F403635

General Info

Members Datasets Scaffolds Average Seq Length
316 187 299 160

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11521599|Ga0105240_115215991
Length 185
Sequence MVIGHAANLLIFLPIEEFLTNFGLMDQPKANKISDEKVALGKAENYCAYQERSQQEVRDKLYEWGVYPSIVEGVISKLIENNFLNEERFAIAYATGKFRQKGWGRNKIEQGLKFKKVSDPLIKKALKSIDEDEYLEMLRRIIQKKELSVTEKVSYKRKYKLHQYALSRGFENDLIGDILRDEEMG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541284 Pedobacter sp. YR016 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
7 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
8 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
9 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
10 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
11 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
12 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
13 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
14 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
15 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
16 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
17 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
18 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
19 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
20 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
27 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
91 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
127 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
128 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
183 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
184 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
185 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
186 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
187 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 0
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.28
Nodule 0
Rhizoplane 0.63
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 5.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1188869 2162886007 Bacteria 809
2 MBSR1b_contig_9334638 2162886012 Bacteria 1568
3 JGI24741J21665_1022177 3300001915 Bacteria 986
4 JGI24740J21852_10013832 3300001979 Bacteria 2996
5 JGI24739J22299_10067712 3300001989 Bacteria 1115
6 JGI24737J22298_10004484 3300001990 Bacteria 4862
7 JGI24737J22298_10014872 3300001990 Bacteria 2523
8 JGI24735J21928_10000048 3300002067 Bacteria 51228
9 JGI24744J21845_10027442 3300002077 Bacteria 1100
10 JGI25164J39214_1002916 3300002772 Bacteria 2358
11 JGI25165J46597_1000634 3300003214 Bacteria 29066
12 rootH1_10065003 3300003316 Bacteria 7491
13 rootH1_10079750 3300003316 Bacteria 4100
14 rootH1_10079750 3300003323 Bacteria 1538
15 rootH2_10016199 3300003320 Bacteria 99895
16 rootH1_10024899 3300003323 Bacteria 34477
17 rootH1_10090188 3300003323 Bacteria 4386
18 rootH1_10316821 3300003323 Bacteria 1079
19 Ga0065714_10187910 3300005288 Bacteria 933
20 Ga0065714_10212259 3300005288 Bacteria 863
21 Ga0065714_10270957 3300005288 Bacteria 739
22 Ga0065714_10304567 3300005288 Bacteria 683
23 Ga0065715_10001465 3300005293 Bacteria 7524
24 Ga0070658_10000019 3300005327 Bacteria 194742
25 Ga0070658_10133912 3300005327 Bacteria 2067
26 Ga0070658_10591672 3300005327 Bacteria 961
27 Ga0070676_10015810 3300005328 Bacteria 4163
28 Ga0068869_100441684 3300005334 Bacteria 1077
29 Ga0070680_100025882 3300005336 Bacteria 4691
30 Ga0068868_100116656 3300005338 Bacteria 2174
31 Ga0068868_100302633 3300005338 Bacteria 1358
32 Ga0070660_100069803 3300005339 Bacteria 2741
33 Ga0070689_100123590 3300005340 Bacteria 2069
34 Ga0070671_100010818 3300005355 Bacteria 7322
35 Ga0070673_100003609 3300005364 Bacteria 9677
36 Ga0070688_100018422 3300005365 Bacteria 4029
37 Ga0070659_100000318 3300005366 Bacteria 37333
38 Ga0070659_100071792 3300005366 Bacteria 2754
39 Ga0070659_100970635 3300005366 Bacteria 745
40 Ga0070663_100158156 3300005455 Bacteria 1743
41 Ga0070678_100001108 3300005456 Bacteria 14126
42 Ga0070678_100735395 3300005456 Bacteria 891
43 Ga0070662_100003334 3300005457 Bacteria 10015
44 Ga0070681_10128556 3300005458 Bacteria 2466
45 Ga0068867_100000136 3300005459 Bacteria 47486
46 Ga0070685_10038676 3300005466 Unclassified 2706
47 Ga0070679_100376983 3300005530 Bacteria 1365
48 Ga0070693_100724438 3300005547 Unclassified 730
49 Ga0070665_100000003 3300005548 Bacteria 811857
50 Ga0068855_100000073 3300005563 Bacteria 121126
51 Ga0068855_100029344 3300005563 Bacteria 6577
52 Ga0068855_100033475 3300005563 Bacteria 6133
53 Ga0068855_100867235 3300005563 Bacteria 956
54 Ga0068857_101556954 3300005577 Bacteria 645
55 Ga0068856_100002043 3300005614 Bacteria 20938
56 Ga0068856_100177980 3300005614 Bacteria 2139
57 Ga0068856_100900389 3300005614 Bacteria 904
58 Ga0068866_10090430 3300005718 Bacteria 1666
59 Ga0081539_10026827 3300005985 Bacteria 3662
60 Ga0075366_10000412 3300006195 Bacteria 19976
61 Ga0075366_10000734 3300006195 Bacteria 15602
62 Ga0075366_10204482 3300006195 Bacteria 1201
63 Ga0075366_10242164 3300006195 Bacteria 1099
64 Ga0097621_100000417 3300006237 Bacteria 29675
65 Ga0097621_100910410 3300006237 Bacteria 820
66 Ga0068871_100000652 3300006358 Bacteria 23848
67 Ga0068865_100000067 3300006881 Bacteria 54449
68 Ga0105240_10000722 3300009093 Bacteria 60400
69 Ga0105240_10025869 3300009093 Bacteria 7706
70 Ga0105240_10138150 3300009093 Bacteria 2916
71 Ga0105240_10447504 3300009093 Bacteria 1446
72 Ga0105240_11207653 3300009093 Bacteria 801
73 Ga0105240_11210215 3300009093 Bacteria 800
74 Ga0105240_11222486 3300009093 Bacteria 795
75 Ga0105240_11521599 3300009093 Bacteria 701
76 Ga0111539_11499533 3300009094 Unclassified 782
77 Ga0105245_10895072 3300009098 Bacteria 929
78 Ga0105243_10577240 3300009148 Bacteria 1079
79 Ga0105241_10003437 3300009174 Bacteria 11784
80 Ga0105241_10031778 3300009174 Bacteria 3953
81 Ga0105241_10365964 3300009174 Bacteria 1256
82 Ga0105241_10401112 3300009174 Unclassified 1203
83 Ga0105242_10296591 3300009176 Bacteria 1474
84 Ga0105242_11085934 3300009176 Bacteria 813
85 Ga0105237_10003926 3300009545 Bacteria 17413
86 Ga0105237_10014131 3300009545 Bacteria 8355
87 Ga0105237_10068896 3300009545 Bacteria 3532
88 Ga0105237_10200737 3300009545 Bacteria 1994
89 Ga0105237_10485119 3300009545 Bacteria 1242
90 Ga0105237_10786022 3300009545 Bacteria 958
91 Ga0105238_10587989 3300009551 Bacteria 1120
92 Ga0105249_10164263 3300009553 Bacteria 2148
93 Ga0105239_10002733 3300010375 Bacteria 22146
94 Ga0105239_10003420 3300010375 Bacteria 19460
95 Ga0105239_10008214 3300010375 Bacteria 11907
96 Ga0105239_10018512 3300010375 Bacteria 7694
97 Ga0105239_11340796 3300010375 Bacteria 826
98 Ga0105239_11454498 3300010375 Bacteria 792
99 Ga0105246_10987957 3300011119 Bacteria 761
100 Ga0157373_10008356 3300013100 Bacteria 7692
101 Ga0157373_10136071 3300013100 Bacteria 1727
102 Ga0157371_10016011 3300013102 Bacteria 5608
103 Ga0157371_10028342 3300013102 Bacteria 4056
104 Ga0157370_10132965 3300013104 Bacteria 2320
105 Ga0157369_10002019 3300013105 Bacteria 24475
106 Ga0157369_10059760 3300013105 Bacteria 4111
107 Ga0157374_10004282 3300013296 Bacteria 12005
108 Ga0157374_10005007 3300013296 Bacteria 11119
109 Ga0157374_11960924 3300013296 Bacteria 612
110 Ga0157378_10046788 3300013297 Bacteria 3845
111 Ga0157378_10161560 3300013297 Bacteria 2095
112 Ga0157378_10856707 3300013297 Bacteria 937
113 Ga0163162_10000024 3300013306 Bacteria 188515
114 Ga0163162_10075688 3300013306 Bacteria 3427
115 Ga0163162_10325429 3300013306 Bacteria 1670
116 Ga0163162_10470899 3300013306 Bacteria 1388
117 Ga0163162_11035042 3300013306 Bacteria 929
118 Ga0157372_10000011 3300013307 Bacteria 277202
119 Ga0157372_10000120 3300013307 Bacteria 83586
120 Ga0157372_10155132 3300013307 Bacteria 2644
121 Ga0157375_10011675 3300013308 Bacteria 7760
122 Ga0157375_10021080 3300013308 Bacteria 5968
123 Ga0157375_11277433 3300013308 Bacteria 862
124 Ga0157375_11590406 3300013308 Bacteria 773
125 Ga0157375_12535185 3300013308 Bacteria 612
126 Ga0163163_10070875 3300014325 Bacteria 3472
127 Ga0157380_10000013 3300014326 Bacteria 131248
128 Ga0157377_10287001 3300014745 Bacteria 1081
129 Ga0157376_10799429 3300014969 Bacteria 956
130 Ga0157376_10912311 3300014969 Unclassified 897
131 Ga0163161_10004625 3300017792 Bacteria 9579
132 Ga0163161_10472964 3300017792 Bacteria 1016
133 Ga0213872_10002791 3300021361 Bacteria 9992
134 Ga0207427_100103 3300025231 Bacteria 119618
135 Ga0209437_100024 3300025233 Bacteria 592878
136 Ga0209437_100101 3300025233 Bacteria 226668
137 Ga0209026_1002297 3300025250 Bacteria 7298
138 Ga0209026_1003770 3300025250 Bacteria 4806
139 Ga0209233_1000124 3300025261 Bacteria 226743
140 Ga0209233_1040806 3300025261 Bacteria 1007
141 Ga0207642_10449539 3300025899 Bacteria 780
142 Ga0207647_10000051 3300025904 Bacteria 87826
143 Ga0207647_10340736 3300025904 Bacteria 850
144 Ga0207645_10000067 3300025907 Bacteria 75648
145 Ga0207705_10000069 3300025909 Bacteria 133094
146 Ga0207705_10428125 3300025909 Unclassified 1025
147 Ga0207654_10001814 3300025911 Bacteria 11090
148 Ga0207654_10099320 3300025911 Bacteria 1790
149 Ga0207654_10561857 3300025911 Bacteria 811
150 Ga0207707_10357400 3300025912 Bacteria 1258
151 Ga0207695_10000013 3300025913 Bacteria 821265
152 Ga0207695_10011550 3300025913 Bacteria 10683
153 Ga0207695_10060404 3300025913 Bacteria 3924
154 Ga0207695_10150646 3300025913 Bacteria 2265
155 Ga0207695_10470538 3300025913 Unclassified 1139
156 Ga0207671_10002970 3300025914 Bacteria 17427
157 Ga0207671_10006604 3300025914 Bacteria 10296
158 Ga0207671_10006942 3300025914 Bacteria 9965
159 Ga0207671_10026152 3300025914 Bacteria 4377
160 Ga0207671_10052166 3300025914 Bacteria 3031
161 Ga0207671_10103843 3300025914 Bacteria 2155
162 Ga0207671_10117347 3300025914 Bacteria 2031
163 Ga0207671_10707095 3300025914 Bacteria 801
164 Ga0207660_10018467 3300025917 Bacteria 4649
165 Ga0207657_10145850 3300025919 Bacteria 1931
166 Ga0207657_10180484 3300025919 Bacteria 1706
167 Ga0207652_10472007 3300025921 Bacteria 1130
168 Ga0207694_10290223 3300025924 Bacteria 1345
169 Ga0207687_10315866 3300025927 Bacteria 1263
170 Ga0207644_10030977 3300025931 Bacteria 3725
171 Ga0207690_10000318 3300025932 Bacteria 32496
172 Ga0207690_10032498 3300025932 Bacteria 3349
173 Ga0207706_10005473 3300025933 Bacteria 11839
174 Ga0207686_10033664 3300025934 Bacteria 3061
175 Ga0207709_10000072 3300025935 Bacteria 178084
176 Ga0207704_10000056 3300025938 Bacteria 78848
177 Ga0207689_10494143 3300025942 Bacteria 1025
178 Ga0207689_11113221 3300025942 Unclassified 665
179 Ga0207667_10000009 3300025949 Bacteria 603135
180 Ga0207667_10119301 3300025949 Bacteria 2718
181 Ga0207667_10226997 3300025949 Bacteria 1913
182 Ga0207667_11106596 3300025949 Bacteria 775
183 Ga0207651_10001950 3300025960 Bacteria 9699
184 Ga0207640_10782380 3300025981 Bacteria 825
185 Ga0207677_10290141 3300026023 Bacteria 1347
186 Ga0207639_10054265 3300026041 Bacteria 3063
187 Ga0207678_10084955 3300026067 Bacteria 2706
188 Ga0207702_10007304 3300026078 Bacteria 9444
189 Ga0207702_10034522 3300026078 Bacteria 4229
190 Ga0207702_10868195 3300026078 Bacteria 893
191 Ga0207648_10001841 3300026089 Bacteria 23201
192 Ga0207674_10774592 3300026116 Bacteria 926
193 Ga0207683_10080942 3300026121 Bacteria 2882
194 Ga0207698_10010379 3300026142 Bacteria 5979
195 Ga0207698_10064543 3300026142 Unclassified 2871
196 Ga0268266_10000137 3300028379 Bacteria 140685
197 Ga0307517_10002507 3300028786 Bacteria 29365
198 Ga0307515_10002439 3300028794 Bacteria 40495
199 Ga0307515_10003653 3300028794 Bacteria 32336
200 Ga0316177_1055273 3300030731 Bacteria 1491
201 Ga0316176_1019983 3300030732 Bacteria 5317
202 Ga0316183_1205599 3300030742 Bacteria 27167
203 Ga0316181_1039405 3300030744 Bacteria 12554
204 Ga0316182_1024000 3300030745 Bacteria 1428
205 Ga0307408_100029239 3300031548 Bacteria 3815
206 Ga0307408_100080471 3300031548 Bacteria 2433
207 Ga0307405_10002409 3300031731 Bacteria 8233
208 Ga0307412_10035273 3300031911 Bacteria 3194
209 Ga0307412_10436139 3300031911 Bacteria 1075
210 Ga0307414_10043731 3300032004 Bacteria 3053
211 Ga0307414_10054520 3300032004 Bacteria 2794
212 Ga0307414_10069401 3300032004 Bacteria 2534
213 Ga0307414_10391278 3300032004 Bacteria 1205
214 Ga0307414_10788202 3300032004 Bacteria 866
215 Ga0307411_10394012 3300032005 Bacteria 1143
216 Ga0373941_0006217 3300035115 Bacteria 2865
217 Ga0395899_0000001 3300037312 Bacteria 1750322
218 Ga0395899_0000547 3300037312 Bacteria 40664
219 Ga0395899_0000796 3300037312 Bacteria 30874
220 Ga0395899_0115654 3300037312 Bacteria 1925
221 Ga0395900_0000014 3300037418 Bacteria 386513
222 Ga0395900_0001002 3300037418 Bacteria 36638
223 Ga0395900_0124670 3300037418 Bacteria 2642
224 Ga0395898_0012314 3300037466 Bacteria 8844
225 Ga0395905_0000520 3300037471 Bacteria 52744
226 Ga0395905_0001097 3300037471 Bacteria 34059
227 Ga0395901_0000523 3300038443 Bacteria 44364
228 Ga0395901_0009717 3300038443 Bacteria 9754
229 Ga0395901_0846890 3300038443 Bacteria 900
230 Ga0436361_0504524 3300039447 Bacteria 10480
231 Ga0451807_2269413 3300041486 Bacteria 709
232 Ga0439455_0041786 3300042012 Bacteria 1176
233 Ga0466961_0257991 3300044693 Bacteria 1069
234 Ga0466959_0082308 3300045049 Bacteria 2319
235 Ga0495629_0399103 3300046459 Bacteria 935
236 Ga0495638_0209765 3300046460 Bacteria 1095
237 Ga0495650_0000036 3300046471 Bacteria 400633
238 Ga0495650_0132076 3300046471 Bacteria 910
239 Ga0495605_0325680 3300046474 Bacteria 647
240 Ga0495585_0000246 3300046492 Bacteria 56090
241 Ga0495585_0022158 3300046492 Bacteria 3647
242 Ga0495607_0347694 3300046501 Bacteria 685
243 Ga0495583_0023996 3300046506 Bacteria 3074
244 Ga0495606_0012256 3300046507 Bacteria 6896
245 Ga0495606_0085517 3300046507 Bacteria 1951
246 Ga0495606_0087171 3300046507 Bacteria 1928
247 Ga0495606_0127472 3300046507 Bacteria 1516
248 Ga0495610_0000757 3300046512 Bacteria 30503
249 Ga0495616_0009964 3300046513 Bacteria 5524
250 Ga0495616_0013313 3300046513 Bacteria 4644
251 Ga0495631_0022740 3300046518 Bacteria 2914
252 Ga0495648_0000390 3300046524 Bacteria 48133
253 Ga0495648_0017135 3300046524 Bacteria 5191
254 Ga0495652_0329165 3300046529 Bacteria 1101
255 Ga0495609_0001678 3300046538 Bacteria 14363
256 Ga0495622_0221340 3300046557 Bacteria 838
257 Ga0495633_0000233 3300046558 Bacteria 67958
258 Ga0495633_0021672 3300046558 Bacteria 3210
259 Ga0495668_0000044 3300046616 Bacteria 227585
260 Ga0495611_0066164 3300046648 Bacteria 1648
261 Ga0495625_0000379 3300046660 Bacteria 67828
262 Ga0495625_0000772 3300046660 Bacteria 44536
263 Ga0495625_0201999 3300046660 Bacteria 1311
264 Ga0495625_0248403 3300046660 Bacteria 1155
265 Ga0495625_0378725 3300046660 Bacteria 888
266 Ga0495625_0423070 3300046660 Bacteria 828
267 Ga0495661_0000702 3300046665 Bacteria 33210
268 Ga0495661_0004466 3300046665 Bacteria 10092
269 Ga0495661_0198161 3300046665 Bacteria 1053
270 Ga0495588_0179797 3300046674 Bacteria 1118
271 Ga0495669_0326199 3300046684 Bacteria 741
272 Ga0495671_0080669 3300046692 Bacteria 1594
273 Ga0495649_0000010 3300046694 Bacteria 430552
274 Ga0495660_0133610 3300046810 Bacteria 1242
275 Ga0495660_0198619 3300046810 Bacteria 959
276 Ga0495687_015735 3300047443 Bacteria 3834
277 Ga0495687_020751 3300047443 Bacteria 3197
278 Ga0495687_111079 3300047443 Bacteria 1007
279 Ga0495673_0030372 3300047469 Bacteria 2538
280 Ga0495686_0000196 3300047472 Bacteria 112875
281 Ga0495686_0004135 3300047472 Bacteria 12083
282 Ga0495686_0150715 3300047472 Bacteria 1365
283 Ga0495686_0217365 3300047472 Unclassified 1089
284 Ga0495614_0016639 3300048089 Bacteria 3199
285 Ga0495678_026790 3300049459 Bacteria 2454
286 Ga0501223_000747 3300049663 Bacteria 7734
287 Ga0501280_055304 3300049776 Bacteria 677
288 nmdc:mga0k408_222757_c1 3300050493 Bacteria 1126
289 nmdc:mga0k408_223170_c1 3300050493 Bacteria 1125
290 nmdc:mga0k408_234_c1 3300050493 Bacteria 29698
291 nmdc:mga0k408_605_c2 3300050493 Bacteria 15618
292 Ga0500635_0001826 3300053080 Bacteria 5200
293 Ga0500608_000318 3300053122 Bacteria 18520
294 Ga0500608_001848 3300053122 Bacteria 7546
295 Ga0500614_068677 3300053123 Bacteria 968
296 Ga0500642_0164318 3300053130 Bacteria 1040
297 Ga0500619_155094 3300053154 Bacteria 778
298 Ga0500624_001454 3300053157 Bacteria 3804
299 Ga0500636_0257819 3300053177 Bacteria 885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0378725 Ga0495625_0378725_18_461 147
2 3300006195 Ga0075366_10204482 Ga0075366_102044822 148
3 3300031731 Ga0307405_10002409 Ga0307405_100024099 148
4 3300031911 Ga0307412_10436139 Ga0307412_104361393 148
5 3300049663 Ga0501223_000747 Ga0501223_000747_1327_1821 148
6 3300050493 nmdc:mga0k408_222757_c1 nmdc:mga0k408_222757_c1_137_622 148
7 iso_pu_bacteria 2911138879 2911139021 149
8 3300046471 Ga0495650_0132076 Ga0495650_0132076_311_763 150
9 3300026142 Ga0207698_10064543 Ga0207698_100645432 152
10 3300014326 Ga0157380_10000013 Ga0157380_1000001356 153
11 iso_pu_bacteria 2902048731 2902051727 154
12 3300014969 Ga0157376_10799429 Ga0157376_107994291 155
13 3300009174 Ga0105241_10401112 Ga0105241_104011121 156
14 iso_pu_bacteria 2599185184 2599481003 156
15 iso_pu_bacteria 2852623160 2852623877 156
16 iso_pu_bacteria 2884933994 2884937219 156
17 iso_pu_bacteria 2896317667 2896318097 156
18 iso_pu_bacteria 2919437846 2919438395 156
19 iso_pu_bacteria 2928078545 2928080915 156
20 iso_pu_bacteria 2928147474 2928150178 156
21 iso_pu_bacteria 2932082852 2932088256 156
22 iso_pu_bacteria 2977232053 2977232743 156
23 iso_pu_bacteria 3003233435 3003234074 156
24 3300037312 Ga0395899_0000001 Ga0395899_0000001_1442839_1443318 157
25 iso_pu_bacteria 2738541284 2738760557 157
26 iso_pu_bacteria 2738543023 2739300643 157
27 iso_pu_bacteria 2842903701 2842908397 157
28 3300005339 Ga0070660_100069803 Ga0070660_1000698034 158
29 3300005340 Ga0070689_100123590 Ga0070689_1001235901 158
30 3300005365 Ga0070688_100018422 Ga0070688_1000184222 158
31 3300005466 Ga0070685_10038676 Ga0070685_100386763 158
32 3300005547 Ga0070693_100724438 Ga0070693_1007244381 158
33 3300005563 Ga0068855_100000073 Ga0068855_100000073114 158
34 3300005985 Ga0081539_10026827 Ga0081539_100268272 158
35 3300009545 Ga0105237_10200737 Ga0105237_102007372 158
36 3300013100 Ga0157373_10008356 Ga0157373_100083561 158
37 3300017792 Ga0163161_10004625 Ga0163161_100046253 158
38 3300025914 Ga0207671_10103843 Ga0207671_101038432 158
39 3300025919 Ga0207657_10180484 Ga0207657_101804842 158
40 3300025949 Ga0207667_11106596 Ga0207667_111065962 158
41 3300031548 Ga0307408_100029239 Ga0307408_1000292398 158
42 3300031548 Ga0307408_100080471 Ga0307408_1000804718 158
43 3300031911 Ga0307412_10035273 Ga0307412_100352732 158
44 3300035115 Ga0373941_0006217 Ga0373941_0006217_1243_1725 158
45 iso_pu_bacteria 2904780799 2904783902 158
46 iso_pu_bacteria 2919177583 2919181840 158
47 iso_pu_bacteria 8055588893 8055589206 158
48 3300005614 Ga0068856_100002043 Ga0068856_1000020436 159
49 3300009094 Ga0111539_11499533 Ga0111539_114995332 159
50 3300013296 Ga0157374_11960924 Ga0157374_119609241 159
51 3300013297 Ga0157378_10856707 Ga0157378_108567072 159
52 3300014325 Ga0163163_10070875 Ga0163163_100708755 159
53 3300025914 Ga0207671_10006942 Ga0207671_100069429 159
54 3300025949 Ga0207667_10000009 Ga0207667_10000009252 159
55 3300026078 Ga0207702_10007304 Ga0207702_100073046 159
56 3300037418 Ga0395900_0124670 Ga0395900_0124670_1837_2328 159
57 3300038443 Ga0395901_0846890 Ga0395901_0846890_141_632 159
58 3300045049 Ga0466959_0082308 Ga0466959_0082308_1764_2243 159
59 3300053130 Ga0500642_0164318 Ga0500642_0164318_102_584 159
60 2162886012 MBSR1b_contig_9334638 MBSR1b_0085.00006870 160
61 3300001915 JGI24741J21665_1022177 JGI24741J21665_10221771 160
62 3300001979 JGI24740J21852_10013832 JGI24740J21852_100138322 160
63 3300001989 JGI24739J22299_10067712 JGI24739J22299_100677122 160
64 3300001990 JGI24737J22298_10004484 JGI24737J22298_100044842 160
65 3300001990 JGI24737J22298_10014872 JGI24737J22298_100148722 160
66 3300002067 JGI24735J21928_10000048 JGI24735J21928_1000004832 160
67 3300002077 JGI24744J21845_10027442 JGI24744J21845_100274422 160
68 3300002772 JGI25164J39214_1002916 JGI25164J39214_10029162 160
69 3300003214 JGI25165J46597_1000634 JGI25165J46597_100063417 160
70 3300003316 rootH1_10065003 rootH1_100650033 160
71 3300003316 rootH1_10079750 rootH1_100797502 160
72 3300003320 rootH2_10016199 rootH2_100161991 160
73 3300003323 rootH1_10024899 rootH1_100248992 160
74 3300003323 rootH1_10090188 rootH1_100901882 160
75 3300003323 rootH1_10316821 rootH1_103168212 160
76 3300005288 Ga0065714_10187910 Ga0065714_101879102 160
77 3300005288 Ga0065714_10212259 Ga0065714_102122592 160
78 3300005288 Ga0065714_10270957 Ga0065714_102709572 160
79 3300005288 Ga0065714_10304567 Ga0065714_103045672 160
80 3300005293 Ga0065715_10001465 Ga0065715_100014656 160
81 3300005327 Ga0070658_10000019 Ga0070658_100000192 160
82 3300005327 Ga0070658_10133912 Ga0070658_101339122 160
83 3300005327 Ga0070658_10591672 Ga0070658_105916722 160
84 3300005328 Ga0070676_10015810 Ga0070676_100158103 160
85 3300005334 Ga0068869_100441684 Ga0068869_1004416841 160
86 3300005336 Ga0070680_100025882 Ga0070680_1000258825 160
87 3300005338 Ga0068868_100116656 Ga0068868_1001166561 160
88 3300005355 Ga0070671_100010818 Ga0070671_1000108185 160
89 3300005364 Ga0070673_100003609 Ga0070673_1000036097 160
90 3300005366 Ga0070659_100000318 Ga0070659_10000031828 160
91 3300005366 Ga0070659_100970635 Ga0070659_1009706351 160
92 3300005455 Ga0070663_100158156 Ga0070663_1001581561 160
93 3300005456 Ga0070678_100001108 Ga0070678_10000110813 160
94 3300005456 Ga0070678_100735395 Ga0070678_1007353952 160
95 3300005458 Ga0070681_10128556 Ga0070681_101285562 160
96 3300005459 Ga0068867_100000136 Ga0068867_1000001362 160
97 3300005530 Ga0070679_100376983 Ga0070679_1003769832 160
98 3300005548 Ga0070665_100000003 Ga0070665_10000000330 160
99 3300005563 Ga0068855_100029344 Ga0068855_1000293448 160
100 3300005563 Ga0068855_100033475 Ga0068855_1000334753 160
101 3300005563 Ga0068855_100867235 Ga0068855_1008672352 160
102 3300005577 Ga0068857_101556954 Ga0068857_1015569541 160
103 3300005614 Ga0068856_100177980 Ga0068856_1001779802 160
104 3300005718 Ga0068866_10090430 Ga0068866_100904302 160
105 3300006195 Ga0075366_10000412 Ga0075366_1000041215 160
106 3300006195 Ga0075366_10000734 Ga0075366_1000073415 160
107 3300006195 Ga0075366_10242164 Ga0075366_102421642 160
108 3300006237 Ga0097621_100000417 Ga0097621_10000041720 160
109 3300006358 Ga0068871_100000652 Ga0068871_10000065213 160
110 3300006881 Ga0068865_100000067 Ga0068865_10000006717 160
111 3300009093 Ga0105240_10000722 Ga0105240_100007228 160
112 3300009093 Ga0105240_10025869 Ga0105240_100258697 160
113 3300009093 Ga0105240_10447504 Ga0105240_104475041 160
114 3300009093 Ga0105240_11207653 Ga0105240_112076531 160
115 3300009093 Ga0105240_11210215 Ga0105240_112102151 160
116 3300009093 Ga0105240_11222486 Ga0105240_112224862 160
117 3300009098 Ga0105245_10895072 Ga0105245_108950721 160
118 3300009148 Ga0105243_10577240 Ga0105243_105772402 160
119 3300009174 Ga0105241_10031778 Ga0105241_100317782 160
120 3300009174 Ga0105241_10365964 Ga0105241_103659641 160
121 3300009176 Ga0105242_11085934 Ga0105242_110859342 160
122 3300009545 Ga0105237_10003926 Ga0105237_1000392624 160
123 3300009545 Ga0105237_10014131 Ga0105237_100141316 160
124 3300009545 Ga0105237_10068896 Ga0105237_100688962 160
125 3300009545 Ga0105237_10485119 Ga0105237_104851191 160
126 3300009545 Ga0105237_10786022 Ga0105237_107860222 160
127 3300009551 Ga0105238_10587989 Ga0105238_105879894 160
128 3300009553 Ga0105249_10164263 Ga0105249_101642632 160
129 3300010375 Ga0105239_10002733 Ga0105239_1000273318 160
130 3300010375 Ga0105239_10003420 Ga0105239_100034202 160
131 3300010375 Ga0105239_10008214 Ga0105239_100082141 160
132 3300010375 Ga0105239_10018512 Ga0105239_100185122 160
133 3300010375 Ga0105239_11340796 Ga0105239_113407962 160
134 3300010375 Ga0105239_11454498 Ga0105239_114544981 160
135 3300011119 Ga0105246_10987957 Ga0105246_109879572 160
136 3300013102 Ga0157371_10016011 Ga0157371_100160112 160
137 3300013102 Ga0157371_10028342 Ga0157371_100283422 160
138 3300013104 Ga0157370_10132965 Ga0157370_101329652 160
139 3300013105 Ga0157369_10002019 Ga0157369_100020194 160
140 3300013105 Ga0157369_10059760 Ga0157369_100597602 160
141 3300013296 Ga0157374_10005007 Ga0157374_100050072 160
142 3300013297 Ga0157378_10046788 Ga0157378_100467884 160
143 3300013297 Ga0157378_10161560 Ga0157378_101615601 160
144 3300013306 Ga0163162_10000024 Ga0163162_100000245 160
145 3300013306 Ga0163162_10075688 Ga0163162_100756886 160
146 3300013306 Ga0163162_10325429 Ga0163162_103254293 160
147 3300013306 Ga0163162_10470899 Ga0163162_104708992 160
148 3300013306 Ga0163162_11035042 Ga0163162_110350422 160
149 3300013307 Ga0157372_10000011 Ga0157372_10000011104 160
150 3300013307 Ga0157372_10000120 Ga0157372_1000012058 160
151 3300013308 Ga0157375_10011675 Ga0157375_100116757 160
152 3300013308 Ga0157375_10021080 Ga0157375_100210805 160
153 3300013308 Ga0157375_11277433 Ga0157375_112774332 160
154 3300013308 Ga0157375_11590406 Ga0157375_115904061 160
155 3300014969 Ga0157376_10912311 Ga0157376_109123112 160
156 3300017792 Ga0163161_10472964 Ga0163161_104729642 160
157 3300021361 Ga0213872_10002791 Ga0213872_100027916 160
158 3300025231 Ga0207427_100103 Ga0207427_100103122 160
159 3300025233 Ga0209437_100024 Ga0209437_10002435 160
160 3300025233 Ga0209437_100101 Ga0209437_100101143 160
161 3300025250 Ga0209026_1002297 Ga0209026_10022975 160
162 3300025250 Ga0209026_1003770 Ga0209026_10037707 160
163 3300025261 Ga0209233_1000124 Ga0209233_100012494 160
164 3300025261 Ga0209233_1040806 Ga0209233_10408061 160
165 3300025899 Ga0207642_10449539 Ga0207642_104495392 160
166 3300025904 Ga0207647_10340736 Ga0207647_103407362 160
167 3300025907 Ga0207645_10000067 Ga0207645_1000006726 160
168 3300025909 Ga0207705_10000069 Ga0207705_100000692 160
169 3300025909 Ga0207705_10428125 Ga0207705_104281252 160
170 3300025911 Ga0207654_10099320 Ga0207654_100993202 160
171 3300025911 Ga0207654_10561857 Ga0207654_105618572 160
172 3300025912 Ga0207707_10357400 Ga0207707_103574002 160
173 3300025913 Ga0207695_10000013 Ga0207695_10000013156 160
174 3300025913 Ga0207695_10011550 Ga0207695_100115504 160
175 3300025913 Ga0207695_10150646 Ga0207695_101506463 160
176 3300025913 Ga0207695_10470538 Ga0207695_104705382 160
177 3300025914 Ga0207671_10002970 Ga0207671_1000297025 160
178 3300025914 Ga0207671_10006604 Ga0207671_100066046 160
179 3300025914 Ga0207671_10026152 Ga0207671_100261523 160
180 3300025914 Ga0207671_10052166 Ga0207671_100521662 160
181 3300025914 Ga0207671_10117347 Ga0207671_101173472 160
182 3300025914 Ga0207671_10707095 Ga0207671_107070951 160
183 3300025917 Ga0207660_10018467 Ga0207660_100184671 160
184 3300025919 Ga0207657_10145850 Ga0207657_101458502 160
185 3300025921 Ga0207652_10472007 Ga0207652_104720071 160
186 3300025924 Ga0207694_10290223 Ga0207694_102902232 160
187 3300025927 Ga0207687_10315866 Ga0207687_103158662 160
188 3300025931 Ga0207644_10030977 Ga0207644_100309772 160
189 3300025932 Ga0207690_10000318 Ga0207690_1000031818 160
190 3300025934 Ga0207686_10033664 Ga0207686_100336642 160
191 3300025938 Ga0207704_10000056 Ga0207704_1000005631 160
192 3300025942 Ga0207689_10494143 Ga0207689_104941432 160
193 3300025942 Ga0207689_11113221 Ga0207689_111132211 160
194 3300025949 Ga0207667_10119301 Ga0207667_101193015 160
195 3300025949 Ga0207667_10226997 Ga0207667_102269972 160
196 3300025960 Ga0207651_10001950 Ga0207651_100019507 160
197 3300025981 Ga0207640_10782380 Ga0207640_107823801 160
198 3300026041 Ga0207639_10054265 Ga0207639_100542652 160
199 3300026067 Ga0207678_10084955 Ga0207678_100849555 160
200 3300026078 Ga0207702_10034522 Ga0207702_100345222 160
201 3300026089 Ga0207648_10001841 Ga0207648_100018413 160
202 3300026116 Ga0207674_10774592 Ga0207674_107745922 160
203 3300026121 Ga0207683_10080942 Ga0207683_100809422 160
204 3300026142 Ga0207698_10010379 Ga0207698_100103795 160
205 3300028379 Ga0268266_10000137 Ga0268266_1000013729 160
206 3300028786 Ga0307517_10002507 Ga0307517_1000250722 160
207 3300028794 Ga0307515_10002439 Ga0307515_1000243917 160
208 3300028794 Ga0307515_10003653 Ga0307515_1000365329 160
209 3300030731 Ga0316177_1055273 Ga0316177_10552733 160
210 3300030732 Ga0316176_1019983 Ga0316176_10199835 160
211 3300030742 Ga0316183_1205599 Ga0316183_12055999 160
212 3300030744 Ga0316181_1039405 Ga0316181_10394055 160
213 3300030745 Ga0316182_1024000 Ga0316182_10240002 160
214 3300032004 Ga0307414_10043731 Ga0307414_100437312 160
215 3300032004 Ga0307414_10054520 Ga0307414_100545205 160
216 3300032004 Ga0307414_10391278 Ga0307414_103912784 160
217 3300032004 Ga0307414_10788202 Ga0307414_107882022 160
218 3300032005 Ga0307411_10394012 Ga0307411_103940122 160
219 3300037312 Ga0395899_0000547 Ga0395899_0000547_32130_32612 160
220 3300037312 Ga0395899_0000796 Ga0395899_0000796_8332_8817 160
221 3300037312 Ga0395899_0115654 Ga0395899_0115654_1035_1517 160
222 3300037418 Ga0395900_0000014 Ga0395900_0000014_375260_375742 160
223 3300037466 Ga0395898_0012314 Ga0395898_0012314_7982_8464 160
224 3300037471 Ga0395905_0000520 Ga0395905_0000520_26204_26686 160
225 3300037471 Ga0395905_0001097 Ga0395905_0001097_6093_6575 160
226 3300038443 Ga0395901_0000523 Ga0395901_0000523_24076_24558 160
227 3300038443 Ga0395901_0009717 Ga0395901_0009717_6613_7095 160
228 3300039447 Ga0436361_0504524 Ga0436361_0504524_3306_3788 160
229 3300041486 Ga0451807_2269413 Ga0451807_2269413_56_538 160
230 3300042012 Ga0439455_0041786 Ga0439455_0041786_69_551 160
231 3300044693 Ga0466961_0257991 Ga0466961_0257991_313_798 160
232 3300046459 Ga0495629_0399103 Ga0495629_0399103_233_715 160
233 3300046460 Ga0495638_0209765 Ga0495638_0209765_88_570 160
234 3300046471 Ga0495650_0000036 Ga0495650_0000036_341707_342189 160
235 3300046474 Ga0495605_0325680 Ga0495605_0325680_150_632 160
236 3300046492 Ga0495585_0000246 Ga0495585_0000246_44648_45130 160
237 3300046492 Ga0495585_0022158 Ga0495585_0022158_1075_1557 160
238 3300046501 Ga0495607_0347694 Ga0495607_0347694_44_526 160
239 3300046506 Ga0495583_0023996 Ga0495583_0023996_1186_1668 160
240 3300046507 Ga0495606_0012256 Ga0495606_0012256_3124_3606 160
241 3300046507 Ga0495606_0085517 Ga0495606_0085517_1212_1694 160
242 3300046507 Ga0495606_0087171 Ga0495606_0087171_948_1430 160
243 3300046507 Ga0495606_0127472 Ga0495606_0127472_793_1275 160
244 3300046512 Ga0495610_0000757 Ga0495610_0000757_23567_24049 160
245 3300046513 Ga0495616_0009964 Ga0495616_0009964_2501_2983 160
246 3300046513 Ga0495616_0013313 Ga0495616_0013313_1628_2110 160
247 3300046518 Ga0495631_0022740 Ga0495631_0022740_729_1211 160
248 3300046524 Ga0495648_0000390 Ga0495648_0000390_37181_37663 160
249 3300046524 Ga0495648_0017135 Ga0495648_0017135_1907_2389 160
250 3300046529 Ga0495652_0329165 Ga0495652_0329165_169_651 160
251 3300046538 Ga0495609_0001678 Ga0495609_0001678_1116_1598 160
252 3300046557 Ga0495622_0221340 Ga0495622_0221340_233_715 160
253 3300046558 Ga0495633_0000233 Ga0495633_0000233_25939_26421 160
254 3300046558 Ga0495633_0021672 Ga0495633_0021672_465_947 160
255 3300046616 Ga0495668_0000044 Ga0495668_0000044_223586_224068 160
256 3300046648 Ga0495611_0066164 Ga0495611_0066164_236_718 160
257 3300046660 Ga0495625_0000379 Ga0495625_0000379_35456_35938 160
258 3300046660 Ga0495625_0000772 Ga0495625_0000772_7028_7510 160
259 3300046660 Ga0495625_0201999 Ga0495625_0201999_712_1194 160
260 3300046660 Ga0495625_0248403 Ga0495625_0248403_142_624 160
261 3300046660 Ga0495625_0423070 Ga0495625_0423070_215_697 160
262 3300046665 Ga0495661_0000702 Ga0495661_0000702_12542_13024 160
263 3300046665 Ga0495661_0004466 Ga0495661_0004466_4977_5459 160
264 3300046665 Ga0495661_0198161 Ga0495661_0198161_46_528 160
265 3300046674 Ga0495588_0179797 Ga0495588_0179797_127_609 160
266 3300046684 Ga0495669_0326199 Ga0495669_0326199_36_518 160
267 3300046692 Ga0495671_0080669 Ga0495671_0080669_842_1324 160
268 3300046694 Ga0495649_0000010 Ga0495649_0000010_398171_398653 160
269 3300046810 Ga0495660_0133610 Ga0495660_0133610_742_1224 160
270 3300046810 Ga0495660_0198619 Ga0495660_0198619_102_584 160
271 3300047443 Ga0495687_020751 Ga0495687_020751_663_1145 160
272 3300047443 Ga0495687_111079 Ga0495687_111079_491_973 160
273 3300047469 Ga0495673_0030372 Ga0495673_0030372_1495_1977 160
274 3300047472 Ga0495686_0000196 Ga0495686_0000196_60179_60661 160
275 3300047472 Ga0495686_0004135 Ga0495686_0004135_1075_1557 160
276 3300047472 Ga0495686_0150715 Ga0495686_0150715_599_1081 160
277 3300047472 Ga0495686_0217365 Ga0495686_0217365_12_494 160
278 3300048089 Ga0495614_0016639 Ga0495614_0016639_2372_2854 160
279 3300049459 Ga0495678_026790 Ga0495678_026790_322_804 160
280 3300049776 Ga0501280_055304 Ga0501280_055304_89_583 160
281 3300050493 nmdc:mga0k408_223170_c1 nmdc:mga0k408_223170_c1_365_847 160
282 3300050493 nmdc:mga0k408_234_c1 nmdc:mga0k408_234_c1_23547_24029 160
283 3300050493 nmdc:mga0k408_605_c2 nmdc:mga0k408_605_c2_3127_3609 160
284 3300053080 Ga0500635_0001826 Ga0500635_0001826_3315_3797 160
285 3300053122 Ga0500608_000318 Ga0500608_000318_4256_4738 160
286 3300053122 Ga0500608_001848 Ga0500608_001848_1512_1994 160
287 3300053123 Ga0500614_068677 Ga0500614_068677_334_816 160
288 3300053154 Ga0500619_155094 Ga0500619_155094_154_636 160
289 3300053157 Ga0500624_001454 Ga0500624_001454_338_820 160
290 3300053177 Ga0500636_0257819 Ga0500636_0257819_111_593 160
291 2162886007 SwRhRL2b_contig_1188869 SwRhRL2b_0965.00006440 162
292 3300005338 Ga0068868_100302633 Ga0068868_1003026333 162
293 3300005366 Ga0070659_100071792 Ga0070659_1000717924 162
294 3300005457 Ga0070662_100003334 Ga0070662_1000033345 162
295 3300005614 Ga0068856_100900389 Ga0068856_1009003892 162
296 3300006237 Ga0097621_100910410 Ga0097621_1009104102 162
297 3300009093 Ga0105240_10138150 Ga0105240_101381505 162
298 3300009093 Ga0105240_11521599 Ga0105240_115215991 162
299 3300009174 Ga0105241_10003437 Ga0105241_100034372 162
300 3300009176 Ga0105242_10296591 Ga0105242_102965912 162
301 3300013100 Ga0157373_10136071 Ga0157373_101360713 162
302 3300013296 Ga0157374_10004282 Ga0157374_1000428210 162
303 3300013307 Ga0157372_10155132 Ga0157372_101551323 162
304 3300013308 Ga0157375_12535185 Ga0157375_125351851 162
305 3300014745 Ga0157377_10287001 Ga0157377_102870013 162
306 3300025904 Ga0207647_10000051 Ga0207647_1000005191 162
307 3300025911 Ga0207654_10001814 Ga0207654_100018146 162
308 3300025913 Ga0207695_10060404 Ga0207695_100604046 162
309 3300025932 Ga0207690_10032498 Ga0207690_100324984 162
310 3300025933 Ga0207706_10005473 Ga0207706_1000547311 162
311 3300025935 Ga0207709_10000072 Ga0207709_1000007291 162
312 3300026023 Ga0207677_10290141 Ga0207677_102901412 162
313 3300026078 Ga0207702_10868195 Ga0207702_108681952 162
314 3300032004 Ga0307414_10069401 Ga0307414_100694011 162
315 3300037418 Ga0395900_0001002 Ga0395900_0001002_31844_32398 162
316 3300047443 Ga0495687_015735 Ga0495687_015735_2773_3327 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02631

RecX_HTH2

RecX, second three-helix domain

85

126

0.99

PF21982

RecX_HTH1

RecX, first three-helix domain

39

78

0.97

PF21981

RecX_HTH3

RecX, third three-helix domain

131

179

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e3v-assembly1.cif.gz_A crystal structure of recx from lactobacillus salivarius 0.8901 14 159
3d5l-assembly2.cif.gz_B crystal structure of regulatory protein recx 0.8696 17 158
3c1d-assembly3.cif.gz_B x-ray crystal structure of recx 0.8566 14 156
3d5l-assembly1.cif.gz_A crystal structure of regulatory protein recx 0.8519 14 158
3c1d-assembly3.cif.gz_A x-ray crystal structure of recx 0.8495 14 156
ID Description Score Start End Superfamily
3e3vA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9542 63 103 1.10.10.10
3e3vA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9276 14 61 1.10.10.10
af_Q2G2G9_1_107_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9184 14 61 1.10.10.10
3e3vA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9035 113 159 1.10.10.10
3d5lA03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8968 113 158 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y1V3D8-F1-model_v4 Regulatory protein RecX 0.9867 6 159 GO:0005737
GO:0006282
AF-A0A1I3J7S8-F1-model_v4 Regulatory protein RecX 0.9845 16 162 GO:0005737
GO:0006282
AF-A0A389LT78-F1-model_v4 Regulatory protein RecX 0.9841 10 159 GO:0005737
GO:0006282
AF-A0A496L7S1-F1-model_v4 Regulatory protein RecX 0.9812 12 159 GO:0005737
GO:0006282
AF-A0A496C8T8-F1-model_v4 Regulatory protein RecX 0.9809 11 158 GO:0005737
GO:0006282

Feature Viewer

pLDDT pTM Quality
93.48 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map