F403293

General Info

Members Datasets Scaffolds Average Seq Length
315 220 630 144

Family's Representative Sequence

Representative Sequence 3300042012|Ga0439455_0034343|Ga0439455_0034343_113_622
Length 169
Sequence MTITPEAPARPKQTYSYSSDDIKRMLPHRWPMLMIDRAHDVVPGVSGRGVKSVSVNEPFFAGHYPDHSIMPGVMIVEAMAQLVAVVYVAEIIEAPESEAAAGDPSESVGYLGSISSMKFSRLVVPGDQLKLEAKLGQRLGGLRQVSVRASVGNELAAAGSLIVTTGRKA

Samples

Sample ID Description Type Environment
1 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
154 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
192 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
205 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
206 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
207 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
208 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
209 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
210 2818991459 Paenibacillus sp. 597 Isolate Unclassified
211 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
212 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
213 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
214 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
215 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
216 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
217 2952252522 Salinicola sp. DM10 Isolate Unclassified
218 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
219 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
220 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.65
Metatranscriptomes 0.95
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 2.86
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 0.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439455_0034343 3300042012 Bacteria 1276
2 JGI24735J21928_10168855 3300002067 Bacteria 632
3 JGI25151J46595_10029899 3300003187 Bacteria 2149
4 Ga0055541_1000792 3300003841 Bacteria 7875
5 Ga0070658_10005432 3300005327 Bacteria 10338
6 Ga0070658_10048209 3300005327 Bacteria 3448
7 Ga0070658_11343464 3300005327 Bacteria 620
8 Ga0070676_10253790 3300005328 Bacteria 1175
9 Ga0070683_100555521 3300005329 Bacteria 1098
10 Ga0070683_100723267 3300005329 Bacteria 954
11 Ga0070670_100280519 3300005331 Bacteria 1455
12 Ga0070670_100798822 3300005331 Bacteria 852
13 Ga0070670_100838093 3300005331 Bacteria 832
14 Ga0070666_10232742 3300005335 Bacteria 1301
15 Ga0070680_100260030 3300005336 Bacteria 1468
16 Ga0070682_100416508 3300005337 Bacteria 1020
17 Ga0070660_100086496 3300005339 Bacteria 2466
18 Ga0070660_100117913 3300005339 Bacteria 2117
19 Ga0070660_100168899 3300005339 Bacteria 1766
20 Ga0070689_100090210 3300005340 Bacteria 2415
21 Ga0070661_100623405 3300005344 Bacteria 873
22 Ga0070671_100028657 3300005355 Bacteria 4587
23 Ga0070671_100494409 3300005355 Bacteria 1052
24 Ga0070671_100744271 3300005355 Bacteria 852
25 Ga0070674_100023646 3300005356 Bacteria 3980
26 Ga0070674_101079761 3300005356 Bacteria 708
27 Ga0070673_100165637 3300005364 Bacteria 1883
28 Ga0070673_100506207 3300005364 Bacteria 1093
29 Ga0070673_100977112 3300005364 Bacteria 788
30 Ga0070659_100105130 3300005366 Bacteria 2275
31 Ga0070714_100068079 3300005435 Bacteria 3071
32 Ga0070713_100733717 3300005436 Unclassified 944
33 Ga0070713_101917387 3300005436 Bacteria 575
34 Ga0070710_10181111 3300005437 Bacteria 1319
35 Ga0070701_10023824 3300005438 Bacteria 2954
36 Ga0070701_10099145 3300005438 Bacteria 1610
37 Ga0070711_100728574 3300005439 Bacteria 837
38 Ga0070700_100059284 3300005441 Bacteria 2409
39 Ga0070663_100063799 3300005455 Bacteria 2661
40 Ga0070663_100071076 3300005455 Bacteria 2532
41 Ga0070663_101165368 3300005455 Bacteria 676
42 Ga0070678_100171903 3300005456 Bacteria 1766
43 Ga0070678_100193385 3300005456 Bacteria 1674
44 Ga0070662_100542765 3300005457 Bacteria 973
45 Ga0070681_10757438 3300005458 Bacteria 888
46 Ga0068867_100024060 3300005459 Bacteria 4364
47 Ga0070685_10272525 3300005466 Bacteria 1130
48 Ga0070679_100331713 3300005530 Bacteria 1470
49 Ga0070679_100422722 3300005530 Bacteria 1278
50 Ga0070679_100431742 3300005530 Bacteria 1262
51 Ga0070672_100046358 3300005543 Bacteria 3368
52 Ga0070672_100741086 3300005543 Bacteria 862
53 Ga0070672_100747468 3300005543 Bacteria 858
54 Ga0070672_101797529 3300005543 Bacteria 551
55 Ga0070686_100414411 3300005544 Bacteria 1028
56 Ga0070693_100002074 3300005547 Bacteria 9185
57 Ga0070693_100322902 3300005547 Bacteria 1048
58 Ga0070693_101009765 3300005547 Bacteria 630
59 Ga0070665_100000377 3300005548 Bacteria 66234
60 Ga0070665_101071400 3300005548 Bacteria 818
61 Ga0068855_100096807 3300005563 Bacteria 3399
62 Ga0068855_100136574 3300005563 Bacteria 2797
63 Ga0070664_100006962 3300005564 Bacteria 9115
64 Ga0070664_100418712 3300005564 Bacteria 1227
65 Ga0070664_100823451 3300005564 Bacteria 869
66 Ga0068857_100184124 3300005577 Bacteria 1901
67 Ga0068857_100660122 3300005577 Bacteria 991
68 Ga0068857_100740711 3300005577 Bacteria 936
69 Ga0068854_100036791 3300005578 Bacteria 3433
70 Ga0068854_100246336 3300005578 Bacteria 1425
71 Ga0068856_100130246 3300005614 Bacteria 2520
72 Ga0070702_100417259 3300005615 Bacteria 965
73 Ga0068852_100011732 3300005616 Bacteria 6615
74 Ga0068852_100184429 3300005616 Bacteria 1964
75 Ga0068852_100226775 3300005616 Bacteria 1779
76 Ga0068852_100938060 3300005616 Bacteria 883
77 Ga0068852_101347003 3300005616 Bacteria 736
78 Ga0068859_100853166 3300005617 Bacteria 997
79 Ga0068859_101104142 3300005617 Bacteria 872
80 Ga0068864_100533072 3300005618 Bacteria 1133
81 Ga0068866_10697303 3300005718 Bacteria 696
82 Ga0068851_10009998 3300005834 Bacteria 4417
83 Ga0068851_10706850 3300005834 Bacteria 621
84 Ga0068858_100004505 3300005842 Bacteria 13655
85 Ga0070716_100348561 3300006173 Bacteria 1047
86 Ga0070712_100000264 3300006175 Bacteria 29360
87 Ga0097621_100102423 3300006237 Bacteria 2410
88 Ga0097621_100302682 3300006237 Bacteria 1412
89 Ga0068871_100385619 3300006358 Bacteria 1245
90 Ga0068865_100290149 3300006881 Bacteria 1305
91 Ga0075436_100595545 3300006914 Bacteria 814
92 Ga0097620_100853200 3300006931 Bacteria 997
93 Ga0097620_101104554 3300006931 Bacteria 872
94 Ga0105240_10165872 3300009093 Bacteria 2620
95 Ga0111539_10297277 3300009094 Bacteria 1879
96 Ga0105245_10316064 3300009098 Bacteria 1537
97 Ga0105245_12324099 3300009098 Bacteria 590
98 Ga0105242_10002341 3300009176 Bacteria 14952
99 Ga0105242_10093891 3300009176 Bacteria 2530
100 Ga0105242_10316269 3300009176 Bacteria 1430
101 Ga0105248_10072977 3300009177 Bacteria 3857
102 Ga0105248_10453569 3300009177 Bacteria 1445
103 Ga0105238_10068107 3300009551 Bacteria 3560
104 Ga0105238_12720166 3300009551 Bacteria 531
105 Ga0099796_10000164 3300010159 Bacteria 9924
106 Ga0099796_10197445 3300010159 Bacteria 815
107 Ga0105239_11828300 3300010375 Bacteria 704
108 Ga0105239_11918893 3300010375 Bacteria 687
109 Ga0105246_10572878 3300011119 Bacteria 971
110 Ga0157370_11392077 3300013104 Bacteria 631
111 Ga0157369_11034939 3300013105 Bacteria 840
112 Ga0157374_10161658 3300013296 Bacteria 2181
113 Ga0157374_10773727 3300013296 Bacteria 975
114 Ga0163162_10145316 3300013306 Bacteria 2487
115 Ga0157372_12610746 3300013307 Bacteria 580
116 Ga0157375_10663702 3300013308 Bacteria 1198
117 Ga0157379_10010731 3300014968 Bacteria 7983
118 Ga0157379_10041329 3300014968 Bacteria 4117
119 Ga0157379_10261629 3300014968 Bacteria 1572
120 Ga0157376_10028271 3300014969 Bacteria 4456
121 Ga0213872_10000050 3300021361 Bacteria 109093
122 Ga0213872_10022937 3300021361 Bacteria 2871
123 Ga0213872_10194571 3300021361 Bacteria 871
124 Ga0209566_100158 3300025225 Bacteria 76076
125 Ga0209025_1010466 3300025294 Bacteria 6280
126 Ga0207692_10132364 3300025898 Bacteria 1410
127 Ga0207642_10581954 3300025899 Bacteria 695
128 Ga0207699_10143834 3300025906 Bacteria 1570
129 Ga0207699_10486886 3300025906 Bacteria 889
130 Ga0207645_10348821 3300025907 Bacteria 990
131 Ga0207705_10005240 3300025909 Bacteria 9721
132 Ga0207695_10101989 3300025913 Bacteria 2863
133 Ga0207693_10000242 3300025915 Bacteria 50442
134 Ga0207693_10259347 3300025915 Bacteria 1363
135 Ga0207663_10526821 3300025916 Bacteria 921
136 Ga0207663_10718268 3300025916 Bacteria 792
137 Ga0207660_10118308 3300025917 Bacteria 2004
138 Ga0207662_10044345 3300025918 Bacteria 2626
139 Ga0207657_10041454 3300025919 Bacteria 4070
140 Ga0207657_10084929 3300025919 Bacteria 2652
141 Ga0207657_10488370 3300025919 Bacteria 965
142 Ga0207649_10077798 3300025920 Bacteria 2139
143 Ga0207649_11136040 3300025920 Bacteria 617
144 Ga0207652_10113044 3300025921 Bacteria 2410
145 Ga0207652_10303213 3300025921 Bacteria 1442
146 Ga0207650_10060578 3300025925 Bacteria 2825
147 Ga0207650_10201056 3300025925 Bacteria 1596
148 Ga0207687_10050649 3300025927 Bacteria 2891
149 Ga0207687_10311617 3300025927 Bacteria 1271
150 Ga0207687_10660232 3300025927 Bacteria 885
151 Ga0207664_10036083 3300025929 Bacteria 3819
152 Ga0207644_10522867 3300025931 Bacteria 980
153 Ga0207690_10030117 3300025932 Bacteria 3458
154 Ga0207690_10208450 3300025932 Bacteria 1489
155 Ga0207690_11327757 3300025932 Bacteria 601
156 Ga0207706_10041660 3300025933 Bacteria 4070
157 Ga0207706_10204617 3300025933 Bacteria 1731
158 Ga0207686_10020770 3300025934 Bacteria 3756
159 Ga0207686_10281467 3300025934 Bacteria 1228
160 Ga0207670_10044015 3300025936 Bacteria 2952
161 Ga0207669_10848590 3300025937 Bacteria 760
162 Ga0207665_10167042 3300025939 Bacteria 1587
163 Ga0207691_10277278 3300025940 Bacteria 1443
164 Ga0207691_10316312 3300025940 Bacteria 1339
165 Ga0207711_10178855 3300025941 Bacteria 1928
166 Ga0207711_10340793 3300025941 Bacteria 1387
167 Ga0207689_10056414 3300025942 Bacteria 3233
168 Ga0207689_10233115 3300025942 Bacteria 1521
169 Ga0207661_10173784 3300025944 Bacteria 1877
170 Ga0207661_11060667 3300025944 Bacteria 746
171 Ga0207679_10123846 3300025945 Bacteria 2062
172 Ga0207667_10122668 3300025949 Bacteria 2677
173 Ga0207667_11142032 3300025949 Bacteria 761
174 Ga0207640_10679293 3300025981 Bacteria 880
175 Ga0207677_10206380 3300026023 Bacteria 1565
176 Ga0207703_10010495 3300026035 Bacteria 7241
177 Ga0207678_10129183 3300026067 Bacteria 2155
178 Ga0207708_10054600 3300026075 Bacteria 3046
179 Ga0207702_10114164 3300026078 Bacteria 2407
180 Ga0207702_10159974 3300026078 Bacteria 2056
181 Ga0207641_10935282 3300026088 Bacteria 862
182 Ga0207641_11379543 3300026088 Bacteria 706
183 Ga0207648_10039090 3300026089 Bacteria 4172
184 Ga0207676_10610445 3300026095 Bacteria 1049
185 Ga0207674_10140865 3300026116 Bacteria 2371
186 Ga0207674_10246384 3300026116 Bacteria 1734
187 Ga0207674_11197991 3300026116 Bacteria 729
188 Ga0207675_100324621 3300026118 Bacteria 1503
189 Ga0207683_10050997 3300026121 Bacteria 3625
190 Ga0207683_10146923 3300026121 Bacteria 2126
191 Ga0207698_10011851 3300026142 Bacteria 5676
192 Ga0207698_10064757 3300026142 Bacteria 2867
193 Ga0207698_11114812 3300026142 Bacteria 802
194 Ga0268266_10000727 3300028379 Bacteria 44221
195 Ga0268266_10653138 3300028379 Bacteria 1012
196 Ga0265334_10000053 3300028573 Bacteria 82319
197 Ga0265760_10015725 3300031090 Unclassified 2170
198 Ga0265328_10003994 3300031239 Bacteria 6468
199 Ga0265331_10000170 3300031250 Bacteria 80298
200 Ga0265331_10004949 3300031250 Bacteria 8180
201 Ga0265327_10001032 3300031251 Bacteria 39265
202 Ga0307408_100268586 3300031548 Bacteria 1415
203 Ga0316575_10016298 3300031665 Bacteria 2810
204 Ga0316579_10000285 3300031691 Bacteria 15471
205 Ga0316578_10342651 3300031728 Bacteria 890
206 Ga0307405_10115591 3300031731 Bacteria 1826
207 Ga0307405_10411169 3300031731 Bacteria 1062
208 Ga0307412_10765050 3300031911 Bacteria 835
209 Ga0307416_100068243 3300032002 Bacteria 2937
210 Ga0307416_100098720 3300032002 Bacteria 2534
211 Ga0307415_101087546 3300032126 Bacteria 748
212 Ga0316583_10001463 3300032133 Bacteria 7882
213 Ga0373930_0047458 3300034816 Bacteria 929
214 Ga0373928_0089054 3300035084 Bacteria 790
215 Ga0373934_0191254 3300035086 Bacteria 842
216 Ga0373952_0081524 3300035092 Bacteria 826
217 Ga0373923_0370179 3300035111 Bacteria 686
218 Ga0373960_0292301 3300035121 Bacteria 604
219 Ga0373955_0379858 3300035172 Bacteria 857
220 Ga0373931_0462009 3300035691 Bacteria 813
221 Ga0373931_0783920 3300035691 Bacteria 634
222 Ga0373935_0092256 3300035692 Bacteria 1984
223 Ga0373935_0857433 3300035692 Bacteria 672
224 Ga0373933_0072616 3300035724 Bacteria 2096
225 Ga0373933_0475001 3300035724 Bacteria 818
226 Ga0373947_0038225 3300035725 Bacteria 2850
227 Ga0373947_0759659 3300035725 Bacteria 662
228 Ga0373937_0011003 3300036401 Bacteria 7929
229 Ga0373937_0877625 3300036401 Bacteria 846
230 Ga0373925_0079146 3300037068 Bacteria 2497
231 Ga0395900_0428909 3300037418 Bacteria 1282
232 Ga0395898_0279378 3300037466 Bacteria 1593
233 Ga0395905_0021687 3300037471 Bacteria 6076
234 Ga0316581_0003459 3300037588 Bacteria 3929
235 Ga0436364_0521054 3300037853 Bacteria 1214
236 Ga0436364_1236344 3300037853 Bacteria 26268
237 Ga0436364_1376171 3300037853 Bacteria 1414
238 Ga0436365_1432339 3300039437 Bacteria 1192
239 Ga0436360_0443581 3300039438 Bacteria 1192
240 Ga0436361_0022070 3300039447 Bacteria 1145
241 Ga0436361_0269507 3300039447 Bacteria 102308
242 Ga0436361_0966343 3300039447 Bacteria 2735
243 Ga0451802_0281521 3300041460 Bacteria 566
244 Ga0451851_0648648 3300041507 Bacteria 729
245 Ga0451853_3260459 3300041512 Bacteria 3120
246 Ga0439443_085127 3300042003 Bacteria 592
247 Ga0439458_0080144 3300042157 Bacteria 832
248 Ga0451577_0419657 3300042876 Bacteria 1215
249 Ga0451577_0874431 3300042876 Bacteria 810
250 Ga0466972_0074226 3300044658 Bacteria 1621
251 Ga0466966_0292796 3300044684 Bacteria 979
252 Ga0466961_0110579 3300044693 Bacteria 1729
253 Ga0466964_0891050 3300044706 Bacteria 508
254 Ga0453684_0329888 3300044712 Bacteria 1726
255 Ga0453684_0947348 3300044712 Bacteria 919
256 Ga0466959_0364144 3300045049 Bacteria 985
257 Ga0451576_1720558 3300045051 Bacteria 649
258 Ga0495580_0200234 3300046472 Bacteria 1376
259 Ga0495608_0875394 3300046511 Bacteria 527
260 Ga0495642_0237865 3300046528 Bacteria 796
261 Ga0495621_0002464 3300046539 Bacteria 4993
262 Ga0495635_0498769 3300046663 Bacteria 802
263 Ga0495658_0058573 3300046683 Bacteria 2204
264 Ga0495658_0616255 3300046683 Bacteria 695
265 Ga0495670_0139829 3300046691 Bacteria 1265
266 Ga0495604_0351605 3300047317 Bacteria 979
267 Ga0495675_0192014 3300047444 Bacteria 1246
268 Ga0495602_0807466 3300048088 Bacteria 630
269 Ga0496100_0437579 3300048903 Bacteria 1001
270 Ga0496104_0022154 3300048907 Bacteria 5838
271 Ga0496107_0551004 3300048910 Unclassified 854
272 Ga0496109_0535147 3300048912 Bacteria 1105
273 Ga0496112_0049210 3300048915 Bacteria 4131
274 Ga0496112_0789408 3300048915 Bacteria 875
275 Ga0496113_0253109 3300048916 Bacteria 1406
276 Ga0496114_0234391 3300048917 Bacteria 1613
277 Ga0496116_0309818 3300048919 Bacteria 746
278 Ga0501310_006349 3300049130 Bacteria 1239
279 Ga0501031_0583218 3300049568 Bacteria 720
280 Ga0501034_0100594 3300049571 Bacteria 2885
281 Ga0501034_0148196 3300049571 Bacteria 2323
282 Ga0501047_0104253 3300049581 Bacteria 2716
283 Ga0501069_0313794 3300049585 Bacteria 920
284 Ga0501072_0816822 3300049588 Bacteria 730
285 Ga0501076_0869178 3300049592 Bacteria 744
286 Ga0501210_015467 3300049657 Bacteria 669
287 Ga0501217_010447 3300049661 Bacteria 2034
288 Ga0501233_108573 3300049668 Bacteria 740
289 Ga0501236_047835 3300049670 Bacteria 726
290 Ga0501081_0204496 3300049743 Bacteria 1433
291 nmdc:mga09592_244476_c1 3300050508 Bacteria 1555
292 nmdc:mga08y16_24209_c1 3300050511 Bacteria 6409
293 Ga0495619_0551155 3300053085 Bacteria 791
294 Ga0500641_0006686 3300053096 Bacteria 4097
295 Ga0500568_0006476 3300053139 Bacteria 5871
296 Ga0587067_037736 3300059640 Bacteria 924
297 Ga0501082_0765485 3300060353 Bacteria 845
298 Ga0466962_0027776 3300061719 Bacteria 2713
299 2587743592 2585428059 Bacteria 8696589
300 2644423886 2643221676 Bacteria 8119172
301 2644439731 2643221678 Bacteria 9540101
302 2687577727 2687453129 Bacteria 4387428
303 2795784783 2795385470 Bacteria 8317180
304 2808843738 2808606359 Bacteria 9866990
305 2819675645 2818991459 Bacteria 8736032
306 2857459088 2857453340 Bacteria 8090534
307 2883357131 2883354860 Bacteria 5865246
308 2898910941 2898907183 Bacteria 4067722
309 2904762818 2904755435 Bacteria 7986759
310 2919430596 2919425241 Bacteria 8055701
311 2919474245 2919468124 Bacteria 9133025
312 2952254030 2952252522 Bacteria 4171745
313 2971416636 2971410472 Bacteria 8311090
314 8056536024 8056533031 Bacteria 8964429
315 8057162610 8057160832 Bacteria 3268302
316 Ga0439455_0034343
317 JGI24735J21928_10168855
318 JGI25151J46595_10029899
319 Ga0055541_1000792
320 Ga0070658_10005432
321 Ga0070658_10048209
322 Ga0070658_11343464
323 Ga0070676_10253790
324 Ga0070683_100555521
325 Ga0070683_100723267
326 Ga0070670_100280519
327 Ga0070670_100798822
328 Ga0070670_100838093
329 Ga0070666_10232742
330 Ga0070680_100260030
331 Ga0070682_100416508
332 Ga0070660_100086496
333 Ga0070660_100117913
334 Ga0070660_100168899
335 Ga0070689_100090210
336 Ga0070661_100623405
337 Ga0070671_100028657
338 Ga0070671_100494409
339 Ga0070671_100744271
340 Ga0070674_100023646
341 Ga0070674_101079761
342 Ga0070673_100165637
343 Ga0070673_100506207
344 Ga0070673_100977112
345 Ga0070659_100105130
346 Ga0070714_100068079
347 Ga0070713_100733717
348 Ga0070713_101917387
349 Ga0070710_10181111
350 Ga0070701_10023824
351 Ga0070701_10099145
352 Ga0070711_100728574
353 Ga0070700_100059284
354 Ga0070663_100063799
355 Ga0070663_100071076
356 Ga0070663_101165368
357 Ga0070678_100171903
358 Ga0070678_100193385
359 Ga0070662_100542765
360 Ga0070681_10757438
361 Ga0068867_100024060
362 Ga0070685_10272525
363 Ga0070679_100331713
364 Ga0070679_100422722
365 Ga0070679_100431742
366 Ga0070672_100046358
367 Ga0070672_100741086
368 Ga0070672_100747468
369 Ga0070672_101797529
370 Ga0070686_100414411
371 Ga0070693_100002074
372 Ga0070693_100322902
373 Ga0070693_101009765
374 Ga0070665_100000377
375 Ga0070665_101071400
376 Ga0068855_100096807
377 Ga0068855_100136574
378 Ga0070664_100006962
379 Ga0070664_100418712
380 Ga0070664_100823451
381 Ga0068857_100184124
382 Ga0068857_100660122
383 Ga0068857_100740711
384 Ga0068854_100036791
385 Ga0068854_100246336
386 Ga0068856_100130246
387 Ga0070702_100417259
388 Ga0068852_100011732
389 Ga0068852_100184429
390 Ga0068852_100226775
391 Ga0068852_100938060
392 Ga0068852_101347003
393 Ga0068859_100853166
394 Ga0068859_101104142
395 Ga0068864_100533072
396 Ga0068866_10697303
397 Ga0068851_10009998
398 Ga0068851_10706850
399 Ga0068858_100004505
400 Ga0070716_100348561
401 Ga0070712_100000264
402 Ga0097621_100102423
403 Ga0097621_100302682
404 Ga0068871_100385619
405 Ga0068865_100290149
406 Ga0075436_100595545
407 Ga0097620_100853200
408 Ga0097620_101104554
409 Ga0105240_10165872
410 Ga0111539_10297277
411 Ga0105245_10316064
412 Ga0105245_12324099
413 Ga0105242_10002341
414 Ga0105242_10093891
415 Ga0105242_10316269
416 Ga0105248_10072977
417 Ga0105248_10453569
418 Ga0105238_10068107
419 Ga0105238_12720166
420 Ga0099796_10000164
421 Ga0099796_10197445
422 Ga0105239_11828300
423 Ga0105239_11918893
424 Ga0105246_10572878
425 Ga0157370_11392077
426 Ga0157369_11034939
427 Ga0157374_10161658
428 Ga0157374_10773727
429 Ga0163162_10145316
430 Ga0157372_12610746
431 Ga0157375_10663702
432 Ga0157379_10010731
433 Ga0157379_10041329
434 Ga0157379_10261629
435 Ga0157376_10028271
436 Ga0213872_10000050
437 Ga0213872_10022937
438 Ga0213872_10194571
439 Ga0209566_100158
440 Ga0209025_1010466
441 Ga0207692_10132364
442 Ga0207642_10581954
443 Ga0207699_10143834
444 Ga0207699_10486886
445 Ga0207645_10348821
446 Ga0207705_10005240
447 Ga0207695_10101989
448 Ga0207693_10000242
449 Ga0207693_10259347
450 Ga0207663_10526821
451 Ga0207663_10718268
452 Ga0207660_10118308
453 Ga0207662_10044345
454 Ga0207657_10041454
455 Ga0207657_10084929
456 Ga0207657_10488370
457 Ga0207649_10077798
458 Ga0207649_11136040
459 Ga0207652_10113044
460 Ga0207652_10303213
461 Ga0207650_10060578
462 Ga0207650_10201056
463 Ga0207687_10050649
464 Ga0207687_10311617
465 Ga0207687_10660232
466 Ga0207664_10036083
467 Ga0207644_10522867
468 Ga0207690_10030117
469 Ga0207690_10208450
470 Ga0207690_11327757
471 Ga0207706_10041660
472 Ga0207706_10204617
473 Ga0207686_10020770
474 Ga0207686_10281467
475 Ga0207670_10044015
476 Ga0207669_10848590
477 Ga0207665_10167042
478 Ga0207691_10277278
479 Ga0207691_10316312
480 Ga0207711_10178855
481 Ga0207711_10340793
482 Ga0207689_10056414
483 Ga0207689_10233115
484 Ga0207661_10173784
485 Ga0207661_11060667
486 Ga0207679_10123846
487 Ga0207667_10122668
488 Ga0207667_11142032
489 Ga0207640_10679293
490 Ga0207677_10206380
491 Ga0207703_10010495
492 Ga0207678_10129183
493 Ga0207708_10054600
494 Ga0207702_10114164
495 Ga0207702_10159974
496 Ga0207641_10935282
497 Ga0207641_11379543
498 Ga0207648_10039090
499 Ga0207676_10610445
500 Ga0207674_10140865
501 Ga0207674_10246384
502 Ga0207674_11197991
503 Ga0207675_100324621
504 Ga0207683_10050997
505 Ga0207683_10146923
506 Ga0207698_10011851
507 Ga0207698_10064757
508 Ga0207698_11114812
509 Ga0268266_10000727
510 Ga0268266_10653138
511 Ga0265334_10000053
512 Ga0265760_10015725
513 Ga0265328_10003994
514 Ga0265331_10000170
515 Ga0265331_10004949
516 Ga0265327_10001032
517 Ga0307408_100268586
518 Ga0316575_10016298
519 Ga0316579_10000285
520 Ga0316578_10342651
521 Ga0307405_10115591
522 Ga0307405_10411169
523 Ga0307412_10765050
524 Ga0307416_100068243
525 Ga0307416_100098720
526 Ga0307415_101087546
527 Ga0316583_10001463
528 Ga0373930_0047458
529 Ga0373928_0089054
530 Ga0373934_0191254
531 Ga0373952_0081524
532 Ga0373923_0370179
533 Ga0373960_0292301
534 Ga0373955_0379858
535 Ga0373931_0462009
536 Ga0373931_0783920
537 Ga0373935_0092256
538 Ga0373935_0857433
539 Ga0373933_0072616
540 Ga0373933_0475001
541 Ga0373947_0038225
542 Ga0373947_0759659
543 Ga0373937_0011003
544 Ga0373937_0877625
545 Ga0373925_0079146
546 Ga0395900_0428909
547 Ga0395898_0279378
548 Ga0395905_0021687
549 Ga0316581_0003459
550 Ga0436364_0521054
551 Ga0436364_1236344
552 Ga0436364_1376171
553 Ga0436365_1432339
554 Ga0436360_0443581
555 Ga0436361_0022070
556 Ga0436361_0269507
557 Ga0436361_0966343
558 Ga0451802_0281521
559 Ga0451851_0648648
560 Ga0451853_3260459
561 Ga0439443_085127
562 Ga0439458_0080144
563 Ga0451577_0419657
564 Ga0451577_0874431
565 Ga0466972_0074226
566 Ga0466966_0292796
567 Ga0466961_0110579
568 Ga0466964_0891050
569 Ga0453684_0329888
570 Ga0453684_0947348
571 Ga0466959_0364144
572 Ga0451576_1720558
573 Ga0495580_0200234
574 Ga0495608_0875394
575 Ga0495642_0237865
576 Ga0495621_0002464
577 Ga0495635_0498769
578 Ga0495658_0058573
579 Ga0495658_0616255
580 Ga0495670_0139829
581 Ga0495604_0351605
582 Ga0495675_0192014
583 Ga0495602_0807466
584 Ga0496100_0437579
585 Ga0496104_0022154
586 Ga0496107_0551004
587 Ga0496109_0535147
588 Ga0496112_0049210
589 Ga0496112_0789408
590 Ga0496113_0253109
591 Ga0496114_0234391
592 Ga0496116_0309818
593 Ga0501310_006349
594 Ga0501031_0583218
595 Ga0501034_0100594
596 Ga0501034_0148196
597 Ga0501047_0104253
598 Ga0501069_0313794
599 Ga0501072_0816822
600 Ga0501076_0869178
601 Ga0501210_015467
602 Ga0501217_010447
603 Ga0501233_108573
604 Ga0501236_047835
605 Ga0501081_0204496
606 nmdc:mga09592_244476_c1
607 nmdc:mga08y16_24209_c1
608 Ga0495619_0551155
609 Ga0500641_0006686
610 Ga0500568_0006476
611 Ga0587067_037736
612 Ga0501082_0765485
613 Ga0466962_0027776
614 2587743592
615 2644423886
616 2644439731
617 2687577727
618 2795784783
619 2808843738
620 2819675645
621 2857459088
622 2883357131
623 2898910941
624 2904762818
625 2919430596
626 2919474245
627 2952254030
628 2971416636
629 8056536024
630 8057162610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

26

160

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h4g-assembly2.cif.gz_H-2 crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9616 19 167
7qv0-assembly1.cif.gz_C-2 covalent complex between scalindua brodae amxfabz and amxacp 0.9494 22 167
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.9478 20 167
4h4g-assembly2.cif.gz_H-2 crystal structure of (3r)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from burkholderia thailandensis e264 0.9475 19 167
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.9456 20 167
ID Description Score Start End Superfamily
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9318 19 167 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9317 17 165 3.10.129.10
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9206 19 170 3.10.129.10
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9186 19 167 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9184 17 165 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A384HRB9-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9753 17 170 GO:0016829
AF-A0A7K0J3V7-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9708 27 167 GO:0016829
AF-A0A2M9KTZ2-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.97 11 170 GO:0016829
AF-A0A384HRB9-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9691 17 170 GO:0016829
AF-A0A7K0J3V7-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9641 27 167 GO:0016829

Map