F403178

General Info

Members Datasets Scaffolds Average Seq Length
315 150 311 259

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10368407|Ga0157372_103684072
Length 294
Sequence MAIDLQSVCWNKEHFHRPNRTKLPTTRSNSPMPSTPLHAEEEISSLKERIAALGPWFHNIRLAGVQTAPDHFLGDYPQIKYKRFSDSLPQDLSGKTVLDIGCNGGFYSLEMKRRGADRVLGIDTDDHYLAQARFAAEVSQMDVEFRRMSVWEVGGLNERFDLIIFMGVFYHLRHPLLALDLIHEHVARDLLLFQSMQRGSREIAHVDPDYDFHAEVHFDDPGYPKMHFVEHRYSHDETNWWVPNRACVEAMLRSSGFAIESQPEDEVYICRSIPVEIPPDGPHCVYPARGRSNS

Samples

Sample ID Description Type Environment
1 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
2 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
3 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
4 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
86 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
144 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.02
Metatranscriptomes 5.71
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0.32
Rhizoplane 7.3
Rhizosphere 84.76
Stem 0
Stem Tuber 0
Unclassified 6.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10027561 3300003320 Bacteria 12840
2 rootL2_10123646 3300003322 Bacteria 2925
3 rootH1_10037731 3300003323 Bacteria 3409
4 rootH1_10109929 3300003323 Bacteria 2479
5 Ga0070658_10004165 3300005327 Bacteria 11840
6 Ga0070658_10008140 3300005327 Bacteria 8432
7 Ga0070658_10045108 3300005327 Bacteria 3563
8 Ga0070658_10054436 3300005327 Bacteria 3249
9 Ga0070658_10098883 3300005327 Bacteria 2410
10 Ga0070658_10170603 3300005327 Bacteria 1827
11 Ga0070683_100001653 3300005329 Bacteria 17279
12 Ga0070683_100004696 3300005329 Bacteria 11290
13 Ga0070683_100013006 3300005329 Bacteria 7245
14 Ga0070682_100236817 3300005337 Bacteria 1308
15 Ga0070660_100045348 3300005339 Bacteria 3365
16 Ga0070660_100112654 3300005339 Bacteria 2166
17 Ga0070660_100292130 3300005339 Bacteria 1335
18 Ga0070661_100005762 3300005344 Bacteria 8526
19 Ga0070661_100010015 3300005344 Bacteria 6579
20 Ga0070671_100078723 3300005355 Bacteria 2755
21 Ga0070659_100018994 3300005366 Bacteria 5197
22 Ga0070714_100065169 3300005435 Bacteria 3138
23 Ga0070714_100134362 3300005435 Bacteria 2213
24 Ga0070663_100012694 3300005455 Bacteria 5340
25 Ga0070681_10044178 3300005458 Bacteria 4459
26 Ga0070679_100021610 3300005530 Bacteria 6284
27 Ga0070679_100078483 3300005530 Bacteria 3290
28 Ga0070679_100322660 3300005530 Unclassified 1493
29 Ga0070684_100008163 3300005535 Bacteria 8174
30 Ga0068853_100000645 3300005539 Bacteria 23916
31 Ga0068853_100066507 3300005539 Unclassified 3130
32 Ga0070665_100087607 3300005548 Bacteria 3119
33 Ga0068855_100005800 3300005563 Bacteria 15070
34 Ga0068855_100006032 3300005563 Bacteria 14780
35 Ga0068855_100017111 3300005563 Bacteria 8721
36 Ga0068855_100018498 3300005563 Bacteria 8376
37 Ga0068855_100021972 3300005563 Bacteria 7650
38 Ga0068855_100060232 3300005563 Bacteria 4440
39 Ga0068855_100069438 3300005563 Bacteria 4100
40 Ga0068855_100125480 3300005563 Bacteria 2935
41 Ga0068857_100076739 3300005577 Bacteria 2980
42 Ga0068857_100195722 3300005577 Bacteria 1842
43 Ga0068854_100034282 3300005578 Bacteria 3545
44 Ga0068856_100002433 3300005614 Bacteria 19150
45 Ga0068856_100020304 3300005614 Bacteria 6453
46 Ga0068856_100029739 3300005614 Bacteria 5336
47 Ga0068856_100035204 3300005614 Bacteria 4906
48 Ga0068856_100123150 3300005614 Bacteria 2596
49 Ga0068856_100202220 3300005614 Bacteria 2001
50 Ga0068856_100525490 3300005614 Bacteria 1204
51 Ga0068852_100000027 3300005616 Bacteria 113819
52 Ga0068852_100001198 3300005616 Bacteria 17225
53 Ga0068852_100025823 3300005616 Unclassified 4765
54 Ga0068851_10006212 3300005834 Bacteria 5452
55 Ga0068851_10046798 3300005834 Bacteria 2189
56 Ga0070717_10069114 3300006028 Bacteria 2940
57 Ga0099823_1028728 3300006944 Bacteria 4756
58 Ga0105240_10000002 3300009093 Bacteria 1924170
59 Ga0105240_10000222 3300009093 Bacteria 113825
60 Ga0105240_10021105 3300009093 Bacteria 8670
61 Ga0105240_10024191 3300009093 Bacteria 8015
62 Ga0105240_10035763 3300009093 Bacteria 6397
63 Ga0105240_10048712 3300009093 Bacteria 5353
64 Ga0105240_10172488 3300009093 Bacteria 2560
65 Ga0105241_10000074 3300009174 Bacteria 75523
66 Ga0105241_10002755 3300009174 Bacteria 13168
67 Ga0105241_10002874 3300009174 Bacteria 12868
68 Ga0105237_10004817 3300009545 Bacteria 15502
69 Ga0105238_10000516 3300009551 Bacteria 40563
70 Ga0105238_10005260 3300009551 Bacteria 12797
71 Ga0105238_10012158 3300009551 Bacteria 8674
72 Ga0105238_10065900 3300009551 Bacteria 3623
73 Ga0105238_10100281 3300009551 Bacteria 2879
74 Ga0105238_10102973 3300009551 Bacteria 2836
75 Ga0105239_10034561 3300010375 Bacteria 5552
76 Ga0105239_10097928 3300010375 Bacteria 3242
77 Ga0105239_10349000 3300010375 Bacteria 1670
78 Ga0105239_10942250 3300010375 Unclassified 992
79 Ga0105246_10338912 3300011119 Bacteria 1228
80 Ga0157370_10001610 3300013104 Bacteria 27915
81 Ga0157370_10030278 3300013104 Bacteria 5304
82 Ga0157370_10144247 3300013104 Bacteria 2218
83 Ga0157370_10288022 3300013104 Bacteria 1517
84 Ga0157370_10288861 3300013104 Bacteria 1515
85 Ga0157369_10000112 3300013105 Bacteria 114309
86 Ga0157369_10004670 3300013105 Bacteria 16098
87 Ga0157369_10005663 3300013105 Bacteria 14513
88 Ga0157369_10032098 3300013105 Bacteria 5776
89 Ga0157369_10072665 3300013105 Bacteria 3692
90 Ga0157369_10074155 3300013105 Unclassified 3650
91 Ga0157369_10092307 3300013105 Bacteria 3231
92 Ga0157369_10153416 3300013105 Bacteria 2434
93 Ga0157369_10161090 3300013105 Bacteria 2368
94 Ga0157369_10209860 3300013105 Bacteria 2041
95 Ga0157369_10260979 3300013105 Bacteria 1807
96 Ga0157369_10321087 3300013105 Bacteria 1610
97 Ga0157369_10371063 3300013105 Bacteria 1485
98 Ga0157374_10110829 3300013296 Bacteria 2640
99 Ga0157374_10201947 3300013296 Unclassified 1947
100 Ga0157374_10503147 3300013296 Bacteria 1216
101 Ga0157374_10942817 3300013296 Bacteria 881
102 Ga0157372_10000422 3300013307 Bacteria 46497
103 Ga0157372_10001211 3300013307 Bacteria 27915
104 Ga0157372_10001505 3300013307 Bacteria 25337
105 Ga0157372_10013465 3300013307 Bacteria 8739
106 Ga0157372_10014790 3300013307 Bacteria 8353
107 Ga0157372_10020524 3300013307 Bacteria 7129
108 Ga0157372_10035598 3300013307 Bacteria 5482
109 Ga0157372_10094842 3300013307 Bacteria 3399
110 Ga0157372_10368407 3300013307 Bacteria 1674
111 Ga0163163_10243469 3300014325 Bacteria 1848
112 Ga0197907_10276965 3300020069 Bacteria 2495
113 Ga0206356_11854622 3300020070 Bacteria 2243
114 Ga0206349_1579503 3300020075 Bacteria 1615
115 Ga0206351_10134588 3300020077 Bacteria 3473
116 Ga0206351_10158272 3300020077 Bacteria 3840
117 Ga0206351_10532110 3300020077 Bacteria 1113
118 Ga0206350_10481610 3300020080 Bacteria 1747
119 Ga0206350_11186952 3300020080 Bacteria 949
120 Ga0206350_11441557 3300020080 Bacteria 1213
121 Ga0206350_11490550 3300020080 Bacteria 4155
122 Ga0154015_1224164 3300020610 Bacteria 1052
123 Ga0154015_1510406 3300020610 Bacteria 4423
124 Ga0154015_1575426 3300020610 Bacteria 1549
125 Ga0213872_10000159 3300021361 Bacteria 61788
126 Ga0213872_10037354 3300021361 Bacteria 2217
127 Ga0213872_10048351 3300021361 Bacteria 1933
128 Ga0213874_10006927 3300021377 Bacteria 2700
129 Ga0213876_10001363 3300021384 Bacteria 15279
130 Ga0213876_10002881 3300021384 Bacteria 9990
131 Ga0213871_10003772 3300021441 Bacteria 2963
132 Ga0224712_10003361 3300022467 Bacteria 4146
133 Ga0224712_10033272 3300022467 Bacteria 1885
134 Ga0209677_100828 3300025253 Bacteria 15410
135 Ga0209455_1002604 3300025272 Bacteria 6861
136 Ga0207705_10016369 3300025909 Bacteria 5317
137 Ga0207705_10029850 3300025909 Unclassified 3887
138 Ga0207654_10000380 3300025911 Bacteria 25850
139 Ga0207654_10002712 3300025911 Bacteria 8987
140 Ga0207654_10114732 3300025911 Bacteria 1682
141 Ga0207707_10011452 3300025912 Bacteria 7724
142 Ga0207695_10000002 3300025913 Bacteria 2188391
143 Ga0207695_10000028 3300025913 Bacteria 551835
144 Ga0207695_10003411 3300025913 Bacteria 22444
145 Ga0207695_10006107 3300025913 Bacteria 15714
146 Ga0207695_10020709 3300025913 Bacteria 7525
147 Ga0207695_10053211 3300025913 Bacteria 4235
148 Ga0207695_10155020 3300025913 Unclassified 2226
149 Ga0207695_10618339 3300025913 Bacteria 964
150 Ga0207671_10003647 3300025914 Bacteria 15208
151 Ga0207660_10118600 3300025917 Bacteria 2002
152 Ga0207657_10010380 3300025919 Bacteria 9295
153 Ga0207657_10027138 3300025919 Bacteria 5249
154 Ga0207657_10224928 3300025919 Bacteria 1502
155 Ga0207649_10008237 3300025920 Bacteria 5678
156 Ga0207649_10099619 3300025920 Bacteria 1920
157 Ga0207649_10318469 3300025920 Bacteria 1142
158 Ga0207652_10006209 3300025921 Bacteria 9650
159 Ga0207694_10000160 3300025924 Bacteria 68770
160 Ga0207694_10003078 3300025924 Bacteria 13349
161 Ga0207694_10277280 3300025924 Bacteria 1376
162 Ga0207694_10506667 3300025924 Bacteria 1011
163 Ga0207664_10013192 3300025929 Bacteria 5920
164 Ga0207664_10065928 3300025929 Bacteria 2901
165 Ga0207664_10112994 3300025929 Bacteria 2261
166 Ga0207664_10129824 3300025929 Bacteria 2120
167 Ga0207664_10148409 3300025929 Bacteria 1990
168 Ga0207664_10179942 3300025929 Bacteria 1815
169 Ga0207664_10323935 3300025929 Bacteria 1360
170 Ga0207661_10002715 3300025944 Bacteria 12180
171 Ga0207661_10087320 3300025944 Bacteria 2590
172 Ga0207667_10000056 3300025949 Bacteria 206107
173 Ga0207667_10004966 3300025949 Bacteria 16249
174 Ga0207667_10034201 3300025949 Bacteria 5460
175 Ga0207667_10066880 3300025949 Bacteria 3745
176 Ga0207667_10078951 3300025949 Bacteria 3411
177 Ga0207667_10144585 3300025949 Bacteria 2448
178 Ga0207640_10018996 3300025981 Bacteria 4050
179 Ga0207639_10000145 3300026041 Bacteria 53212
180 Ga0207639_10009789 3300026041 Bacteria 6623
181 Ga0207639_10068772 3300026041 Bacteria 2760
182 Ga0207639_10084866 3300026041 Bacteria 2517
183 Ga0207678_10005705 3300026067 Bacteria 11113
184 Ga0207702_10016469 3300026078 Bacteria 6117
185 Ga0207702_10126598 3300026078 Bacteria 2294
186 Ga0207702_10133810 3300026078 Bacteria 2234
187 Ga0207702_10264079 3300026078 Bacteria 1622
188 Ga0207702_10313237 3300026078 Bacteria 1493
189 Ga0207702_10556737 3300026078 Bacteria 1122
190 Ga0207674_10006143 3300026116 Bacteria 14185
191 Ga0207674_10034456 3300026116 Bacteria 5292
192 Ga0207674_10157023 3300026116 Bacteria 2230
193 Ga0207674_10200589 3300026116 Bacteria 1944
194 Ga0207698_10000021 3300026142 Bacteria 133280
195 Ga0207698_10000738 3300026142 Bacteria 18978
196 Ga0207698_10081891 3300026142 Bacteria 2607
197 Ga0207698_10094295 3300026142 Bacteria 2460
198 Ga0268266_10066435 3300028379 Bacteria 3119
199 Ga0265339_10006604 3300031249 Bacteria 7591
200 Ga0307408_100098304 3300031548 Unclassified 2225
201 Ga0307405_10010522 3300031731 Bacteria 4801
202 Ga0307409_100118300 3300031995 Bacteria 2238
203 Ga0307409_100575509 3300031995 Bacteria 1109
204 Ga0307416_100260242 3300032002 Bacteria 1695
205 Ga0307414_10111363 3300032004 Bacteria 2085
206 Ga0395900_0348954 3300037418 Bacteria 1454
207 Ga0395898_0001253 3300037466 Bacteria 37794
208 Ga0395898_0046500 3300037466 Bacteria 4263
209 Ga0395898_0677545 3300037466 Bacteria 973
210 Ga0436364_0415739 3300037853 Bacteria 2197
211 Ga0436364_0584951 3300037853 Bacteria 1288
212 Ga0436364_0941071 3300037853 Bacteria 4320
213 Ga0436364_1403352 3300037853 Bacteria 2772
214 Ga0436364_1465313 3300037853 Bacteria 2066
215 Ga0395901_0000682 3300038443 Bacteria 38923
216 Ga0395901_0088912 3300038443 Bacteria 3232
217 Ga0395901_0818221 3300038443 Bacteria 919
218 Ga0436365_0320692 3300039437 Bacteria 2853
219 Ga0436365_0546549 3300039437 Bacteria 13799
220 Ga0436365_1793529 3300039437 Bacteria 27914
221 Ga0436360_0024264 3300039438 Bacteria 4072
222 Ga0436360_0066433 3300039438 Bacteria 1509
223 Ga0436360_0551360 3300039438 Bacteria 5805
224 Ga0436361_0265451 3300039447 Bacteria 1011
225 Ga0436361_0335407 3300039447 Bacteria 151349
226 Ga0436361_0449247 3300039447 Bacteria 2846
227 Ga0436361_0533731 3300039447 Bacteria 1298
228 Ga0436361_0619787 3300039447 Bacteria 4625
229 Ga0436361_0861100 3300039447 Bacteria 7498
230 Ga0436363_1530268 3300039450 Bacteria 33359
231 Ga0439431_0014934 3300041997 Bacteria 1804
232 Ga0466969_0161902 3300044656 Bacteria 1028
233 Ga0466966_0015657 3300044684 Bacteria 5014
234 Ga0466966_0282417 3300044684 Bacteria 998
235 Ga0466961_0040006 3300044693 Bacteria 3005
236 Ga0466961_0091914 3300044693 Bacteria 1916
237 Ga0466957_0110189 3300044842 Bacteria 1745
238 Ga0466959_0007015 3300045049 Bacteria 7875
239 Ga0466967_0004335 3300045976 Bacteria 9541
240 Ga0466967_0096954 3300045976 Bacteria 2691
241 Ga0466967_0109883 3300045976 Bacteria 2532
242 Ga0466967_0153675 3300045976 Bacteria 2153
243 Ga0495590_0000721 3300046457 Bacteria 15128
244 Ga0495638_0001239 3300046460 Bacteria 24050
245 Ga0495584_0005454 3300046491 Bacteria 6740
246 Ga0495585_0050800 3300046492 Bacteria 2299
247 Ga0495606_0001733 3300046507 Bacteria 28021
248 Ga0495610_0017689 3300046512 Bacteria 4057
249 Ga0495610_0025663 3300046512 Bacteria 3158
250 Ga0495620_0021742 3300046515 Bacteria 3108
251 Ga0495631_0035010 3300046518 Bacteria 2248
252 Ga0495632_0000379 3300046519 Bacteria 42470
253 Ga0495643_0001666 3300046522 Bacteria 19506
254 Ga0495648_0034342 3300046524 Bacteria 3301
255 Ga0495597_0044005 3300046542 Bacteria 1986
256 Ga0495668_0001340 3300046616 Bacteria 24198
257 Ga0495611_0055724 3300046648 Bacteria 1789
258 Ga0495625_0000382 3300046660 Bacteria 67633
259 Ga0495669_0136003 3300046684 Bacteria 1158
260 Ga0495649_0000693 3300046694 Bacteria 27497
261 Ga0495589_0063896 3300046794 Bacteria 1805
262 Ga0495683_0053035 3300047323 Bacteria 2023
263 Ga0495677_0034045 3300047445 Bacteria 1858
264 Ga0495686_0006188 3300047472 Bacteria 9245
265 Ga0496100_0001256 3300048903 Bacteria 12372
266 Ga0496101_0012155 3300048904 Bacteria 5738
267 Ga0496102_0019791 3300048905 Bacteria 5933
268 Ga0496103_0025348 3300048906 Bacteria 3584
269 Ga0496104_0006034 3300048907 Bacteria 10626
270 Ga0496104_0057750 3300048907 Bacteria 3672
271 Ga0496105_0162822 3300048908 Bacteria 1831
272 Ga0496106_0001479 3300048909 Bacteria 17653
273 Ga0496108_0004513 3300048911 Bacteria 11213
274 Ga0496108_0014345 3300048911 Bacteria 6469
275 Ga0496109_0008617 3300048912 Bacteria 8681
276 Ga0496109_0134709 3300048912 Bacteria 2307
277 Ga0496110_0000924 3300048913 Bacteria 20595
278 Ga0496110_0001281 3300048913 Bacteria 18012
279 Ga0496110_0184069 3300048913 Bacteria 1897
280 Ga0496110_0397100 3300048913 Bacteria 1257
281 Ga0496111_0015758 3300048914 Bacteria 5198
282 Ga0496111_0029260 3300048914 Bacteria 3911
283 Ga0496112_0004028 3300048915 Bacteria 12326
284 Ga0496112_0014305 3300048915 Bacteria 7352
285 Ga0496112_0115143 3300048915 Bacteria 2659
286 Ga0496113_0061388 3300048916 Bacteria 2836
287 Ga0496113_0062874 3300048916 Bacteria 2804
288 Ga0496118_0034733 3300048921 Bacteria 4108
289 Ga0496121_0063271 3300048924 Bacteria 3024
290 Ga0501034_0000320 3300049571 Bacteria 84295
291 Ga0501046_0059867 3300049580 Bacteria 2982
292 Ga0501047_0037140 3300049581 Bacteria 4710
293 Ga0501048_0152988 3300049582 Bacteria 1632
294 Ga0501068_0218300 3300049584 Bacteria 1212
295 Ga0501069_0018504 3300049585 Bacteria 3760
296 Ga0501070_0283409 3300049586 Bacteria 1351
297 Ga0501070_0477104 3300049586 Bacteria 1003
298 Ga0501071_0049777 3300049587 Bacteria 3017
299 Ga0501071_0217236 3300049587 Bacteria 1438
300 Ga0501074_0068995 3300049590 Bacteria 2542
301 Ga0501079_0266115 3300049741 Bacteria 1340
302 Ga0501035_0088996 3300049822 Bacteria 2720
303 Ga0501044_0000155 3300049823 Bacteria 84608
304 Ga0495655_0033284 3300053083 Bacteria 1267
305 Ga0500556_0000207 3300053104 Bacteria 48431
306 Ga0500658_0029177 3300053134 Bacteria 2144
307 Ga0590075_015318 3300059424 Bacteria 1881
308 Ga0587073_0001765 3300059492 Bacteria 2623
309 Ga0587082_015372 3300059504 Bacteria 1181
310 Ga0587072_030710 3300059643 Bacteria 1002
311 Ga0501082_0057377 3300060353 Bacteria 3355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_10942250 Ga0105239_109422502 237
2 3300005548 Ga0070665_100087607 Ga0070665_1000876073 238
3 3300028379 Ga0268266_10066435 Ga0268266_100664352 238
4 3300020080 Ga0206350_11186952 Ga0206350_111869521 240
5 3300025929 Ga0207664_10323935 Ga0207664_103239352 240
6 3300021361 Ga0213872_10000159 Ga0213872_1000015920 242
7 3300039447 Ga0436361_0335407 Ga0436361_0335407_110717_111454 242
8 3300044693 Ga0466961_0040006 Ga0466961_0040006_171_953 242
9 3300049581 Ga0501047_0037140 Ga0501047_0037140_2031_2768 242
10 3300049822 Ga0501035_0088996 Ga0501035_0088996_1654_2391 242
11 3300049823 Ga0501044_0000155 Ga0501044_0000155_51521_52258 242
12 3300009093 Ga0105240_10035763 Ga0105240_100357632 243
13 3300013104 Ga0157370_10030278 Ga0157370_100302786 243
14 3300013105 Ga0157369_10161090 Ga0157369_101610902 243
15 3300013307 Ga0157372_10000422 Ga0157372_1000042213 243
16 3300003322 rootL2_10123646 rootL2_101236464 244
17 3300049590 Ga0501074_0068995 Ga0501074_0068995_1159_1908 244
18 iso_pu_bacteria 2883577096 2883579765 247
19 3300005355 Ga0070671_100078723 Ga0070671_1000787233 248
20 3300031731 Ga0307405_10010522 Ga0307405_100105222 248
21 3300049584 Ga0501068_0218300 Ga0501068_0218300_47_793 248
22 3300049585 Ga0501069_0018504 Ga0501069_0018504_2695_3441 248
23 3300049586 Ga0501070_0283409 Ga0501070_0283409_304_1050 248
24 3300049586 Ga0501070_0477104 Ga0501070_0477104_77_823 248
25 3300049587 Ga0501071_0049777 Ga0501071_0049777_1519_2265 248
26 3300060353 Ga0501082_0057377 Ga0501082_0057377_2070_2816 248
27 iso_pu_bacteria 2902405164 2902405481 248
28 3300025913 Ga0207695_10020709 Ga0207695_100207094 249
29 iso_pu_bacteria 2844533157 2844535517 249
30 3300003323 rootH1_10037731 rootH1_100377312 250
31 3300053104 Ga0500556_0000207 Ga0500556_0000207_14322_15074 250
32 iso_pu_bacteria 2919450847 2919456055 250
33 3300037466 Ga0395898_0001253 Ga0395898_0001253_18587_19342 251
34 3300037853 Ga0436364_0941071 Ga0436364_0941071_1170_1943 251
35 3300038443 Ga0395901_0000682 Ga0395901_0000682_19716_20471 251
36 3300048913 Ga0496110_0184069 Ga0496110_0184069_199_966 251
37 3300005614 Ga0068856_100123150 Ga0068856_1001231503 252
38 3300014325 Ga0163163_10243469 Ga0163163_102434693 252
39 3300021377 Ga0213874_10006927 Ga0213874_100069273 252
40 3300021384 Ga0213876_10001363 Ga0213876_1000136312 252
41 3300031548 Ga0307408_100098304 Ga0307408_1000983041 252
42 3300037853 Ga0436364_0415739 Ga0436364_0415739_426_1184 252
43 3300037853 Ga0436364_0584951 Ga0436364_0584951_11_769 252
44 3300037853 Ga0436364_1403352 Ga0436364_1403352_1134_1892 252
45 3300039437 Ga0436365_0320692 Ga0436365_0320692_829_1587 252
46 3300039437 Ga0436365_1793529 Ga0436365_1793529_8825_9583 252
47 3300039450 Ga0436363_1530268 Ga0436363_1530268_15481_16239 252
48 3300044656 Ga0466969_0161902 Ga0466969_0161902_128_886 252
49 3300044684 Ga0466966_0015657 Ga0466966_0015657_3467_4225 252
50 3300045049 Ga0466959_0007015 Ga0466959_0007015_3084_3842 252
51 3300041997 Ga0439431_0014934 Ga0439431_0014934_329_1090 253
52 3300046512 Ga0495610_0017689 Ga0495610_0017689_1919_2680 253
53 3300048913 Ga0496110_0397100 Ga0496110_0397100_346_1107 253
54 3300048915 Ga0496112_0115143 Ga0496112_0115143_1819_2580 253
55 3300025253 Ga0209677_100828 Ga0209677_1008285 254
56 3300025272 Ga0209455_1002604 Ga0209455_10026043 254
57 3300025929 Ga0207664_10179942 Ga0207664_101799421 254
58 3300032002 Ga0307416_100260242 Ga0307416_1002602422 254
59 3300032004 Ga0307414_10111363 Ga0307414_101113632 254
60 3300037466 Ga0395898_0677545 Ga0395898_0677545_69_833 254
61 3300037853 Ga0436364_1465313 Ga0436364_1465313_78_842 254
62 3300038443 Ga0395901_0088912 Ga0395901_0088912_813_1577 254
63 3300038443 Ga0395901_0818221 Ga0395901_0818221_81_854 254
64 3300039447 Ga0436361_0533731 Ga0436361_0533731_82_846 254
65 3300044842 Ga0466957_0110189 Ga0466957_0110189_586_1350 254
66 3300045976 Ga0466967_0096954 Ga0466967_0096954_1784_2548 254
67 3300045976 Ga0466967_0153675 Ga0466967_0153675_961_1725 254
68 3300046457 Ga0495590_0000721 Ga0495590_0000721_8832_9596 254
69 3300046460 Ga0495638_0001239 Ga0495638_0001239_11913_12677 254
70 3300046491 Ga0495584_0005454 Ga0495584_0005454_5411_6175 254
71 3300046492 Ga0495585_0050800 Ga0495585_0050800_473_1237 254
72 3300046507 Ga0495606_0001733 Ga0495606_0001733_16533_17297 254
73 3300046512 Ga0495610_0025663 Ga0495610_0025663_1775_2539 254
74 3300046515 Ga0495620_0021742 Ga0495620_0021742_1178_1942 254
75 3300046518 Ga0495631_0035010 Ga0495631_0035010_1459_2223 254
76 3300046519 Ga0495632_0000379 Ga0495632_0000379_20293_21057 254
77 3300046522 Ga0495643_0001666 Ga0495643_0001666_8766_9530 254
78 3300046524 Ga0495648_0034342 Ga0495648_0034342_1431_2195 254
79 3300046542 Ga0495597_0044005 Ga0495597_0044005_786_1550 254
80 3300046616 Ga0495668_0001340 Ga0495668_0001340_4160_4924 254
81 3300046648 Ga0495611_0055724 Ga0495611_0055724_848_1612 254
82 3300046660 Ga0495625_0000382 Ga0495625_0000382_50256_51020 254
83 3300046684 Ga0495669_0136003 Ga0495669_0136003_318_1082 254
84 3300046694 Ga0495649_0000693 Ga0495649_0000693_15360_16124 254
85 3300046794 Ga0495589_0063896 Ga0495589_0063896_476_1240 254
86 3300047323 Ga0495683_0053035 Ga0495683_0053035_749_1513 254
87 3300047445 Ga0495677_0034045 Ga0495677_0034045_722_1486 254
88 3300048921 Ga0496118_0034733 Ga0496118_0034733_1402_2166 254
89 3300048924 Ga0496121_0063271 Ga0496121_0063271_2040_2804 254
90 3300053083 Ga0495655_0033284 Ga0495655_0033284_368_1132 254
91 3300053134 Ga0500658_0029177 Ga0500658_0029177_596_1360 254
92 3300006944 Ga0099823_1028728 Ga0099823_10287282 255
93 3300011119 Ga0105246_10338912 Ga0105246_103389122 255
94 3300025913 Ga0207695_10618339 Ga0207695_106183392 255
95 3300026078 Ga0207702_10133810 Ga0207702_101338102 255
96 3300031249 Ga0265339_10006604 Ga0265339_100066042 255
97 3300048903 Ga0496100_0001256 Ga0496100_0001256_865_1632 255
98 3300048904 Ga0496101_0012155 Ga0496101_0012155_3620_4387 255
99 3300048905 Ga0496102_0019791 Ga0496102_0019791_3455_4222 255
100 3300048906 Ga0496103_0025348 Ga0496103_0025348_1293_2060 255
101 3300048907 Ga0496104_0006034 Ga0496104_0006034_5980_6747 255
102 3300048907 Ga0496104_0057750 Ga0496104_0057750_29_796 255
103 3300048908 Ga0496105_0162822 Ga0496105_0162822_108_944 255
104 3300048909 Ga0496106_0001479 Ga0496106_0001479_9294_10061 255
105 3300048911 Ga0496108_0004513 Ga0496108_0004513_4758_5594 255
106 3300048911 Ga0496108_0014345 Ga0496108_0014345_3997_4764 255
107 3300048912 Ga0496109_0008617 Ga0496109_0008617_6401_7237 255
108 3300048912 Ga0496109_0134709 Ga0496109_0134709_945_1712 255
109 3300048913 Ga0496110_0000924 Ga0496110_0000924_17703_18539 255
110 3300048913 Ga0496110_0001281 Ga0496110_0001281_3870_4637 255
111 3300048914 Ga0496111_0015758 Ga0496111_0015758_1629_2396 255
112 3300048914 Ga0496111_0029260 Ga0496111_0029260_225_992 255
113 3300048915 Ga0496112_0004028 Ga0496112_0004028_11124_11891 255
114 3300048915 Ga0496112_0014305 Ga0496112_0014305_3566_4333 255
115 3300048916 Ga0496113_0061388 Ga0496113_0061388_1632_2399 255
116 3300048916 Ga0496113_0062874 Ga0496113_0062874_415_1182 255
117 3300059424 Ga0590075_015318 Ga0590075_015318_1021_1800 255
118 3300031995 Ga0307409_100575509 Ga0307409_1005755092 256
119 3300039438 Ga0436360_0024264 Ga0436360_0024264_2169_2942 256
120 3300049580 Ga0501046_0059867 Ga0501046_0059867_1923_2702 256
121 3300049582 Ga0501048_0152988 Ga0501048_0152988_679_1458 256
122 3300049587 Ga0501071_0217236 Ga0501071_0217236_618_1397 256
123 3300049741 Ga0501079_0266115 Ga0501079_0266115_301_1080 256
124 3300026067 Ga0207678_10005705 Ga0207678_100057058 257
125 3300005344 Ga0070661_100010015 Ga0070661_1000100153 258
126 3300005366 Ga0070659_100018994 Ga0070659_1000189944 258
127 3300005435 Ga0070714_100134362 Ga0070714_1001343622 258
128 3300005563 Ga0068855_100005800 Ga0068855_1000058004 258
129 3300005614 Ga0068856_100525490 Ga0068856_1005254902 258
130 3300009093 Ga0105240_10172488 Ga0105240_101724882 258
131 3300013104 Ga0157370_10144247 Ga0157370_101442472 258
132 3300013105 Ga0157369_10209860 Ga0157369_102098602 258
133 3300021361 Ga0213872_10037354 Ga0213872_100373542 258
134 3300021441 Ga0213871_10003772 Ga0213871_100037724 258
135 3300025919 Ga0207657_10027138 Ga0207657_100271385 258
136 3300025920 Ga0207649_10099619 Ga0207649_100996192 258
137 3300025929 Ga0207664_10065928 Ga0207664_100659282 258
138 3300025949 Ga0207667_10004966 Ga0207667_1000496610 258
139 3300026078 Ga0207702_10556737 Ga0207702_105567372 258
140 3300039438 Ga0436360_0551360 Ga0436360_0551360_2866_3648 258
141 3300039447 Ga0436361_0449247 Ga0436361_0449247_1155_1937 258
142 3300049571 Ga0501034_0000320 Ga0501034_0000320_38104_38889 258
143 3300020077 Ga0206351_10532110 Ga0206351_105321102 259
144 3300020610 Ga0154015_1575426 Ga0154015_15754262 259
145 3300021361 Ga0213872_10048351 Ga0213872_100483512 259
146 3300031995 Ga0307409_100118300 Ga0307409_1001183002 259
147 3300039438 Ga0436360_0066433 Ga0436360_0066433_173_958 259
148 3300039447 Ga0436361_0265451 Ga0436361_0265451_107_892 259
149 3300039447 Ga0436361_0619787 Ga0436361_0619787_1545_2330 259
150 3300039447 Ga0436361_0861100 Ga0436361_0861100_4868_5689 259
151 3300005327 Ga0070658_10004165 Ga0070658_100041655 260
152 3300005327 Ga0070658_10008140 Ga0070658_100081402 260
153 3300005327 Ga0070658_10098883 Ga0070658_100988833 260
154 3300005339 Ga0070660_100112654 Ga0070660_1001126542 260
155 3300005455 Ga0070663_100012694 Ga0070663_1000126942 260
156 3300005563 Ga0068855_100006032 Ga0068855_1000060327 260
157 3300005563 Ga0068855_100017111 Ga0068855_1000171113 260
158 3300005614 Ga0068856_100202220 Ga0068856_1002022202 260
159 3300005616 Ga0068852_100000027 Ga0068852_10000002720 260
160 3300009093 Ga0105240_10000002 Ga0105240_10000002283 260
161 3300009093 Ga0105240_10000222 Ga0105240_1000022219 260
162 3300009551 Ga0105238_10100281 Ga0105238_101002812 260
163 3300009551 Ga0105238_10102973 Ga0105238_101029733 260
164 3300010375 Ga0105239_10349000 Ga0105239_103490002 260
165 3300013104 Ga0157370_10001610 Ga0157370_1000161019 260
166 3300013105 Ga0157369_10000112 Ga0157369_1000011220 260
167 3300013105 Ga0157369_10092307 Ga0157369_100923072 260
168 3300013105 Ga0157369_10321087 Ga0157369_103210872 260
169 3300013296 Ga0157374_10201947 Ga0157374_102019472 260
170 3300013296 Ga0157374_10503147 Ga0157374_105031472 260
171 3300013307 Ga0157372_10001211 Ga0157372_1000121119 260
172 3300013307 Ga0157372_10014790 Ga0157372_100147902 260
173 3300013307 Ga0157372_10020524 Ga0157372_100205244 260
174 3300013307 Ga0157372_10094842 Ga0157372_100948422 260
175 3300020080 Ga0206350_11490550 Ga0206350_114905503 260
176 3300025913 Ga0207695_10000002 Ga0207695_10000002285 260
177 3300025913 Ga0207695_10000028 Ga0207695_10000028199 260
178 3300025919 Ga0207657_10224928 Ga0207657_102249281 260
179 3300026041 Ga0207639_10009789 Ga0207639_100097892 260
180 3300026078 Ga0207702_10264079 Ga0207702_102640792 260
181 3300026142 Ga0207698_10000021 Ga0207698_10000021104 260
182 3300026142 Ga0207698_10094295 Ga0207698_100942952 260
183 3300044684 Ga0466966_0282417 Ga0466966_0282417_180_962 260
184 3300045976 Ga0466967_0004335 Ga0466967_0004335_6123_6908 260
185 3300047472 Ga0495686_0006188 Ga0495686_0006188_2521_3303 260
186 3300005530 Ga0070679_100322660 Ga0070679_1003226602 261
187 3300013104 Ga0157370_10288022 Ga0157370_102880222 261
188 3300013307 Ga0157372_10035598 Ga0157372_100355984 261
189 3300020075 Ga0206349_1579503 Ga0206349_15795032 261
190 3300020077 Ga0206351_10134588 Ga0206351_101345884 261
191 3300020080 Ga0206350_11441557 Ga0206350_114415572 261
192 3300021384 Ga0213876_10002881 Ga0213876_100028818 261
193 3300025929 Ga0207664_10129824 Ga0207664_101298241 261
194 3300025929 Ga0207664_10148409 Ga0207664_101484092 261
195 3300026078 Ga0207702_10313237 Ga0207702_103132372 261
196 3300037418 Ga0395900_0348954 Ga0395900_0348954_241_1026 261
197 3300039437 Ga0436365_0546549 Ga0436365_0546549_4961_5824 261
198 3300045976 Ga0466967_0109883 Ga0466967_0109883_1199_1984 261
199 3300003323 rootH1_10109929 rootH1_101099293 262
200 3300005327 Ga0070658_10045108 Ga0070658_100451083 262
201 3300005327 Ga0070658_10170603 Ga0070658_101706032 262
202 3300005329 Ga0070683_100001653 Ga0070683_10000165315 262
203 3300005329 Ga0070683_100004696 Ga0070683_1000046963 262
204 3300005329 Ga0070683_100013006 Ga0070683_1000130065 262
205 3300005337 Ga0070682_100236817 Ga0070682_1002368172 262
206 3300005339 Ga0070660_100292130 Ga0070660_1002921302 262
207 3300005344 Ga0070661_100005762 Ga0070661_1000057624 262
208 3300005435 Ga0070714_100065169 Ga0070714_1000651693 262
209 3300005535 Ga0070684_100008163 Ga0070684_1000081634 262
210 3300005539 Ga0068853_100000645 Ga0068853_10000064521 262
211 3300005563 Ga0068855_100021972 Ga0068855_1000219726 262
212 3300005563 Ga0068855_100060232 Ga0068855_1000602323 262
213 3300005563 Ga0068855_100069438 Ga0068855_1000694385 262
214 3300005563 Ga0068855_100125480 Ga0068855_1001254802 262
215 3300005577 Ga0068857_100076739 Ga0068857_1000767393 262
216 3300005577 Ga0068857_100195722 Ga0068857_1001957222 262
217 3300005578 Ga0068854_100034282 Ga0068854_1000342822 262
218 3300005614 Ga0068856_100020304 Ga0068856_1000203044 262
219 3300005614 Ga0068856_100029739 Ga0068856_1000297395 262
220 3300005614 Ga0068856_100035204 Ga0068856_1000352043 262
221 3300005616 Ga0068852_100001198 Ga0068852_1000011988 262
222 3300005616 Ga0068852_100025823 Ga0068852_1000258235 262
223 3300005834 Ga0068851_10006212 Ga0068851_100062125 262
224 3300005834 Ga0068851_10046798 Ga0068851_100467982 262
225 3300006028 Ga0070717_10069114 Ga0070717_100691142 262
226 3300009093 Ga0105240_10021105 Ga0105240_100211056 262
227 3300009093 Ga0105240_10024191 Ga0105240_100241914 262
228 3300009093 Ga0105240_10048712 Ga0105240_100487122 262
229 3300009174 Ga0105241_10000074 Ga0105241_100000747 262
230 3300009174 Ga0105241_10002755 Ga0105241_100027552 262
231 3300009174 Ga0105241_10002874 Ga0105241_1000287410 262
232 3300009545 Ga0105237_10004817 Ga0105237_100048174 262
233 3300009551 Ga0105238_10005260 Ga0105238_100052609 262
234 3300009551 Ga0105238_10012158 Ga0105238_100121583 262
235 3300009551 Ga0105238_10065900 Ga0105238_100659003 262
236 3300010375 Ga0105239_10034561 Ga0105239_100345617 262
237 3300010375 Ga0105239_10097928 Ga0105239_100979282 262
238 3300013104 Ga0157370_10288861 Ga0157370_102888612 262
239 3300013105 Ga0157369_10004670 Ga0157369_1000467010 262
240 3300013105 Ga0157369_10005663 Ga0157369_100056633 262
241 3300013105 Ga0157369_10032098 Ga0157369_100320984 262
242 3300013105 Ga0157369_10072665 Ga0157369_100726654 262
243 3300013105 Ga0157369_10153416 Ga0157369_101534163 262
244 3300013105 Ga0157369_10260979 Ga0157369_102609792 262
245 3300013105 Ga0157369_10371063 Ga0157369_103710632 262
246 3300013296 Ga0157374_10110829 Ga0157374_101108292 262
247 3300013296 Ga0157374_10942817 Ga0157374_109428172 262
248 3300013307 Ga0157372_10001505 Ga0157372_1000150516 262
249 3300013307 Ga0157372_10013465 Ga0157372_100134656 262
250 3300013307 Ga0157372_10368407 Ga0157372_103684072 262
251 3300020070 Ga0206356_11854622 Ga0206356_118546223 262
252 3300020077 Ga0206351_10158272 Ga0206351_101582723 262
253 3300020610 Ga0154015_1510406 Ga0154015_15104062 262
254 3300022467 Ga0224712_10003361 Ga0224712_100033612 262
255 3300025909 Ga0207705_10016369 Ga0207705_100163695 262
256 3300025911 Ga0207654_10000380 Ga0207654_100003807 262
257 3300025911 Ga0207654_10002712 Ga0207654_100027123 262
258 3300025911 Ga0207654_10114732 Ga0207654_101147322 262
259 3300025913 Ga0207695_10003411 Ga0207695_100034115 262
260 3300025913 Ga0207695_10053211 Ga0207695_100532114 262
261 3300025913 Ga0207695_10155020 Ga0207695_101550202 262
262 3300025914 Ga0207671_10003647 Ga0207671_1000364711 262
263 3300025917 Ga0207660_10118600 Ga0207660_101186002 262
264 3300025920 Ga0207649_10008237 Ga0207649_100082373 262
265 3300025920 Ga0207649_10318469 Ga0207649_103184692 262
266 3300025924 Ga0207694_10000160 Ga0207694_100001604 262
267 3300025924 Ga0207694_10277280 Ga0207694_102772802 262
268 3300025924 Ga0207694_10506667 Ga0207694_105066672 262
269 3300025929 Ga0207664_10013192 Ga0207664_100131925 262
270 3300025929 Ga0207664_10112994 Ga0207664_101129943 262
271 3300025944 Ga0207661_10002715 Ga0207661_100027153 262
272 3300025944 Ga0207661_10087320 Ga0207661_100873203 262
273 3300025949 Ga0207667_10034201 Ga0207667_100342013 262
274 3300025949 Ga0207667_10066880 Ga0207667_100668803 262
275 3300025949 Ga0207667_10078951 Ga0207667_100789514 262
276 3300025949 Ga0207667_10144585 Ga0207667_101445852 262
277 3300025981 Ga0207640_10018996 Ga0207640_100189963 262
278 3300026041 Ga0207639_10000145 Ga0207639_1000014548 262
279 3300026041 Ga0207639_10068772 Ga0207639_100687723 262
280 3300026041 Ga0207639_10084866 Ga0207639_100848663 262
281 3300026078 Ga0207702_10016469 Ga0207702_100164695 262
282 3300026078 Ga0207702_10126598 Ga0207702_101265982 262
283 3300026116 Ga0207674_10006143 Ga0207674_100061432 262
284 3300026116 Ga0207674_10034456 Ga0207674_100344562 262
285 3300026116 Ga0207674_10200589 Ga0207674_102005892 262
286 3300026142 Ga0207698_10000738 Ga0207698_1000073811 262
287 3300026142 Ga0207698_10081891 Ga0207698_100818913 262
288 3300037466 Ga0395898_0046500 Ga0395898_0046500_1043_1831 262
289 3300044693 Ga0466961_0091914 Ga0466961_0091914_720_1508 262
290 3300059492 Ga0587073_0001765 Ga0587073_0001765_1592_2383 262
291 3300059504 Ga0587082_015372 Ga0587082_015372_61_852 262
292 3300059643 Ga0587072_030710 Ga0587072_030710_147_938 262
293 3300003320 rootH2_10027561 rootH2_100275617 263
294 3300005327 Ga0070658_10054436 Ga0070658_100544362 263
295 3300005339 Ga0070660_100045348 Ga0070660_1000453483 263
296 3300005458 Ga0070681_10044178 Ga0070681_100441782 263
297 3300005530 Ga0070679_100021610 Ga0070679_1000216107 263
298 3300005530 Ga0070679_100078483 Ga0070679_1000784834 263
299 3300005539 Ga0068853_100066507 Ga0068853_1000665073 263
300 3300005563 Ga0068855_100018498 Ga0068855_1000184988 263
301 3300005614 Ga0068856_100002433 Ga0068856_1000024337 263
302 3300009551 Ga0105238_10000516 Ga0105238_1000051617 263
303 3300013105 Ga0157369_10074155 Ga0157369_100741553 263
304 3300020069 Ga0197907_10276965 Ga0197907_102769652 263
305 3300020080 Ga0206350_10481610 Ga0206350_104816102 263
306 3300020610 Ga0154015_1224164 Ga0154015_12241642 263
307 3300022467 Ga0224712_10033272 Ga0224712_100332722 263
308 3300025909 Ga0207705_10029850 Ga0207705_100298504 263
309 3300025912 Ga0207707_10011452 Ga0207707_100114523 263
310 3300025913 Ga0207695_10006107 Ga0207695_100061073 263
311 3300025919 Ga0207657_10010380 Ga0207657_100103808 263
312 3300025921 Ga0207652_10006209 Ga0207652_100062093 263
313 3300025924 Ga0207694_10003078 Ga0207694_100030782 263
314 3300025949 Ga0207667_10000056 Ga0207667_1000005688 263
315 3300026116 Ga0207674_10157023 Ga0207674_101570232 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

98

193

0.93

PF13649

Methyltransf_25

Methyltransferase domain

97

189

0.9

PF13847

Methyltransf_31

Methyltransferase domain

91

213

0.87

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

7

208

0.82

PF13489

Methyltransf_23

Methyltransferase domain

71

262

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8497 63 133
4kwc-assembly1.cif.gz_A structure of the plantazolicin methyltransferase bpuml in complex with sah 0.849 63 165
1n2x-assembly2.cif.gz_B crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.8482 61 133
5dnk-assembly1.cif.gz_B the structure of pkmt1 from rickettsia prowazekii in complex with adohcy 0.8344 59 163
3mgg-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina mazei 0.8273 49 165
ID Description Score Start End Superfamily
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8955 60 114 3.40.50.150
af_I1JDM5_91_303_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8767 60 155 3.40.50.150
af_Q55C78_181_338_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8735 60 137 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8733 56 124 3.40.50.150
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8587 49 155 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4Q2YU95-F1-model_v4 TIGR04290 family methyltransferase 0.9869 65 243 GO:0008168
GO:0032259
AF-A0A7W1SGT1-F1-model_v4 DUF1698 domain-containing protein 0.9693 12 106
AF-A0A7W0FNL2-F1-model_v4 TIGR04290 family methyltransferase 0.9682 8 243 GO:0008168
GO:0032259
AF-A0A1Q6XGG7-F1-model_v4 Methyltransferase, TIGR04290 family 0.9671 16 244 GO:0008168
GO:0032259
AF-A0A4Q3NU32-F1-model_v4 deleted 0.964 124 242

Feature Viewer

pLDDT pTM Quality
89.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map