F403246

General Info

Members Datasets Scaffolds Average Seq Length
315 249 630 331

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10005467|Ga0307407_100054673
Length 386
Sequence VAERALAEAAAPLLSVRNLRVEFPTRRGRLVAVHDVSFDIAAGEVLGVVGESGAGKSLTGAAIIGLIDPPGRIAGGEVHLDGRRIDQLPYEAMRRVRGREIGAIFQDPLTSLNPLYTIGRQLVETIRTHLDMNEAQARARAVALLEEVGIPAAARRVDQYPHQFSGGMRQRVVIALALAARPKLIIADEPTTALDVSIQAQIIQLLKRLCREHGTSVMLVTHDMGVIAETAHRVAVMYAGRIVEIGPVADVIHRAQHPYSIGLMGSIPSIAQDRDRLAQIDGTMPRLTSVPPGCPFHPRCPRAFVRCTRERPELIPAMASLAACWLHDPVARLEAHQRIAPAGASAEAAHAADTDHAGARGRDPFVTPDDVAGTGEAIDAPRGDTR

Samples

Sample ID Description Type Environment
1 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
119 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
192 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
199 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
200 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
201 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
202 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
203 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
204 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
205 2643221626 Ensifer sp. Root31 Isolate Unclassified
206 2643221723 Ensifer sp. Root278 Isolate Unclassified
207 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
208 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
209 2858950400 Achromobacter sp. K91 Isolate Unclassified
210 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
211 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
212 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
213 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
214 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
215 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
216 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
217 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
218 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
219 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
220 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
221 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
222 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
223 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
224 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
225 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
226 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
227 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
228 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
229 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
230 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
231 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
232 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
233 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
234 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
235 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
236 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
237 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
238 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
239 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
240 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
241 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
242 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
243 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
244 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
245 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
246 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
247 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
248 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
249 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.86
Metatranscriptomes 0.63
Isolates 16.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 13.33
Rhizoplane 2.22
Rhizosphere 69.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307407_10005467 3300031903 Bacteria 5517
2 JGI24740J21852_10014321 3300001979 Bacteria 2928
3 JGI25156J39149_1001032 3300002705 Bacteria 12996
4 JGI25151J46595_10031803 3300003187 Bacteria 2055
5 JGI25153J46596_10000870 3300003215 Bacteria 18404
6 JGI25153J46596_10059184 3300003215 Bacteria 1050
7 Ga0055526_1000950 3300003771 Bacteria 21443
8 Ga0055524_1027513 3300003775 Bacteria 1723
9 Ga0055536_1007009 3300003781 Bacteria 5125
10 Ga0055531_10001642 3300003794 Bacteria 16179
11 Ga0055543_1001756 3300004625 Bacteria 8100
12 Ga0065165_1006796 3300005262 Bacteria 5844
13 Ga0070683_100091025 3300005329 Bacteria 2864
14 Ga0070670_100005250 3300005331 Bacteria 10910
15 Ga0070670_100023104 3300005331 Bacteria 5352
16 Ga0070670_100039475 3300005331 Bacteria 4059
17 Ga0070670_100097924 3300005331 Bacteria 2523
18 Ga0068869_100006765 3300005334 Bacteria 7287
19 Ga0070668_100001697 3300005347 Bacteria 15982
20 Ga0070668_100007090 3300005347 Bacteria 8303
21 Ga0070668_100024660 3300005347 Bacteria 4558
22 Ga0070669_100007523 3300005353 Bacteria 7801
23 Ga0070671_100051322 3300005355 Bacteria 3430
24 Ga0070674_100031037 3300005356 Bacteria 3537
25 Ga0070674_100110675 3300005356 Bacteria 2016
26 Ga0070673_100027633 3300005364 Bacteria 4208
27 Ga0070673_100029931 3300005364 Bacteria 4067
28 Ga0070688_100085528 3300005365 Bacteria 2050
29 Ga0070667_100012423 3300005367 Bacteria 7047
30 Ga0070667_100376490 3300005367 Bacteria 1289
31 Ga0070678_100180910 3300005456 Bacteria 1726
32 Ga0070662_100020661 3300005457 Bacteria 4489
33 Ga0068867_100036721 3300005459 Bacteria 3559
34 Ga0068867_100299064 3300005459 Bacteria 1326
35 Ga0070698_100069315 3300005471 Bacteria 3541
36 Ga0070697_100008976 3300005536 Bacteria 7813
37 Ga0070672_100002453 3300005543 Bacteria 11773
38 Ga0070672_100039031 3300005543 Bacteria 3634
39 Ga0070672_100136855 3300005543 Bacteria 2018
40 Ga0070672_100195793 3300005543 Bacteria 1689
41 Ga0070672_100212780 3300005543 Bacteria 1619
42 Ga0070686_100349063 3300005544 Bacteria 1111
43 Ga0070695_100010690 3300005545 Bacteria 5484
44 Ga0070665_100003283 3300005548 Bacteria 17362
45 Ga0070665_100025418 3300005548 Bacteria 5968
46 Ga0070665_100129684 3300005548 Bacteria 2524
47 Ga0070704_100004664 3300005549 Bacteria 7931
48 Ga0068855_100115080 3300005563 Bacteria 3083
49 Ga0068856_100194876 3300005614 Bacteria 2040
50 Ga0068859_100002711 3300005617 Bacteria 17963
51 Ga0068864_100001221 3300005618 Bacteria 21344
52 Ga0068861_100000947 3300005719 Bacteria 17633
53 Ga0068870_10049295 3300005840 Bacteria 2221
54 Ga0068863_100005462 3300005841 Bacteria 12517
55 Ga0068863_100041085 3300005841 Bacteria 4396
56 Ga0068863_100105124 3300005841 Bacteria 2686
57 Ga0068858_100001698 3300005842 Bacteria 22498
58 Ga0068858_100268954 3300005842 Bacteria 1621
59 Ga0068860_100007624 3300005843 Bacteria 10830
60 Ga0068860_100121735 3300005843 Bacteria 2499
61 Ga0068860_100164800 3300005843 Bacteria 2139
62 Ga0068862_100034597 3300005844 Bacteria 4276
63 Ga0068862_100190190 3300005844 Bacteria 1846
64 Ga0081538_10015651 3300005981 Bacteria 5860
65 Ga0075364_10015268 3300006051 Bacteria 4761
66 Ga0075369_10020142 3300006186 Bacteria 2731
67 Ga0075428_100076210 3300006844 Bacteria 3662
68 Ga0075431_100011241 3300006847 Bacteria 9016
69 Ga0075431_100032176 3300006847 Bacteria 5404
70 Ga0075434_100092631 3300006871 Bacteria 3025
71 Ga0075429_100000007 3300006880 Bacteria 90776
72 Ga0068865_100053695 3300006881 Bacteria 2796
73 Ga0097620_100002711 3300006931 Bacteria 17963
74 Ga0105240_10559459 3300009093 Bacteria 1264
75 Ga0111539_10292534 3300009094 Bacteria 1895
76 Ga0111539_10574916 3300009094 Bacteria 1312
77 Ga0105247_10014134 3300009101 Bacteria 4788
78 Ga0114129_10016509 3300009147 Bacteria 10514
79 Ga0114129_10470221 3300009147 Bacteria 1646
80 Ga0105242_10001842 3300009176 Bacteria 16643
81 Ga0105248_10083518 3300009177 Bacteria 3593
82 Ga0105248_10209041 3300009177 Bacteria 2199
83 Ga0163162_10185804 3300013306 Bacteria 2205
84 Ga0163163_10035683 3300014325 Bacteria 4825
85 Ga0157379_10003651 3300014968 Bacteria 13064
86 Ga0157376_10035554 3300014969 Bacteria 4030
87 Ga0163161_10014440 3300017792 Bacteria 5498
88 Ga0213875_10000968 3300021388 Bacteria 20539
89 Ga0209677_103337 3300025253 Bacteria 5282
90 Ga0209233_1006918 3300025261 Bacteria 3628
91 Ga0209676_1000049 3300025292 Bacteria 403210
92 Ga0209676_1001291 3300025292 Bacteria 25765
93 Ga0209025_1000337 3300025294 Bacteria 103480
94 Ga0209564_1000117 3300025295 Bacteria 207096
95 Ga0209050_1009352 3300025298 Bacteria 5030
96 Ga0209256_1000352 3300025299 Bacteria 74849
97 Ga0209051_1035541 3300025303 Bacteria 1852
98 Ga0209257_1001572 3300025304 Bacteria 26338
99 Ga0207643_10020693 3300025908 Bacteria 3612
100 Ga0207705_10074720 3300025909 Bacteria 2461
101 Ga0207681_10055615 3300025923 Bacteria 2696
102 Ga0207650_10080158 3300025925 Bacteria 2474
103 Ga0207650_10099117 3300025925 Bacteria 2239
104 Ga0207650_10174036 3300025925 Bacteria 1712
105 Ga0207644_10049532 3300025931 Bacteria 3008
106 Ga0207686_10002209 3300025934 Bacteria 10705
107 Ga0207709_10036924 3300025935 Bacteria 2899
108 Ga0207670_10110397 3300025936 Bacteria 1981
109 Ga0207691_10004737 3300025940 Bacteria 13155
110 Ga0207691_10072665 3300025940 Bacteria 3103
111 Ga0207691_10072686 3300025940 Bacteria 3102
112 Ga0207691_10128463 3300025940 Bacteria 2240
113 Ga0207691_10179765 3300025940 Bacteria 1849
114 Ga0207689_10000689 3300025942 Bacteria 32315
115 Ga0207667_10113480 3300025949 Bacteria 2794
116 Ga0207667_10313447 3300025949 Bacteria 1602
117 Ga0207651_10026174 3300025960 Bacteria 3639
118 Ga0207651_10207291 3300025960 Bacteria 1575
119 Ga0207668_10033910 3300025972 Bacteria 3385
120 Ga0207658_10194886 3300025986 Bacteria 1687
121 Ga0207677_10054919 3300026023 Bacteria 2721
122 Ga0207703_10005214 3300026035 Bacteria 10503
123 Ga0207703_10513972 3300026035 Bacteria 1126
124 Ga0207702_10169679 3300026078 Bacteria 2000
125 Ga0207641_10024811 3300026088 Bacteria 4942
126 Ga0207641_10044170 3300026088 Bacteria 3747
127 Ga0207641_10047643 3300026088 Bacteria 3615
128 Ga0207641_10047963 3300026088 Bacteria 3604
129 Ga0207641_10164405 3300026088 Bacteria 2020
130 Ga0207648_10037670 3300026089 Bacteria 4260
131 Ga0207676_10012853 3300026095 Bacteria 6012
132 Ga0207676_10025667 3300026095 Bacteria 4373
133 Ga0207675_100020226 3300026118 Bacteria 6205
134 Ga0207683_10085443 3300026121 Bacteria 2805
135 Ga0209371_1004646 3300027312 Bacteria 5854
136 Ga0268266_10033636 3300028379 Bacteria 4358
137 Ga0268266_10035240 3300028379 Bacteria 4257
138 Ga0268266_10196046 3300028379 Bacteria 1846
139 Ga0268265_10010373 3300028380 Bacteria 6293
140 Ga0268265_10187503 3300028380 Bacteria 1783
141 Ga0268264_10001909 3300028381 Bacteria 18834
142 Ga0265324_10001251 3300029957 Bacteria 15017
143 Ga0265770_1000469 3300030878 Bacteria 5560
144 Ga0265760_10001236 3300031090 Bacteria 7471
145 Ga0307408_100065005 3300031548 Bacteria 2674
146 Ga0307408_100291542 3300031548 Bacteria 1363
147 Ga0316579_10005398 3300031691 Bacteria 5155
148 Ga0265314_10067359 3300031711 Bacteria 2412
149 Ga0316578_10003809 3300031728 Bacteria 6986
150 Ga0316578_10062597 3300031728 Bacteria 2194
151 Ga0316577_10024128 3300031733 Bacteria 3380
152 Ga0307413_10000255 3300031824 Bacteria 16118
153 Ga0307413_10147891 3300031824 Bacteria 1633
154 Ga0307410_10002057 3300031852 Bacteria 9513
155 Ga0307410_10046226 3300031852 Bacteria 2903
156 Ga0307410_10263371 3300031852 Bacteria 1345
157 Ga0307406_10002797 3300031901 Bacteria 9518
158 Ga0307406_10047062 3300031901 Bacteria 2717
159 Ga0307409_100005627 3300031995 Bacteria 7247
160 Ga0307416_100014012 3300032002 Bacteria 5472
161 Ga0307411_10039517 3300032005 Bacteria 2985
162 Ga0307411_10064884 3300032005 Bacteria 2446
163 Ga0307411_10121973 3300032005 Bacteria 1888
164 Ga0307415_100031680 3300032126 Bacteria 3409
165 Ga0316585_10028944 3300032137 Bacteria 1734
166 Ga0307510_10016646 3300033180 Bacteria 8677
167 Ga0373923_0090181 3300035111 Bacteria 1340
168 Ga0373933_0029109 3300035724 Bacteria 3191
169 Ga0373937_0043163 3300036401 Bacteria 4115
170 Ga0316582_0273388 3300036647 Bacteria 1159
171 Ga0316584_0000145 3300036712 Bacteria 31908
172 Ga0373925_0004001 3300037068 Bacteria 11219
173 Ga0316581_0024674 3300037588 Bacteria 1785
174 Ga0436364_0256383 3300037853 Bacteria 83938
175 Ga0237819_01102 3300038705 Bacteria 7907
176 Ga0436365_0736190 3300039437 Bacteria 1917
177 Ga0453683_0003773 3300044673 Bacteria 11042
178 Ga0466965_0003588 3300044683 Bacteria 6830
179 Ga0466964_0000482 3300044706 Bacteria 12299
180 Ga0466971_0065657 3300044719 Bacteria 1643
181 Ga0466970_0087199 3300044765 Bacteria 1692
182 Ga0466957_0005170 3300044842 Bacteria 7297
183 Ga0451576_0120783 3300045051 Bacteria 2728
184 Ga0466958_0036428 3300045836 Bacteria 2944
185 Ga0466967_0017980 3300045976 Bacteria 5635
186 Ga0466967_0099126 3300045976 Bacteria 2661
187 Ga0495629_0000023 3300046459 Bacteria 142325
188 Ga0495638_0010868 3300046460 Bacteria 6295
189 Ga0495653_0006156 3300046463 Bacteria 9840
190 Ga0495580_0011501 3300046472 Bacteria 6846
191 Ga0495582_0104574 3300046473 Bacteria 1587
192 Ga0495605_0011715 3300046474 Bacteria 4881
193 Ga0495583_0000946 3300046506 Bacteria 33756
194 Ga0495583_0013502 3300046506 Bacteria 4552
195 Ga0495630_0304855 3300046517 Bacteria 1217
196 Ga0495648_0063520 3300046524 Bacteria 2179
197 Ga0495652_0189818 3300046529 Bacteria 1569
198 Ga0495611_0026481 3300046648 Bacteria 2530
199 Ga0495661_0164981 3300046665 Bacteria 1186
200 Ga0495646_0040421 3300046680 Bacteria 2872
201 Ga0495613_0096134 3300046689 Bacteria 2142
202 Ga0495624_0029063 3300046690 Bacteria 3608
203 Ga0495624_0186187 3300046690 Bacteria 1263
204 Ga0495649_0001549 3300046694 Bacteria 17248
205 Ga0495674_0250823 3300047319 Bacteria 1456
206 Ga0495679_000022 3300047446 Bacteria 215296
207 Ga0495593_0056618 3300047673 Bacteria 2060
208 Ga0495626_0032221 3300048091 Bacteria 2518
209 Ga0495626_0100012 3300048091 Bacteria 1265
210 Ga0496102_0002356 3300048905 Bacteria 16116
211 Ga0496108_0339523 3300048911 Bacteria 1310
212 Ga0496109_0170130 3300048912 Bacteria 2044
213 Ga0496109_0290096 3300048912 Bacteria 1542
214 Ga0496112_0000240 3300048915 Bacteria 35240
215 Ga0496113_0042005 3300048916 Bacteria 3377
216 Ga0496115_0121491 3300048918 Bacteria 2149
217 Ga0496118_0015067 3300048921 Bacteria 7186
218 Ga0496118_0064402 3300048921 Bacteria 2690
219 Ga0496119_0069509 3300048922 Bacteria 2069
220 Ga0496120_0059668 3300048923 Bacteria 2137
221 Ga0496121_0028871 3300048924 Bacteria 5151
222 Ga0496124_0000004 3300048927 Bacteria 976131
223 Ga0495678_033994 3300049459 Bacteria 2101
224 Ga0501031_0092088 3300049568 Bacteria 1978
225 Ga0501034_0091085 3300049571 Bacteria 3047
226 Ga0501034_0160800 3300049571 Bacteria 2217
227 Ga0501034_0438530 3300049571 Bacteria 1225
228 Ga0501036_0013709 3300049572 Bacteria 6741
229 Ga0501038_0110161 3300049574 Bacteria 2282
230 Ga0501041_0053739 3300049577 Bacteria 2457
231 Ga0501042_0242801 3300049578 Bacteria 1299
232 Ga0501046_0118904 3300049580 Bacteria 2012
233 Ga0501046_0274289 3300049580 Bacteria 1236
234 Ga0501047_0153191 3300049581 Bacteria 2180
235 Ga0501048_0062733 3300049582 Bacteria 2630
236 Ga0501069_0061504 3300049585 Bacteria 2097
237 Ga0501070_0128074 3300049586 Bacteria 2098
238 Ga0501071_0050421 3300049587 Bacteria 2998
239 Ga0501072_0076395 3300049588 Bacteria 2650
240 Ga0501075_0030313 3300049591 Bacteria 4006
241 Ga0501075_0314638 3300049591 Bacteria 1193
242 Ga0501076_0135815 3300049592 Bacteria 1996
243 Ga0501076_0145357 3300049592 Bacteria 1928
244 Ga0501077_0061057 3300049593 Bacteria 2392
245 Ga0501079_0073809 3300049741 Bacteria 2637
246 Ga0501044_0081559 3300049823 Bacteria 3274
247 Ga0501045_0016628 3300049824 Bacteria 5226
248 Ga0501045_0244414 3300049824 Bacteria 1336
249 nmdc:mga05p37_145_c1 3300050507 Bacteria 66709
250 nmdc:mga05p37_443549_c1 3300050507 Bacteria 1504
251 nmdc:mga09592_300_c1 3300050508 Bacteria 35915
252 nmdc:mga0n895_125126_c1 3300050512 Bacteria 2594
253 nmdc:mga0sz30_16810_c1 3300050516 Bacteria 2910
254 Ga0500635_0004993 3300053080 Bacteria 3454
255 Ga0495619_0113782 3300053085 Bacteria 1851
256 Ga0500651_0109825 3300053093 Bacteria 1684
257 Ga0500557_000050 3300053105 Bacteria 54589
258 Ga0500642_0002479 3300053130 Bacteria 5428
259 Ga0501084_0111389 3300054114 Bacteria 2300
260 Ga0501084_0128130 3300054114 Bacteria 2136
261 Ga0501082_0130395 3300060353 Bacteria 2181
262 Ga0466962_0012820 3300061719 Bacteria 4033
263 Ga0530510_0030765 3300061734 Bacteria 3857
264 2508543383 2508501009 Bacteria 7784016
265 2508698843 2508501042 Bacteria 8719808
266 2509126372 2508501125 Bacteria 7208311
267 2513621073 2513237091 Bacteria 6900273
268 2515628919 2515154112 Bacteria 8294334
269 2551694313 2551306086 Bacteria 6843938
270 2551735092 2551306092 Bacteria 6992595
271 2644149190 2643221626 Bacteria 8069654
272 2644672003 2643221723 Bacteria 7095460
273 2855845992 2855839649 Bacteria 7135830
274 2857546135 2857542790 Bacteria 5326616
275 2858952701 2858950400 Bacteria 6783797
276 2874597436 2874590934 Bacteria 8299676
277 2874648512 2874645413 Bacteria 8214782
278 2876777767 2876771140 Bacteria 8287509
279 2876822474 2876818435 Bacteria 8274608
280 2879078175 2879074833 Bacteria 8279565
281 2879134484 2879127579 Bacteria 8294491
282 2879149981 2879142872 Bacteria 8267021
283 2903729347 2903727486 Bacteria 8281579
284 2921257749 2921257292 Bacteria 6808382
285 2935651853 2935648319 Bacteria 8801166
286 2935660663 2935656913 Bacteria 8965014
287 2935980973 2935975950 Bacteria 8347125
288 2935989580 2935984226 Bacteria 8302647
289 2936014719 2936011229 Bacteria 8801034
290 2936023484 2936019824 Bacteria 8804134
291 2936032512 2936028420 Bacteria 8965941
292 2936050460 2936046547 Bacteria 8903709
293 2936059048 2936055302 Bacteria 8785755
294 2937026993 2937023124 Bacteria 6815156
295 2945940232 2945934425 Bacteria 7444609
296 2957401831 2957395598 Bacteria 6822399
297 2957485940 2957484790 Bacteria 6703082
298 2960622812 2960617483 Bacteria 6727748
299 2964621476 2964615318 Bacteria 6809089
300 2964637334 2964636051 Bacteria 7091832
301 2967761246 2967755722 Bacteria 6814706
302 2967768209 2967762386 Bacteria 6923502
303 2970108150 2970102677 Bacteria 6812532
304 2977524327 2977523885 Bacteria 6960446
305 3004217631 3004211236 Bacteria 7417683
306 3004219978 3004218560 Bacteria 7421728
307 8003997535 8003992118 Bacteria 7266902
308 8016631778 8016630954 Bacteria 9217207
309 8019635208 8019629233 Bacteria 8687553
310 8019644518 8019638758 Bacteria 9062356
311 8019657540 8019648815 Bacteria 10014479
312 8019663052 8019659431 Bacteria 8577854
313 8019672649 8019668869 Bacteria 8791617
314 8019683512 8019678201 Bacteria 8863603
315 8055227307 8055225921 Bacteria 3341787
316 Ga0307407_10005467
317 JGI24740J21852_10014321
318 JGI25156J39149_1001032
319 JGI25151J46595_10031803
320 JGI25153J46596_10000870
321 JGI25153J46596_10059184
322 Ga0055526_1000950
323 Ga0055524_1027513
324 Ga0055536_1007009
325 Ga0055531_10001642
326 Ga0055543_1001756
327 Ga0065165_1006796
328 Ga0070683_100091025
329 Ga0070670_100005250
330 Ga0070670_100023104
331 Ga0070670_100039475
332 Ga0070670_100097924
333 Ga0068869_100006765
334 Ga0070668_100001697
335 Ga0070668_100007090
336 Ga0070668_100024660
337 Ga0070669_100007523
338 Ga0070671_100051322
339 Ga0070674_100031037
340 Ga0070674_100110675
341 Ga0070673_100027633
342 Ga0070673_100029931
343 Ga0070688_100085528
344 Ga0070667_100012423
345 Ga0070667_100376490
346 Ga0070678_100180910
347 Ga0070662_100020661
348 Ga0068867_100036721
349 Ga0068867_100299064
350 Ga0070698_100069315
351 Ga0070697_100008976
352 Ga0070672_100002453
353 Ga0070672_100039031
354 Ga0070672_100136855
355 Ga0070672_100195793
356 Ga0070672_100212780
357 Ga0070686_100349063
358 Ga0070695_100010690
359 Ga0070665_100003283
360 Ga0070665_100025418
361 Ga0070665_100129684
362 Ga0070704_100004664
363 Ga0068855_100115080
364 Ga0068856_100194876
365 Ga0068859_100002711
366 Ga0068864_100001221
367 Ga0068861_100000947
368 Ga0068870_10049295
369 Ga0068863_100005462
370 Ga0068863_100041085
371 Ga0068863_100105124
372 Ga0068858_100001698
373 Ga0068858_100268954
374 Ga0068860_100007624
375 Ga0068860_100121735
376 Ga0068860_100164800
377 Ga0068862_100034597
378 Ga0068862_100190190
379 Ga0081538_10015651
380 Ga0075364_10015268
381 Ga0075369_10020142
382 Ga0075428_100076210
383 Ga0075431_100011241
384 Ga0075431_100032176
385 Ga0075434_100092631
386 Ga0075429_100000007
387 Ga0068865_100053695
388 Ga0097620_100002711
389 Ga0105240_10559459
390 Ga0111539_10292534
391 Ga0111539_10574916
392 Ga0105247_10014134
393 Ga0114129_10016509
394 Ga0114129_10470221
395 Ga0105242_10001842
396 Ga0105248_10083518
397 Ga0105248_10209041
398 Ga0163162_10185804
399 Ga0163163_10035683
400 Ga0157379_10003651
401 Ga0157376_10035554
402 Ga0163161_10014440
403 Ga0213875_10000968
404 Ga0209677_103337
405 Ga0209233_1006918
406 Ga0209676_1000049
407 Ga0209676_1001291
408 Ga0209025_1000337
409 Ga0209564_1000117
410 Ga0209050_1009352
411 Ga0209256_1000352
412 Ga0209051_1035541
413 Ga0209257_1001572
414 Ga0207643_10020693
415 Ga0207705_10074720
416 Ga0207681_10055615
417 Ga0207650_10080158
418 Ga0207650_10099117
419 Ga0207650_10174036
420 Ga0207644_10049532
421 Ga0207686_10002209
422 Ga0207709_10036924
423 Ga0207670_10110397
424 Ga0207691_10004737
425 Ga0207691_10072665
426 Ga0207691_10072686
427 Ga0207691_10128463
428 Ga0207691_10179765
429 Ga0207689_10000689
430 Ga0207667_10113480
431 Ga0207667_10313447
432 Ga0207651_10026174
433 Ga0207651_10207291
434 Ga0207668_10033910
435 Ga0207658_10194886
436 Ga0207677_10054919
437 Ga0207703_10005214
438 Ga0207703_10513972
439 Ga0207702_10169679
440 Ga0207641_10024811
441 Ga0207641_10044170
442 Ga0207641_10047643
443 Ga0207641_10047963
444 Ga0207641_10164405
445 Ga0207648_10037670
446 Ga0207676_10012853
447 Ga0207676_10025667
448 Ga0207675_100020226
449 Ga0207683_10085443
450 Ga0209371_1004646
451 Ga0268266_10033636
452 Ga0268266_10035240
453 Ga0268266_10196046
454 Ga0268265_10010373
455 Ga0268265_10187503
456 Ga0268264_10001909
457 Ga0265324_10001251
458 Ga0265770_1000469
459 Ga0265760_10001236
460 Ga0307408_100065005
461 Ga0307408_100291542
462 Ga0316579_10005398
463 Ga0265314_10067359
464 Ga0316578_10003809
465 Ga0316578_10062597
466 Ga0316577_10024128
467 Ga0307413_10000255
468 Ga0307413_10147891
469 Ga0307410_10002057
470 Ga0307410_10046226
471 Ga0307410_10263371
472 Ga0307406_10002797
473 Ga0307406_10047062
474 Ga0307409_100005627
475 Ga0307416_100014012
476 Ga0307411_10039517
477 Ga0307411_10064884
478 Ga0307411_10121973
479 Ga0307415_100031680
480 Ga0316585_10028944
481 Ga0307510_10016646
482 Ga0373923_0090181
483 Ga0373933_0029109
484 Ga0373937_0043163
485 Ga0316582_0273388
486 Ga0316584_0000145
487 Ga0373925_0004001
488 Ga0316581_0024674
489 Ga0436364_0256383
490 Ga0237819_01102
491 Ga0436365_0736190
492 Ga0453683_0003773
493 Ga0466965_0003588
494 Ga0466964_0000482
495 Ga0466971_0065657
496 Ga0466970_0087199
497 Ga0466957_0005170
498 Ga0451576_0120783
499 Ga0466958_0036428
500 Ga0466967_0017980
501 Ga0466967_0099126
502 Ga0495629_0000023
503 Ga0495638_0010868
504 Ga0495653_0006156
505 Ga0495580_0011501
506 Ga0495582_0104574
507 Ga0495605_0011715
508 Ga0495583_0000946
509 Ga0495583_0013502
510 Ga0495630_0304855
511 Ga0495648_0063520
512 Ga0495652_0189818
513 Ga0495611_0026481
514 Ga0495661_0164981
515 Ga0495646_0040421
516 Ga0495613_0096134
517 Ga0495624_0029063
518 Ga0495624_0186187
519 Ga0495649_0001549
520 Ga0495674_0250823
521 Ga0495679_000022
522 Ga0495593_0056618
523 Ga0495626_0032221
524 Ga0495626_0100012
525 Ga0496102_0002356
526 Ga0496108_0339523
527 Ga0496109_0170130
528 Ga0496109_0290096
529 Ga0496112_0000240
530 Ga0496113_0042005
531 Ga0496115_0121491
532 Ga0496118_0015067
533 Ga0496118_0064402
534 Ga0496119_0069509
535 Ga0496120_0059668
536 Ga0496121_0028871
537 Ga0496124_0000004
538 Ga0495678_033994
539 Ga0501031_0092088
540 Ga0501034_0091085
541 Ga0501034_0160800
542 Ga0501034_0438530
543 Ga0501036_0013709
544 Ga0501038_0110161
545 Ga0501041_0053739
546 Ga0501042_0242801
547 Ga0501046_0118904
548 Ga0501046_0274289
549 Ga0501047_0153191
550 Ga0501048_0062733
551 Ga0501069_0061504
552 Ga0501070_0128074
553 Ga0501071_0050421
554 Ga0501072_0076395
555 Ga0501075_0030313
556 Ga0501075_0314638
557 Ga0501076_0135815
558 Ga0501076_0145357
559 Ga0501077_0061057
560 Ga0501079_0073809
561 Ga0501044_0081559
562 Ga0501045_0016628
563 Ga0501045_0244414
564 nmdc:mga05p37_145_c1
565 nmdc:mga05p37_443549_c1
566 nmdc:mga09592_300_c1
567 nmdc:mga0n895_125126_c1
568 nmdc:mga0sz30_16810_c1
569 Ga0500635_0004993
570 Ga0495619_0113782
571 Ga0500651_0109825
572 Ga0500557_000050
573 Ga0500642_0002479
574 Ga0501084_0111389
575 Ga0501084_0128130
576 Ga0501082_0130395
577 Ga0466962_0012820
578 Ga0530510_0030765
579 2508543383
580 2508698843
581 2509126372
582 2513621073
583 2515628919
584 2551694313
585 2551735092
586 2644149190
587 2644672003
588 2855845992
589 2857546135
590 2858952701
591 2874597436
592 2874648512
593 2876777767
594 2876822474
595 2879078175
596 2879134484
597 2879149981
598 2903729347
599 2921257749
600 2935651853
601 2935660663
602 2935980973
603 2935989580
604 2936014719
605 2936023484
606 2936032512
607 2936050460
608 2936059048
609 2937026993
610 2945940232
611 2957401831
612 2957485940
613 2960622812
614 2964621476
615 2964637334
616 2967761246
617 2967768209
618 2970108150
619 2977524327
620 3004217631
621 3004219978
622 8003997535
623 8016631778
624 8019635208
625 8019644518
626 8019657540
627 8019663052
628 8019672649
629 8019683512
630 8055227307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

243

307

0.98

PF00005

ABC_tran

ABC transporter

33

192

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

128

228

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.9386 1 325
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9349 1 258
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9337 1 254
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9313 1 258
6cvl-assembly1.cif.gz_C crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein 0.9281 3 254
ID Description Score Start End Superfamily
af_P33916_3_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9799 1 259 3.40.50.300
af_P75796_10_305_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9611 1 267 3.40.50.300
af_Q2FVF0_1_268_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9578 1 254 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9572 3 261 3.40.50.300
af_Q2FZR5_3_331_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9554 1 325 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2S9BS46-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9801 13 254 GO:0005524
GO:0005886
GO:0016887
AF-A0A3A0B278-F1-model_v4 Dipeptide/oligopeptide/nickel ABC transporter ATP-binding protein 0.9741 1 202 GO:0005524
GO:0016887
AF-A0A352SRK6-F1-model_v4 Peptide ABC transporter ATP-binding protein 0.973 2 169 GO:0005524
GO:0005886
GO:0016887
AF-A0A853I3Z0-F1-model_v4 deleted 0.97 2 184
AF-A0A545AZY2-F1-model_v4 ABC transporter ATP-binding protein 0.9696 1 254 GO:0005524
GO:0016887

Map