 Ga0501070_0037995
606 Ga0501070_0058210
607 Ga0501070_0214142
608 Ga0501071_0104342
609 Ga0501071_0137010
610 Ga0501072_0063152
611 Ga0501074_0080609
612 Ga0501075_0006699
613 Ga0501075_0049125
614 Ga0501076_0131332
615 Ga0501077_0000822
616 Ga0501077_0084011
617 Ga0501249_041367
618 Ga0501080_0782722
619 Ga0501081_0158108
620 Ga0501083_0044179
621 Ga0501035_0000390
622 Ga0501035_0726475
623 Ga0501044_0012140
624 Ga0501044_0108360
625 Ga0501044_0363286
626 Ga0501045_0353019
627 nmdc:mga08y16_5_c1
628 nmdc:mga08x19_62713_c1
629 Ga0495655_0085117
630 Ga0500628_000880
631 Ga0501082_0000736
632 Ga0530510_0049235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

3

169

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

9

195

0.85

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

5

102

0.83

PF23441

13

199

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7l-assembly4.cif.gz_B the crystal structure of the protein lin1944 from listeria innocua . 0.9677 1 195
3ucf-assembly1.cif.gz_A crystal structure of a small-chain dehydrogenase 0.939 1 195
3ucf-assembly1.cif.gz_D crystal structure of a small-chain dehydrogenase 0.9297 1 195
3gvc-assembly1.cif.gz_A-2 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.9143 2 195
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9125 2 195
ID Description Score Start End Superfamily
3d7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9563 2 195 3.40.50.720
3d7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9323 2 195 3.40.50.720
3ucfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9094 1 195 3.40.50.720
af_Q9VWP2_2_241_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9083 2 196 3.40.50.720
3svtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9036 2 196 3.40.50.720
ID Description Score Start End GO Terms
AF-D5HBQ3-F1-model_v4 Dehydrogenases with different specificities (Related to short-chain alcohol dehydrogenases) 0.9977 3 200 GO:0016491
AF-A0A2T2U9F2-F1-model_v4 Short chain dehydrogenase 0.9968 1 200 GO:0016787
AF-A0A1R3UZC4-F1-model_v4 NADP-dependent mannitol dehydrogenase (EC 1.1.1.138) 0.9958 1 119 GO:0050085
AF-A0A1Q4AZV4-F1-model_v4 deleted 0.9954 1 157
AF-A0A2N4Z6P1-F1-model_v4 Short chain dehydrogenase 0.9954 1 151 GO:0016491

Map