F403641

General Info

Members Datasets Scaffolds Average Seq Length
316 172 632 359

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10223540|Ga0111539_102235402
Length 395
Sequence MPRKSSRAACRDRAHGEVAAAIGRVFGTKSPEEMGMAPDSNYDSAKANGFAERLLTTLNDGALCLMISIGHRTGLLDAMRDAAPATSSEIAAKAGLNERYVREWLGAMVTGRIVDVDPATNRFSLPAEHAAFLTRSAGADNIGVFTQYISLLGSVEDDIVECFKKGGGVSYAKFPRFHEVMAEDSGQSVLSSLESHIVPLVSGWAERLARGVQMLDVGCGRGRIINRLAELYPKSRFTGMDLSSEAILSAWQDAADKKLRNIEFIVADLSQFDETAEAESFDLVATFDAIHDQAKPLNVLRGIRRTLRSDGIYLMQDIKGSSHIHQNRDHPIGPFLYTVSCMHCMTVSLAQNGEGLGAMWGEEKTREYLAKAGFSSVEKHELSHDIQNNWYVVRK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
117 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
118 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
145 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
168 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
172 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0.63
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 0.95
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 14.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10223540 3300009094 Bacteria 2193
2 JGI24751J29686_10023084 3300002459 Archaea 1290
3 rootL2_10135102 3300003322 Bacteria 3761
4 Ga0007416J51690_1060033 3300003577 Bacteria 1149
5 Ga0007429J51699_1071158 3300003579 Bacteria 1169
6 JGI25405J52794_10001124 3300003911 Archaea 4287
7 Ga0065712_10002112 3300005290 Bacteria 6833
8 Ga0065712_10010333 3300005290 Unclassified 3163
9 Ga0065715_10002459 3300005293 Archaea 5975
10 Ga0065715_10023532 3300005293 Unclassified 3746
11 Ga0065715_10094354 3300005293 Bacteria 4358
12 Ga0065715_10129465 3300005293 Bacteria 2020
13 Ga0065707_10008633 3300005295 Bacteria 2369
14 Ga0065707_10138569 3300005295 Unclassified 1804
15 Ga0070658_10067502 3300005327 Unclassified 2922
16 Ga0070690_100037458 3300005330 Unclassified 3056
17 Ga0070670_100034756 3300005331 Bacteria 4338
18 Ga0068869_100061586 3300005334 Unclassified 2753
19 Ga0068869_100184221 3300005334 Bacteria 1638
20 Ga0070666_10094257 3300005335 Unclassified 2059
21 Ga0070680_100169722 3300005336 Bacteria 1835
22 Ga0068868_100123491 3300005338 Bacteria 2113
23 Ga0070689_100057092 3300005340 Bacteria 3029
24 Ga0070661_100006283 3300005344 Bacteria 8196
25 Ga0070669_100000996 3300005353 Bacteria 20632
26 Ga0070669_100050564 3300005353 Unclassified 3036
27 Ga0070675_100053401 3300005354 Bacteria 3323
28 Ga0070675_100054723 3300005354 Bacteria 3283
29 Ga0070675_100171536 3300005354 Bacteria 1871
30 Ga0070671_100057906 3300005355 Bacteria 3225
31 Ga0070671_100091853 3300005355 Bacteria 2543
32 Ga0070674_100101764 3300005356 Unclassified 2094
33 Ga0070673_100066199 3300005364 Bacteria 2885
34 Ga0070659_100069830 3300005366 Bacteria 2789
35 Ga0070667_100129589 3300005367 Bacteria 2201
36 Ga0070701_10044221 3300005438 Bacteria 2281
37 Ga0070700_100020750 3300005441 Bacteria 3812
38 Ga0070694_100015995 3300005444 Bacteria 4720
39 Ga0070663_100071679 3300005455 Unclassified 2522
40 Ga0070681_10026196 3300005458 Bacteria 5862
41 Ga0070681_10079528 3300005458 Bacteria 3235
42 Ga0070681_10242843 3300005458 Bacteria 1714
43 Ga0068867_100027767 3300005459 Bacteria 4071
44 Ga0070679_100067426 3300005530 Unclassified 3568
45 Ga0070679_100094542 3300005530 Bacteria 2976
46 Ga0070697_100215626 3300005536 Bacteria 1635
47 Ga0070672_100022849 3300005543 Bacteria 4600
48 Ga0070672_100140628 3300005543 Bacteria 1991
49 Ga0070686_100031237 3300005544 Unclassified 3254
50 Ga0070686_100052686 3300005544 Bacteria 2596
51 Ga0070695_100040361 3300005545 Bacteria 2955
52 Ga0070665_100329339 3300005548 Unclassified 1532
53 Ga0070704_100045370 3300005549 Bacteria 3058
54 Ga0070704_100087493 3300005549 Bacteria 2312
55 Ga0070664_100021671 3300005564 Bacteria 5298
56 Ga0070664_100086644 3300005564 Bacteria 2706
57 Ga0068854_100052032 3300005578 Unclassified 2936
58 Ga0070702_100102505 3300005615 Archaea 1758
59 Ga0068859_100154575 3300005617 Bacteria 2371
60 Ga0068864_100353043 3300005618 Bacteria 1388
61 Ga0068861_100346046 3300005719 Bacteria 1302
62 Ga0068862_100089098 3300005844 Bacteria 2685
63 Ga0081455_10001144 3300005937 Bacteria 33205
64 Ga0081455_10007820 3300005937 Archaea 11197
65 Ga0081455_10027626 3300005937 Archaea 5199
66 Ga0081455_10055006 3300005937 Bacteria 3388
67 Ga0070712_100242560 3300006175 Bacteria 1436
68 Ga0075366_10180761 3300006195 Bacteria 1281
69 Ga0075428_100050553 3300006844 Archaea 4558
70 Ga0075428_100062942 3300006844 Archaea 4061
71 Ga0075428_100079258 3300006844 Bacteria 3585
72 Ga0075428_100113707 3300006844 Bacteria 2949
73 Ga0075428_100215551 3300006844 Archaea 2074
74 Ga0075431_100053107 3300006847 Bacteria 4178
75 Ga0075431_100238751 3300006847 Bacteria 1849
76 Ga0075433_10039724 3300006852 Bacteria 4070
77 Ga0075433_10041088 3300006852 Bacteria 4006
78 Ga0075433_10179231 3300006852 Bacteria 1885
79 Ga0075434_100045105 3300006871 Bacteria 4373
80 Ga0075434_100112747 3300006871 Bacteria 2731
81 Ga0075434_100198144 3300006871 Unclassified 2028
82 Ga0075434_100383349 3300006871 Bacteria 1426
83 Ga0075429_100083295 3300006880 Bacteria 2788
84 Ga0075429_100180477 3300006880 Bacteria 1850
85 Ga0068865_100028463 3300006881 Bacteria 3700
86 Ga0068865_100065682 3300006881 Bacteria 2557
87 Ga0068865_100380403 3300006881 Unclassified 1151
88 Ga0075436_100121732 3300006914 Bacteria 1826
89 Ga0097620_100154569 3300006931 Bacteria 2371
90 Ga0075435_100045758 3300007076 Bacteria 3509
91 Ga0075435_100093171 3300007076 Unclassified 2489
92 Ga0075435_100245433 3300007076 Unclassified 1524
93 Ga0111539_10001064 3300009094 Bacteria 36182
94 Ga0111539_10117605 3300009094 Archaea 3115
95 Ga0111539_10340071 3300009094 Unclassified 1747
96 Ga0111539_10509398 3300009094 Bacteria 1402
97 Ga0105245_10226820 3300009098 Unclassified 1805
98 Ga0105245_10293218 3300009098 Bacteria 1594
99 Ga0114129_10001429 3300009147 Bacteria 32259
100 Ga0114129_10016530 3300009147 Bacteria 10506
101 Ga0114129_10016897 3300009147 Bacteria 10389
102 Ga0114129_10026248 3300009147 Bacteria 8250
103 Ga0114129_10042399 3300009147 Bacteria 6408
104 Ga0114129_10052749 3300009147 Bacteria 5707
105 Ga0114129_10070693 3300009147 Bacteria 4867
106 Ga0114129_10118984 3300009147 Bacteria 3638
107 Ga0114129_10124954 3300009147 Archaea 3538
108 Ga0114129_10568779 3300009147 Bacteria 1472
109 Ga0105243_10095840 3300009148 Bacteria 2453
110 Ga0105249_10003580 3300009553 Bacteria 13440
111 Ga0105249_10415289 3300009553 Unclassified 1378
112 Ga0105239_10353459 3300010375 Unclassified 1659
113 Ga0105246_10027655 3300011119 Unclassified 3719
114 Ga0105246_10150800 3300011119 Archaea 1759
115 Ga0157374_10031720 3300013296 Bacteria 4806
116 Ga0157374_10336073 3300013296 Bacteria 1499
117 Ga0157378_10041755 3300013297 Bacteria 4069
118 Ga0157378_10092904 3300013297 Archaea 2746
119 Ga0157378_10347356 3300013297 Bacteria 1448
120 Ga0163162_10176244 3300013306 Bacteria 2264
121 Ga0163162_10334009 3300013306 Bacteria 1648
122 Ga0157372_10386753 3300013307 Unclassified 1630
123 Ga0163163_10078450 3300014325 Unclassified 3299
124 Ga0157380_10000004 3300014326 Bacteria 212844
125 Ga0157377_10048553 3300014745 Archaea 2382
126 Ga0157377_10076729 3300014745 Bacteria 1944
127 Ga0157377_10264840 3300014745 Unclassified 1120
128 Ga0207697_10001836 3300025315 Bacteria 11370
129 Ga0207688_10102482 3300025901 Archaea 1654
130 Ga0207645_10003843 3300025907 Bacteria 11239
131 Ga0207705_10182152 3300025909 Bacteria 1586
132 Ga0207707_10078838 3300025912 Unclassified 2876
133 Ga0207693_10214145 3300025915 Bacteria 1514
134 Ga0207660_10165681 3300025917 Bacteria 1708
135 Ga0207657_10012256 3300025919 Bacteria 8470
136 Ga0207649_10135086 3300025920 Unclassified 1680
137 Ga0207652_10036053 3300025921 Bacteria 4180
138 Ga0207681_10026651 3300025923 Bacteria 3730
139 Ga0207650_10066651 3300025925 Bacteria 2700
140 Ga0207659_10089030 3300025926 Bacteria 2301
141 Ga0207687_10096718 3300025927 Unclassified 2164
142 Ga0207687_10170906 3300025927 Bacteria 1676
143 Ga0207706_10044344 3300025933 Unclassified 3942
144 Ga0207670_10102893 3300025936 Bacteria 2043
145 Ga0207669_10233242 3300025937 Unclassified 1359
146 Ga0207691_10026521 3300025940 Bacteria 5436
147 Ga0207691_10145186 3300025940 Bacteria 2089
148 Ga0207689_10046044 3300025942 Unclassified 3607
149 Ga0207679_10032875 3300025945 Bacteria 3646
150 Ga0207679_10079422 3300025945 Plasmid 2502
151 Ga0207712_10042504 3300025961 Bacteria 3130
152 Ga0207668_10365206 3300025972 Bacteria 1211
153 Ga0207678_10006572 3300026067 Bacteria 10308
154 Ga0207708_10037409 3300026075 Bacteria 3697
155 Ga0207708_10060230 3300026075 Archaea 2898
156 Ga0207648_10028218 3300026089 Bacteria 4978
157 Ga0207648_10287968 3300026089 Bacteria 1470
158 Ga0207674_10012565 3300026116 Bacteria 9462
159 Ga0207674_10145795 3300026116 Bacteria 2326
160 Ga0207683_10098518 3300026121 Unclassified 2608
161 Ga0209971_1012221 3300027682 Bacteria 2032
162 Ga0209974_10015270 3300027876 Bacteria 2551
163 Ga0207428_10019625 3300027907 Archaea 5760
164 Ga0207428_10100174 3300027907 Bacteria 2239
165 Ga0268265_10076672 3300028380 Bacteria 2623
166 Ga0268264_10199908 3300028381 Bacteria 1828
167 Ga0307408_100079549 3300031548 Unclassified 2446
168 Ga0316576_10083128 3300031727 Bacteria 2378
169 Ga0316576_10125157 3300031727 Bacteria 1931
170 Ga0316578_10001118 3300031728 Bacteria 10481
171 Ga0316578_10006739 3300031728 Bacteria 5695
172 Ga0316578_10034625 3300031728 Bacteria 2900
173 Ga0316577_10087404 3300031733 Bacteria 1744
174 Ga0307413_10004282 3300031824 Bacteria 6184
175 Ga0307406_10231639 3300031901 Bacteria 1380
176 Ga0307416_100110644 3300032002 Bacteria 2419
177 Ga0307416_100110937 3300032002 Bacteria 2417
178 Ga0307414_10034380 3300032004 Unclassified 3360
179 Ga0307411_10015033 3300032005 Unclassified 4329
180 Ga0373945_0131203 3300035116 Bacteria 1004
181 Ga0316574_0036745 3300035398 Bacteria 3000
182 Ga0373931_0008407 3300035691 Bacteria 4896
183 Ga0316584_0010909 3300036712 Bacteria 6365
184 Ga0316584_0029342 3300036712 Bacteria 4060
185 Ga0316584_0079954 3300036712 Bacteria 2449
186 Ga0316581_0032111 3300037588 Unclassified 1583
187 Ga0400489_21347 3300039093 Bacteria 1228
188 Ga0400487_42174 3300039110 Bacteria 112400
189 Ga0439449_0000533 3300042007 Bacteria 14186
190 Ga0439460_0018616 3300042461 Archaea 1872
191 Ga0451576_0000390 3300045051 Bacteria 102401
192 Ga0451576_0368014 3300045051 Bacteria 1506
193 Ga0496108_0453823 3300048911 Bacteria 1120
194 Ga0496112_0086454 3300048915 Unclassified 3102
195 Ga0496112_0164131 3300048915 Bacteria 2187
196 Ga0501291_003750 3300049514 Archaea 1907
197 Ga0501031_0025273 3300049568 Bacteria 3875
198 Ga0501031_0032469 3300049568 Archaea 3404
199 Ga0501032_0020119 3300049569 Bacteria 4653
200 Ga0501032_0098984 3300049569 Bacteria 1932
201 Ga0501033_0134622 3300049570 Archaea 1788
202 Ga0501033_0170816 3300049570 Bacteria 1561
203 Ga0501034_0055208 3300049571 Bacteria 3998
204 Ga0501036_0004589 3300049572 Archaea 11161
205 Ga0501036_0059040 3300049572 Bacteria 3250
206 Ga0501036_0303530 3300049572 Unclassified 1335
207 Ga0501037_0223972 3300049573 Archaea 1322
208 Ga0501038_0006396 3300049574 Archaea 10910
209 Ga0501039_0000304 3300049575 Archaea 34831
210 Ga0501039_0014851 3300049575 Bacteria 5954
211 Ga0501039_0118945 3300049575 Unclassified 2069
212 Ga0501039_0240425 3300049575 Archaea 1423
213 Ga0501039_0307113 3300049575 Unclassified 1247
214 Ga0501040_0000319 3300049576 Archaea 28272
215 Ga0501040_0011248 3300049576 Bacteria 5858
216 Ga0501040_0112744 3300049576 Bacteria 1902
217 Ga0501041_0000210 3300049577 Archaea 27087
218 Ga0501041_0014306 3300049577 Bacteria 4711
219 Ga0501041_0116861 3300049577 Archaea 1656
220 Ga0501042_0008753 3300049578 Archaea 6711
221 Ga0501042_0034384 3300049578 Bacteria 3594
222 Ga0501043_0067446 3300049579 Bacteria 2809
223 Ga0501043_0075162 3300049579 Archaea 2654
224 Ga0501046_0000957 3300049580 Archaea 28306
225 Ga0501046_0063302 3300049580 Bacteria 2888
226 Ga0501046_0271236 3300049580 Archaea 1244
227 Ga0501046_0282293 3300049580 Archaea 1216
228 Ga0501048_0027588 3300049582 Bacteria 4125
229 Ga0501048_0193176 3300049582 Archaea 1442
230 Ga0501068_0012191 3300049584 Bacteria 4862
231 Ga0501068_0061409 3300049584 Bacteria 2284
232 Ga0501068_0072560 3300049584 Archaea 2102
233 Ga0501070_0095810 3300049586 Bacteria 2455
234 Ga0501071_0000278 3300049587 Archaea 24335
235 Ga0501071_0016560 3300049587 Bacteria 5072
236 Ga0501071_0047521 3300049587 Archaea 3083
237 Ga0501071_0264794 3300049587 Bacteria 1299
238 Ga0501072_0000045 3300049588 Archaea 95619
239 Ga0501072_0007840 3300049588 Bacteria 8111
240 Ga0501072_0022849 3300049588 Bacteria 4853
241 Ga0501073_0049175 3300049589 Bacteria 2957
242 Ga0501073_0205788 3300049589 Bacteria 1360
243 Ga0501074_0224072 3300049590 Bacteria 1338
244 Ga0501075_0020356 3300049591 Bacteria 4825
245 Ga0501075_0172495 3300049591 Bacteria 1651
246 Ga0501075_0209792 3300049591 Bacteria 1486
247 Ga0501076_0000172 3300049592 Archaea 37929
248 Ga0501076_0019531 3300049592 Bacteria 5181
249 Ga0501076_0027817 3300049592 Bacteria 4385
250 Ga0501077_0000424 3300049593 Archaea 25573
251 Ga0501077_0009935 3300049593 Bacteria 5922
252 Ga0501077_0010974 3300049593 Bacteria 5646
253 Ga0501077_0207341 3300049593 Archaea 1245
254 Ga0501243_008908 3300049675 Bacteria 1554
255 Ga0501079_0000011 3300049741 Archaea 70980
256 Ga0501079_0010775 3300049741 Bacteria 6961
257 Ga0501079_0165013 3300049741 Unclassified 1727
258 Ga0501080_0026458 3300049742 Bacteria 5390
259 Ga0501081_0000014 3300049743 Archaea 59700
260 Ga0501081_0073856 3300049743 Archaea 2379
261 Ga0501083_0057840 3300049744 Bacteria 2595
262 Ga0501035_0005762 3300049822 Bacteria 11678
263 Ga0501044_0390363 3300049823 Bacteria 1306
264 Ga0501045_0001095 3300049824 Archaea 17911
265 Ga0501045_0024061 3300049824 Bacteria 4371
266 Ga0501045_0036345 3300049824 Bacteria 3577
267 Ga0501045_0078991 3300049824 Bacteria 2426
268 Ga0501045_0214825 3300049824 Bacteria 1432
269 Ga0501045_0254365 3300049824 Archaea 1307
270 nmdc:mga0k408_53832_c1 3300050493 Bacteria 1962
271 nmdc:mga05p37_135315_c1 3300050507 Bacteria 3023
272 nmdc:mga05p37_157566_c1 3300050507 Archaea 2774
273 nmdc:mga05p37_17964_c1 3300050507 Bacteria 8539
274 nmdc:mga05p37_2036_c1 3300050507 Bacteria 23578
275 nmdc:mga05p37_27_c1 3300050507 Bacteria 115422
276 nmdc:mga05p37_30604_c1 3300050507 Bacteria 6568
277 nmdc:mga05p37_400783_c1 3300050507 Unclassified 1602
278 nmdc:mga05p37_44608_c1 3300050507 Archaea 5455
279 nmdc:mga05p37_44743_c1 3300050507 Bacteria 5446
280 nmdc:mga09592_151410_c1 3300050508 Archaea 2001
281 nmdc:mga09592_361125_c1 3300050508 Unclassified 1257
282 nmdc:mga09592_37470_c1 3300050508 Bacteria 4067
283 nmdc:mga0qj67_37115_c1 3300050509 Archaea 3816
284 nmdc:mga06r32_116193_c1 3300050510 Bacteria 2636
285 nmdc:mga06r32_174695_c1 3300050510 Bacteria 2132
286 nmdc:mga06r32_264859_c1 3300050510 Bacteria 1706
287 nmdc:mga06r32_38371_c1 3300050510 Bacteria 4538
288 nmdc:mga06r32_482423_c1 3300050510 Archaea 1218
289 nmdc:mga08y16_25876_c1 3300050511 Bacteria 6191
290 nmdc:mga08y16_46008_c1 3300050511 Bacteria 4571
291 nmdc:mga08y16_55322_c1 3300050511 Archaea 4147
292 nmdc:mga08y16_633833_c1 3300050511 Bacteria 1075
293 nmdc:mga0n895_126056_c1 3300050512 Bacteria 2584
294 nmdc:mga0n895_37842_c1 3300050512 Bacteria 4670
295 nmdc:mga0rr50_183681_c1 3300050513 Unclassified 1711
296 nmdc:mga08x19_108476_c1 3300050514 Bacteria 1849
297 nmdc:mga08x19_37074_c1 3300050514 Bacteria 3092
298 nmdc:mga08x19_73556_c1 3300050514 Bacteria 2231
299 nmdc:mga0a205_112289_c1 3300050515 Bacteria 2624
300 nmdc:mga0a205_172511_c1 3300050515 Bacteria 2059
301 nmdc:mga0a205_50990_c1 3300050515 Bacteria 3995
302 nmdc:mga0a205_66594_c1 3300050515 Unclassified 3480
303 Ga0501084_0000343 3300054114 Archaea 35509
304 Ga0501084_0055306 3300054114 Bacteria 3320
305 Ga0501084_0160099 3300054114 Bacteria 1899
306 Ga0501084_0302298 3300054114 Archaea 1351
307 Ga0590071_000930 3300059421 Bacteria 8101
308 Ga0590077_003190 3300059426 Bacteria 3414
309 Ga0501082_0000301 3300060353 Archaea 43649
310 Ga0501082_0286254 3300060353 Bacteria 1435
311 Ga0530510_0000179 3300061734 Archaea 38586
312 Ga0530510_0008575 3300061734 Bacteria 7138
313 Ga0530510_0025918 3300061734 Bacteria 4194
314 Ga0530510_0051405 3300061734 Archaea 2977
315 2837185460 2837183177 Bacteria 4637169
316 2910249516 2910245624 Bacteria 6935613
317 Ga0111539_10223540
318 JGI24751J29686_10023084
319 rootL2_10135102
320 Ga0007416J51690_1060033
321 Ga0007429J51699_1071158
322 JGI25405J52794_10001124
323 Ga0065712_10002112
324 Ga0065712_10010333
325 Ga0065715_10002459
326 Ga0065715_10023532
327 Ga0065715_10094354
328 Ga0065715_10129465
329 Ga0065707_10008633
330 Ga0065707_10138569
331 Ga0070658_10067502
332 Ga0070690_100037458
333 Ga0070670_100034756
334 Ga0068869_100061586
335 Ga0068869_100184221
336 Ga0070666_10094257
337 Ga0070680_100169722
338 Ga0068868_100123491
339 Ga0070689_100057092
340 Ga0070661_100006283
341 Ga0070669_100000996
342 Ga0070669_100050564
343 Ga0070675_100053401
344 Ga0070675_100054723
345 Ga0070675_100171536
346 Ga0070671_100057906
347 Ga0070671_100091853
348 Ga0070674_100101764
349 Ga0070673_100066199
350 Ga0070659_100069830
351 Ga0070667_100129589
352 Ga0070701_10044221
353 Ga0070700_100020750
354 Ga0070694_100015995
355 Ga0070663_100071679
356 Ga0070681_10026196
357 Ga0070681_10079528
358 Ga0070681_10242843
359 Ga0068867_100027767
360 Ga0070679_100067426
361 Ga0070679_100094542
362 Ga0070697_100215626
363 Ga0070672_100022849
364 Ga0070672_100140628
365 Ga0070686_100031237
366 Ga0070686_100052686
367 Ga0070695_100040361
368 Ga0070665_100329339
369 Ga0070704_100045370
370 Ga0070704_100087493
371 Ga0070664_100021671
372 Ga0070664_100086644
373 Ga0068854_100052032
374 Ga0070702_100102505
375 Ga0068859_100154575
376 Ga0068864_100353043
377 Ga0068861_100346046
378 Ga0068862_100089098
379 Ga0081455_10001144
380 Ga0081455_10007820
381 Ga0081455_10027626
382 Ga0081455_10055006
383 Ga0070712_100242560
384 Ga0075366_10180761
385 Ga0075428_100050553
386 Ga0075428_100062942
387 Ga0075428_100079258
388 Ga0075428_100113707
389 Ga0075428_100215551
390 Ga0075431_100053107
391 Ga0075431_100238751
392 Ga0075433_10039724
393 Ga0075433_10041088
394 Ga0075433_10179231
395 Ga0075434_100045105
396 Ga0075434_100112747
397 Ga0075434_100198144
398 Ga0075434_100383349
399 Ga0075429_100083295
400 Ga0075429_100180477
401 Ga0068865_100028463
402 Ga0068865_100065682
403 Ga0068865_100380403
404 Ga0075436_100121732
405 Ga0097620_100154569
406 Ga0075435_100045758
407 Ga0075435_100093171
408 Ga0075435_100245433
409 Ga0111539_10001064
410 Ga0111539_10117605
411 Ga0111539_10340071
412 Ga0111539_10509398
413 Ga0105245_10226820
414 Ga0105245_10293218
415 Ga0114129_10001429
416 Ga0114129_10016530
417 Ga0114129_10016897
418 Ga0114129_10026248
419 Ga0114129_10042399
420 Ga0114129_10052749
421 Ga0114129_10070693
422 Ga0114129_10118984
423 Ga0114129_10124954
424 Ga0114129_10568779
425 Ga0105243_10095840
426 Ga0105249_10003580
427 Ga0105249_10415289
428 Ga0105239_10353459
429 Ga0105246_10027655
430 Ga0105246_10150800
431 Ga0157374_10031720
432 Ga0157374_10336073
433 Ga0157378_10041755
434 Ga0157378_10092904
435 Ga0157378_10347356
436 Ga0163162_10176244
437 Ga0163162_10334009
438 Ga0157372_10386753
439 Ga0163163_10078450
440 Ga0157380_10000004
441 Ga0157377_10048553
442 Ga0157377_10076729
443 Ga0157377_10264840
444 Ga0207697_10001836
445 Ga0207688_10102482
446 Ga0207645_10003843
447 Ga0207705_10182152
448 Ga0207707_10078838
449 Ga0207693_10214145
450 Ga0207660_10165681
451 Ga0207657_10012256
452 Ga0207649_10135086
453 Ga0207652_10036053
454 Ga0207681_10026651
455 Ga0207650_10066651
456 Ga0207659_10089030
457 Ga0207687_10096718
458 Ga0207687_10170906
459 Ga0207706_10044344
460 Ga0207670_10102893
461 Ga0207669_10233242
462 Ga0207691_10026521
463 Ga0207691_10145186
464 Ga0207689_10046044
465 Ga0207679_10032875
466 Ga0207679_10079422
467 Ga0207712_10042504
468 Ga0207668_10365206
469 Ga0207678_10006572
470 Ga0207708_10037409
471 Ga0207708_10060230
472 Ga0207648_10028218
473 Ga0207648_10287968
474 Ga0207674_10012565
475 Ga0207674_10145795
476 Ga0207683_10098518
477 Ga0209971_1012221
478 Ga0209974_10015270
479 Ga0207428_10019625
480 Ga0207428_10100174
481 Ga0268265_10076672
482 Ga0268264_10199908
483 Ga0307408_100079549
484 Ga0316576_10083128
485 Ga0316576_10125157
486 Ga0316578_10001118
487 Ga0316578_10006739
488 Ga0316578_10034625
489 Ga0316577_10087404
490 Ga0307413_10004282
491 Ga0307406_10231639
492 Ga0307416_100110644
493 Ga0307416_100110937
494 Ga0307414_10034380
495 Ga0307411_10015033
496 Ga0373945_0131203
497 Ga0316574_0036745
498 Ga0373931_0008407
499 Ga0316584_0010909
500 Ga0316584_0029342
501 Ga0316584_0079954
502 Ga0316581_0032111
503 Ga0400489_21347
504 Ga0400487_42174
505 Ga0439449_0000533
506 Ga0439460_0018616
507 Ga0451576_0000390
508 Ga0451576_0368014
509 Ga0496108_0453823
510 Ga0496112_0086454
511 Ga0496112_0164131
512 Ga0501291_003750
513 Ga0501031_0025273
514 Ga0501031_0032469
515 Ga0501032_0020119
516 Ga0501032_0098984
517 Ga0501033_0134622
518 Ga0501033_0170816
519 Ga0501034_0055208
520 Ga0501036_0004589
521 Ga0501036_0059040
522 Ga0501036_0303530
523 Ga0501037_0223972
524 Ga0501038_0006396
525 Ga0501039_0000304
526 Ga0501039_0014851
527 Ga0501039_0118945
528 Ga0501039_0240425
529 Ga0501039_0307113
530 Ga0501040_0000319
531 Ga0501040_0011248
532 Ga0501040_0112744
533 Ga0501041_0000210
534 Ga0501041_0014306
535 Ga0501041_0116861
536 Ga0501042_0008753
537 Ga0501042_0034384
538 Ga0501043_0067446
539 Ga0501043_0075162
540 Ga0501046_0000957
541 Ga0501046_0063302
542 Ga0501046_0271236
543 Ga0501046_0282293
544 Ga0501048_0027588
545 Ga0501048_0193176
546 Ga0501068_0012191
547 Ga0501068_0061409
548 Ga0501068_0072560
549 Ga0501070_0095810
550 Ga0501071_0000278
551 Ga0501071_0016560
552 Ga0501071_0047521
553 Ga0501071_0264794
554 Ga0501072_0000045
555 Ga0501072_0007840
556 Ga0501072_0022849
557 Ga0501073_0049175
558 Ga0501073_0205788
559 Ga0501074_0224072
560 Ga0501075_0020356
561 Ga0501075_0172495
562 Ga0501075_0209792
563 Ga0501076_0000172
564 Ga0501076_0019531
565 Ga0501076_0027817
566 Ga0501077_0000424
567 Ga0501077_0009935
568 Ga0501077_0010974
569 Ga0501077_0207341
570 Ga0501243_008908
571 Ga0501079_0000011
572 Ga0501079_0010775
573 Ga0501079_0165013
574 Ga0501080_0026458
575 Ga0501081_0000014
576 Ga0501081_0073856
577 Ga0501083_0057840
578 Ga0501035_0005762
579 Ga0501044_0390363
580 Ga0501045_0001095
581 Ga0501045_0024061
582 Ga0501045_0036345
583 Ga0501045_0078991
584 Ga0501045_0214825
585 Ga0501045_0254365
586 nmdc:mga0k408_53832_c1
587 nmdc:mga05p37_135315_c1
588 nmdc:mga05p37_157566_c1
589 nmdc:mga05p37_17964_c1
590 nmdc:mga05p37_2036_c1
591 nmdc:mga05p37_27_c1
592 nmdc:mga05p37_30604_c1
593 nmdc:mga05p37_400783_c1
594 nmdc:mga05p37_44608_c1
595 nmdc:mga05p37_44743_c1
596 nmdc:mga09592_151410_c1
597 nmdc:mga09592_361125_c1
598 nmdc:mga09592_37470_c1
599 nmdc:mga0qj67_37115_c1
600 nmdc:mga06r32_116193_c1
601 nmdc:mga06r32_174695_c1
602 nmdc:mga06r32_264859_c1
603 nmdc:mga06r32_38371_c1
604 nmdc:mga06r32_482423_c1
605 nmdc:mga08y16_25876_c1
606 nmdc:mga08y16_46008_c1
607 nmdc:mga08y16_55322_c1
608 nmdc:mga08y16_633833_c1
609 nmdc:mga0n895_126056_c1
610 nmdc:mga0n895_37842_c1
611 nmdc:mga0rr50_183681_c1
612 nmdc:mga08x19_108476_c1
613 nmdc:mga08x19_37074_c1
614 nmdc:mga08x19_73556_c1
615 nmdc:mga0a205_112289_c1
616 nmdc:mga0a205_172511_c1
617 nmdc:mga0a205_50990_c1
618 nmdc:mga0a205_66594_c1
619 Ga0501084_0000343
620 Ga0501084_0055306
621 Ga0501084_0160099
622 Ga0501084_0302298
623 Ga0590071_000930
624 Ga0590077_003190
625 Ga0501082_0000301
626 Ga0501082_0286254
627 Ga0530510_0000179
628 Ga0530510_0008575
629 Ga0530510_0025918
630 Ga0530510_0051405
631 2837185460
632 2910249516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21320

HTH_65

Rv2258c-like winged HTH domain

61

135

0.99

PF08241

Methyltransf_11

Methyltransferase domain

215

315

0.95

PF13649

Methyltransf_25

Methyltransferase domain

214

311

0.92

PF13847

Methyltransf_31

Methyltransferase domain

208

373

0.89

PF02390

Methyltransf_4

Putative methyltransferase

210

287

0.88

PF08242

Methyltransf_12

Methyltransferase domain

215

313

0.88

PF05175

MTS

Methyltransferase small domain

200

315

0.84

PF00891

Methyltransf_2

O-methyltransferase domain

165

343

0.83

PF02353

CMAS

Mycolic acid cyclopropane synthetase

204

339

0.77

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

204

391

0.76

PF13489

Methyltransf_23

Methyltransferase domain

192

379

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f8e-assembly2.cif.gz_C rv2258c-sah 0.9608 1 346
5f8e-assembly2.cif.gz_C rv2258c-sah 0.9554 1 346
8g5s-assembly1.cif.gz_B crystal structure of apo tnmj 0.9069 2 347
8g5s-assembly1.cif.gz_A crystal structure of apo tnmj 0.904 2 347
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9025 30 81
ID Description Score Start End Superfamily
af_O53532_152_353_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9716 148 346 3.40.50.150
af_O53532_152_353_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9527 148 346 3.40.50.150
af_O01594_147_310_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9291 136 288 3.40.50.150
af_P91387_125_346_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9284 129 335 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9151 163 266 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A535VZZ6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9955 247 347
AF-A0A5J4LE17-F1-model_v4 Transcriptional regulator 0.9812 2 346
AF-A0A535VZZ6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9762 247 347
AF-A0A4R7HY59-F1-model_v4 Methyltransferase family protein 0.976 2 347 GO:0008168
GO:0032259
AF-A0A6A7LJ57-F1-model_v4 Methyltransferase domain-containing protein 0.9739 3 347 GO:0008168
GO:0032259

Map