F403123

General Info

Members Datasets Scaffolds Average Seq Length
315 191 630 363

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100267813|Ga0075430_1002678132
Length 375
Sequence MLHRDAEMSRGAARARLLHHVSRAGRTTRTSPPPDQTAASAGLQYVTDHLPGIRRQRVGGSILRDAKTLQRIRSLAIPPAWTDVWICPHPLGHLQATGRDARRRKQHRYHPRWRQVRDEAKYDRILDFAAALPAIRKHVGADLTEQKLSRNKVVAAVVQLLEKTAIRVGNDEYARDNKSYGLTTLRDAHAQVSGATIHFKFRGKSGKFHDISFSDARLARIVRRCQELPGRELFQYLDDDGQVQDLNSADVNQYLREVTGRDFTAKDFRTWMGTVLAARALQEMTAFASDSQGKRNVLKAIEAVAGILGNTRSVCRKCYVHPAIIDSYLDRTLAQALSARGGQRLAGPHDLNRTETAVLALLQRRLRRDPQRRSA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 3.81
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100267813 3300006846 Unclassified 1414
2 rootH1_10245768 3300003323 Bacteria 2139
3 Ga0065165_1000285 3300005262 Bacteria 86006
4 Ga0065712_10001802 3300005290 Bacteria 5422
5 Ga0070676_10027290 3300005328 Bacteria 3237
6 Ga0070676_10035061 3300005328 Bacteria 2884
7 Ga0070676_10128601 3300005328 Bacteria 1599
8 Ga0070690_100000222 3300005330 Bacteria 29660
9 Ga0070670_100003113 3300005331 Bacteria 13725
10 Ga0070670_100147149 3300005331 Bacteria 2038
11 Ga0070677_10000661 3300005333 Bacteria 11494
12 Ga0070677_10034359 3300005333 Bacteria 1958
13 Ga0068869_100000439 3300005334 Bacteria 22722
14 Ga0068869_100031861 3300005334 Bacteria 3712
15 Ga0070666_10024192 3300005335 Bacteria 3956
16 Ga0070666_10057994 3300005335 Bacteria 2617
17 Ga0070680_100001192 3300005336 Bacteria 18734
18 Ga0070680_100040463 3300005336 Bacteria 3774
19 Ga0070682_100003417 3300005337 Bacteria 8802
20 Ga0068868_100006759 3300005338 Bacteria 8147
21 Ga0068868_100145728 3300005338 Bacteria 1947
22 Ga0070660_100069405 3300005339 Bacteria 2748
23 Ga0070689_100000393 3300005340 Bacteria 25619
24 Ga0070689_100134160 3300005340 Bacteria 1987
25 Ga0070689_100157960 3300005340 Bacteria 1831
26 Ga0070691_10000347 3300005341 Bacteria 16486
27 Ga0070687_100000062 3300005343 Bacteria 34854
28 Ga0070661_100040196 3300005344 Bacteria 3411
29 Ga0070668_100009069 3300005347 Bacteria 7388
30 Ga0070668_100047235 3300005347 Bacteria 3309
31 Ga0070669_100067299 3300005353 Bacteria 2642
32 Ga0070675_100018698 3300005354 Bacteria 5517
33 Ga0070675_100137727 3300005354 Unclassified 2084
34 Ga0070675_100140953 3300005354 Bacteria 2061
35 Ga0070674_100000108 3300005356 Bacteria 38454
36 Ga0070688_100005813 3300005365 Bacteria 6528
37 Ga0070659_100015120 3300005366 Bacteria 5773
38 Ga0070667_100083564 3300005367 Bacteria 2735
39 Ga0070714_100002907 3300005435 Bacteria 12666
40 Ga0070701_10000270 3300005438 Bacteria 16952
41 Ga0070705_100000697 3300005440 Bacteria 19149
42 Ga0070700_100003414 3300005441 Bacteria 8182
43 Ga0070694_100000045 3300005444 Bacteria 57135
44 Ga0070678_100046115 3300005456 Bacteria 3123
45 Ga0070678_100054004 3300005456 Bacteria 2925
46 Ga0070678_100160904 3300005456 Bacteria 1819
47 Ga0070681_10022240 3300005458 Bacteria 6365
48 Ga0068867_100000192 3300005459 Bacteria 40328
49 Ga0068867_100033973 3300005459 Bacteria 3696
50 Ga0068867_100043959 3300005459 Unclassified 3271
51 Ga0068867_100060095 3300005459 Bacteria 2818
52 Ga0068867_100150604 3300005459 Unclassified 1827
53 Ga0068867_100300402 3300005459 Bacteria 1323
54 Ga0070685_10014176 3300005466 Bacteria 4216
55 Ga0070685_10049126 3300005466 Bacteria 2433
56 Ga0070699_100219098 3300005518 Bacteria 1696
57 Ga0070679_100003602 3300005530 Bacteria 14152
58 Ga0070679_100029621 3300005530 Bacteria 5400
59 Ga0068853_100012942 3300005539 Bacteria 6800
60 Ga0068853_100053228 3300005539 Bacteria 3486
61 Ga0068853_100088074 3300005539 Bacteria 2725
62 Ga0070672_100024144 3300005543 Bacteria 4488
63 Ga0070672_100081638 3300005543 Bacteria 2592
64 Ga0070672_100152605 3300005543 Archaea 1911
65 Ga0070672_100175798 3300005543 Bacteria 1782
66 Ga0070686_100000427 3300005544 Bacteria 26443
67 Ga0070695_100000638 3300005545 Bacteria 18585
68 Ga0070696_100001053 3300005546 Bacteria 17829
69 Ga0070693_100000085 3300005547 Bacteria 39332
70 Ga0070665_100024700 3300005548 Bacteria 6054
71 Ga0070665_100112010 3300005548 Bacteria 2731
72 Ga0070704_100000062 3300005549 Bacteria 35520
73 Ga0068855_100008068 3300005563 Bacteria 12721
74 Ga0068855_100028188 3300005563 Bacteria 6717
75 Ga0068855_100675808 3300005563 Bacteria 1107
76 Ga0070664_100004974 3300005564 Bacteria 10648
77 Ga0068854_100001875 3300005578 Bacteria 12815
78 Ga0070702_100001805 3300005615 Bacteria 8897
79 Ga0068852_100024829 3300005616 Bacteria 4849
80 Ga0068859_100000539 3300005617 Bacteria 37503
81 Ga0068859_100024524 3300005617 Bacteria 6050
82 Ga0068859_100075261 3300005617 Bacteria 3417
83 Ga0068859_100156133 3300005617 Bacteria 2359
84 Ga0068859_100173689 3300005617 Bacteria 2237
85 Ga0068866_10000063 3300005718 Bacteria 42050
86 Ga0068866_10091811 3300005718 Bacteria 1655
87 Ga0068861_100000191 3300005719 Bacteria 32751
88 Ga0068861_100018816 3300005719 Bacteria 4925
89 Ga0068870_10000921 3300005840 Bacteria 11522
90 Ga0068870_10035334 3300005840 Unclassified 2563
91 Ga0068858_100005333 3300005842 Bacteria 12611
92 Ga0068858_100043325 3300005842 Bacteria 4173
93 Ga0068860_100002955 3300005843 Bacteria 17557
94 Ga0068862_100001064 3300005844 Bacteria 26294
95 Ga0068862_100031612 3300005844 Bacteria 4470
96 Ga0068862_100225508 3300005844 Bacteria 1698
97 Ga0068862_100274406 3300005844 Bacteria 1543
98 Ga0097621_100000471 3300006237 Bacteria 28276
99 Ga0097621_100012921 3300006237 Bacteria 6204
100 Ga0068871_100000464 3300006358 Bacteria 27896
101 Ga0075428_100023956 3300006844 Bacteria 6754
102 Ga0075428_100024455 3300006844 Bacteria 6684
103 Ga0075428_100027417 3300006844 Bacteria 6304
104 Ga0075430_100003436 3300006846 Bacteria 13247
105 Ga0075430_100024622 3300006846 Bacteria 5120
106 Ga0075430_100027842 3300006846 Bacteria 4800
107 Ga0075431_100004849 3300006847 Bacteria 13249
108 Ga0075431_100279801 3300006847 Bacteria 1689
109 Ga0075431_100371867 3300006847 Unclassified 1434
110 Ga0075433_10000654 3300006852 Bacteria 23341
111 Ga0075433_10001714 3300006852 Bacteria 16343
112 Ga0075434_100055386 3300006871 Bacteria 3941
113 Ga0075429_100029598 3300006880 Unclassified 4756
114 Ga0075429_100080440 3300006880 Bacteria 2841
115 Ga0075429_100137488 3300006880 Bacteria 2138
116 Ga0075429_100200136 3300006880 Bacteria 1750
117 Ga0068865_100000605 3300006881 Bacteria 20107
118 Ga0068865_100072318 3300006881 Bacteria 2449
119 Ga0068865_100091152 3300006881 Bacteria 2211
120 Ga0097620_100000539 3300006931 Bacteria 37503
121 Ga0097620_100024524 3300006931 Bacteria 6050
122 Ga0097620_100075260 3300006931 Bacteria 3417
123 Ga0097620_100156138 3300006931 Bacteria 2359
124 Ga0097620_100173695 3300006931 Bacteria 2237
125 Ga0075435_100088950 3300007076 Bacteria 2546
126 Ga0105240_10000026 3300009093 Bacteria 355569
127 Ga0105240_10020247 3300009093 Bacteria 8880
128 Ga0111539_10077409 3300009094 Bacteria 3914
129 Ga0111539_10143950 3300009094 Bacteria 2790
130 Ga0111539_10190450 3300009094 Bacteria 2393
131 Ga0105245_10001663 3300009098 Bacteria 20242
132 Ga0105247_10000988 3300009101 Bacteria 21435
133 Ga0114129_10327013 3300009147 Bacteria 2037
134 Ga0114129_10649343 3300009147 Bacteria 1362
135 Ga0105243_10000476 3300009148 Bacteria 41114
136 Ga0105243_10441952 3300009148 Bacteria 1218
137 Ga0105241_10006450 3300009174 Bacteria 8646
138 Ga0105242_10000253 3300009176 Bacteria 42384
139 Ga0105242_10093876 3300009176 Bacteria 2530
140 Ga0105248_10011179 3300009177 Bacteria 9901
141 Ga0105248_10185405 3300009177 Bacteria 2345
142 Ga0105249_10006650 3300009553 Bacteria 10062
143 Ga0105249_10007805 3300009553 Bacteria 9325
144 Ga0105239_10018410 3300010375 Bacteria 7717
145 Ga0105239_10096529 3300010375 Bacteria 3266
146 Ga0105239_10166156 3300010375 Bacteria 2467
147 Ga0157371_10058826 3300013102 Bacteria 2726
148 Ga0157370_10137998 3300013104 Bacteria 2272
149 Ga0157374_10121751 3300013296 Bacteria 2518
150 Ga0157378_10001351 3300013297 Bacteria 22062
151 Ga0163162_10000004 3300013306 Bacteria 505593
152 Ga0163162_10006840 3300013306 Bacteria 11065
153 Ga0163162_10052849 3300013306 Bacteria 4081
154 Ga0157375_10027748 3300013308 Bacteria 5297
155 Ga0163163_10454596 3300014325 Bacteria 1341
156 Ga0157380_10009698 3300014326 Bacteria 6907
157 Ga0157379_10243474 3300014968 Bacteria 1631
158 Ga0157376_10008979 3300014969 Bacteria 7239
159 Ga0157376_10021733 3300014969 Bacteria 4987
160 Ga0157376_10025344 3300014969 Bacteria 4670
161 Ga0163161_10211069 3300017792 Bacteria 1500
162 Ga0209676_1000348 3300025292 Bacteria 87619
163 Ga0207682_10000172 3300025893 Bacteria 29740
164 Ga0207642_10000538 3300025899 Bacteria 11570
165 Ga0207710_10003831 3300025900 Bacteria 6644
166 Ga0207680_10023398 3300025903 Unclassified 3373
167 Ga0207645_10000280 3300025907 Bacteria 42395
168 Ga0207645_10101330 3300025907 Bacteria 1858
169 Ga0207643_10000344 3300025908 Bacteria 31514
170 Ga0207643_10002846 3300025908 Bacteria 9346
171 Ga0207643_10110394 3300025908 Bacteria 1620
172 Ga0207705_10002665 3300025909 Bacteria 13678
173 Ga0207654_10053902 3300025911 Bacteria 2323
174 Ga0207707_10357266 3300025912 Bacteria 1258
175 Ga0207695_10000246 3300025913 Bacteria 140972
176 Ga0207695_10015717 3300025913 Bacteria 8898
177 Ga0207660_10004903 3300025917 Bacteria 8716
178 Ga0207660_10008028 3300025917 Bacteria 6825
179 Ga0207662_10000049 3300025918 Bacteria 51921
180 Ga0207657_10001124 3300025919 Bacteria 28399
181 Ga0207649_10059005 3300025920 Bacteria 2406
182 Ga0207649_10115916 3300025920 Bacteria 1798
183 Ga0207652_10009426 3300025921 Bacteria 7851
184 Ga0207650_10014296 3300025925 Bacteria 5515
185 Ga0207659_10046599 3300025926 Bacteria 3062
186 Ga0207659_10051627 3300025926 Bacteria 2925
187 Ga0207659_10061927 3300025926 Unclassified 2699
188 Ga0207687_10002481 3300025927 Bacteria 12533
189 Ga0207664_10009286 3300025929 Bacteria 6895
190 Ga0207706_10002135 3300025933 Bacteria 19354
191 Ga0207706_10012467 3300025933 Bacteria 7746
192 Ga0207706_10232538 3300025933 Bacteria 1612
193 Ga0207706_10306723 3300025933 Bacteria 1383
194 Ga0207686_10001045 3300025934 Bacteria 16395
195 Ga0207709_10002414 3300025935 Bacteria 11752
196 Ga0207709_10227233 3300025935 Bacteria 1350
197 Ga0207669_10003259 3300025937 Bacteria 7019
198 Ga0207704_10001639 3300025938 Bacteria 10041
199 Ga0207704_10219157 3300025938 Bacteria 1406
200 Ga0207691_10023903 3300025940 Bacteria 5751
201 Ga0207691_10049074 3300025940 Bacteria 3868
202 Ga0207711_10029921 3300025941 Bacteria 4593
203 Ga0207711_10036335 3300025941 Bacteria 4180
204 Ga0207711_10084745 3300025941 Bacteria 2775
205 Ga0207689_10003116 3300025942 Bacteria 15213
206 Ga0207689_10081717 3300025942 Bacteria 2656
207 Ga0207689_10226569 3300025942 Bacteria 1545
208 Ga0207679_10003112 3300025945 Bacteria 10272
209 Ga0207667_10014370 3300025949 Bacteria 9030
210 Ga0207667_10021224 3300025949 Bacteria 7199
211 Ga0207651_10284178 3300025960 Bacteria 1369
212 Ga0207712_10036197 3300025961 Bacteria 3360
213 Ga0207668_10044218 3300025972 Bacteria 3028
214 Ga0207640_10005022 3300025981 Bacteria 7196
215 Ga0207677_10017726 3300026023 Bacteria 4254
216 Ga0207677_10296217 3300026023 Bacteria 1334
217 Ga0207703_10022370 3300026035 Bacteria 4959
218 Ga0207639_10089012 3300026041 Bacteria 2465
219 Ga0207678_10054526 3300026067 Bacteria 3443
220 Ga0207708_10000238 3300026075 Bacteria 43493
221 Ga0207708_10103020 3300026075 Bacteria 2210
222 Ga0207648_10000265 3300026089 Bacteria 56755
223 Ga0207648_10030415 3300026089 Bacteria 4782
224 Ga0207648_10047839 3300026089 Bacteria 3747
225 Ga0207648_10086554 3300026089 Unclassified 2734
226 Ga0207648_10193942 3300026089 Bacteria 1801
227 Ga0207675_100000182 3300026118 Bacteria 56879
228 Ga0207675_100005636 3300026118 Bacteria 11985
229 Ga0207683_10005097 3300026121 Bacteria 11272
230 Ga0207683_10041807 3300026121 Bacteria 4003
231 Ga0207683_10141144 3300026121 Bacteria 2171
232 Ga0207698_10018775 3300026142 Bacteria 4720
233 Ga0209971_1021679 3300027682 Bacteria 1529
234 Ga0209974_10004073 3300027876 Bacteria 5221
235 Ga0209974_10018674 3300027876 Bacteria 2300
236 Ga0207428_10006980 3300027907 Bacteria 10346
237 Ga0268265_10002976 3300028380 Bacteria 12392
238 Ga0268265_10047030 3300028380 Bacteria 3230
239 Ga0268265_10050581 3300028380 Bacteria 3132
240 Ga0268264_10005809 3300028381 Bacteria 10459
241 Ga0307516_10014480 3300031730 Bacteria 8340
242 Ga0307416_100017288 3300032002 Bacteria 5041
243 Ga0307414_10015696 3300032004 Bacteria 4579
244 Ga0373957_0082606 3300035120 Bacteria 1270
245 Ga0373931_0001920 3300035691 Bacteria 9106
246 Ga0373935_0230550 3300035692 Bacteria 1289
247 Ga0436360_1243429 3300039438 Bacteria 2288
248 Ga0436362_0200381 3300039453 Bacteria 5418
249 Ga0436362_1032347 3300039453 Bacteria 1239
250 Ga0451577_0048762 3300042876 Bacteria 3783
251 Ga0466966_0048600 3300044684 Bacteria 2702
252 Ga0466966_0061178 3300044684 Bacteria 2376
253 Ga0466963_0006502 3300044694 Bacteria 6918
254 Ga0453684_0003900 3300044712 Bacteria 32765
255 Ga0466959_0097170 3300045049 Bacteria 2111
256 Ga0451576_0167833 3300045051 Bacteria 2290
257 Ga0466958_0042873 3300045836 Bacteria 2724
258 Ga0466967_0003351 3300045976 Bacteria 10416
259 Ga0495667_0119260 3300046559 Bacteria 1704
260 Ga0495684_0256271 3300047471 Bacteria 1271
261 Ga0496101_0177825 3300048904 Bacteria 1638
262 Ga0496104_0002404 3300048907 Bacteria 16117
263 Ga0496104_0029063 3300048907 Bacteria 5126
264 Ga0496105_0055750 3300048908 Bacteria 3263
265 Ga0496108_0016082 3300048911 Bacteria 6099
266 Ga0496109_0059510 3300048912 Bacteria 3490
267 Ga0496111_0117829 3300048914 Bacteria 1960
268 Ga0496112_0045851 3300048915 Bacteria 4285
269 Ga0496112_0269393 3300048915 Bacteria 1651
270 Ga0496114_0008053 3300048917 Bacteria 8344
271 Ga0496114_0012904 3300048917 Bacteria 6693
272 Ga0496115_0053270 3300048918 Bacteria 3247
273 Ga0501031_0002116 3300049568 Bacteria 12528
274 Ga0501036_0132064 3300049572 Bacteria 2108
275 Ga0501037_0151782 3300049573 Bacteria 1655
276 Ga0501039_0000714 3300049575 Bacteria 23899
277 Ga0501039_0046348 3300049575 Bacteria 3358
278 Ga0501040_0105577 3300049576 Bacteria 1968
279 Ga0501041_0006988 3300049577 Bacteria 6620
280 Ga0501042_0009282 3300049578 Bacteria 6546
281 Ga0501042_0032403 3300049578 Unclassified 3701
282 Ga0501046_0023683 3300049580 Bacteria 5046
283 Ga0501046_0029312 3300049580 Unclassified 4474
284 Ga0501048_0009972 3300049582 Bacteria 7112
285 Ga0501068_0024747 3300049584 Bacteria 3527
286 Ga0501069_0142966 3300049585 Bacteria 1373
287 Ga0501071_0125568 3300049587 Bacteria 1904
288 Ga0501076_0273128 3300049592 Bacteria 1384
289 Ga0501035_0025811 3300049822 Bacteria 5384
290 Ga0501035_0249030 3300049822 Bacteria 1509
291 Ga0501044_0235470 3300049823 Bacteria 1777
292 Ga0501045_0077782 3300049824 Bacteria 2445
293 nmdc:mga05p37_652629_c1 3300050507 Bacteria 1178
294 nmdc:mga09592_15559_c1 3300050508 Bacteria 6218
295 nmdc:mga09592_37548_c1 3300050508 Bacteria 4063
296 nmdc:mga09592_68270_c1 3300050508 Bacteria 3015
297 nmdc:mga0qj67_19353_c1 3300050509 Bacteria 5200
298 nmdc:mga0qj67_322775_c1 3300050509 Unclassified 1250
299 nmdc:mga06r32_136199_c1 3300050510 Bacteria 2430
300 nmdc:mga06r32_2868_c1 3300050510 Bacteria 15468
301 nmdc:mga06r32_407897_c1 3300050510 Unclassified 1341
302 nmdc:mga08y16_240493_c1 3300050511 Bacteria 1871
303 nmdc:mga08y16_464366_c1 3300050511 Bacteria 1290
304 nmdc:mga08y16_519908_c1 3300050511 Unclassified 1207
305 nmdc:mga0n895_195905_c1 3300050512 Bacteria 2052
306 nmdc:mga0n895_94525_c1 3300050512 Bacteria 2993
307 nmdc:mga0a205_48613_c1 3300050515 Bacteria 4094
308 nmdc:mga0a205_5154_c2 3300050515 Bacteria 7109
309 nmdc:mga0a205_67403_c1 3300050515 Bacteria 3457
310 Ga0495601_0012173 3300053077 Bacteria 5158
311 Ga0500644_0058539 3300053088 Bacteria 1348
312 Ga0501082_0230009 3300060353 Bacteria 1614
313 Ga0530510_0000997 3300061734 Bacteria 18792
314 Ga0530510_0179250 3300061734 Bacteria 1571
315 2522547727 2522125168 Bacteria 7376607
316 Ga0075430_100267813
317 rootH1_10245768
318 Ga0065165_1000285
319 Ga0065712_10001802
320 Ga0070676_10027290
321 Ga0070676_10035061
322 Ga0070676_10128601
323 Ga0070690_100000222
324 Ga0070670_100003113
325 Ga0070670_100147149
326 Ga0070677_10000661
327 Ga0070677_10034359
328 Ga0068869_100000439
329 Ga0068869_100031861
330 Ga0070666_10024192
331 Ga0070666_10057994
332 Ga0070680_100001192
333 Ga0070680_100040463
334 Ga0070682_100003417
335 Ga0068868_100006759
336 Ga0068868_100145728
337 Ga0070660_100069405
338 Ga0070689_100000393
339 Ga0070689_100134160
340 Ga0070689_100157960
341 Ga0070691_10000347
342 Ga0070687_100000062
343 Ga0070661_100040196
344 Ga0070668_100009069
345 Ga0070668_100047235
346 Ga0070669_100067299
347 Ga0070675_100018698
348 Ga0070675_100137727
349 Ga0070675_100140953
350 Ga0070674_100000108
351 Ga0070688_100005813
352 Ga0070659_100015120
353 Ga0070667_100083564
354 Ga0070714_100002907
355 Ga0070701_10000270
356 Ga0070705_100000697
357 Ga0070700_100003414
358 Ga0070694_100000045
359 Ga0070678_100046115
360 Ga0070678_100054004
361 Ga0070678_100160904
362 Ga0070681_10022240
363 Ga0068867_100000192
364 Ga0068867_100033973
365 Ga0068867_100043959
366 Ga0068867_100060095
367 Ga0068867_100150604
368 Ga0068867_100300402
369 Ga0070685_10014176
370 Ga0070685_10049126
371 Ga0070699_100219098
372 Ga0070679_100003602
373 Ga0070679_100029621
374 Ga0068853_100012942
375 Ga0068853_100053228
376 Ga0068853_100088074
377 Ga0070672_100024144
378 Ga0070672_100081638
379 Ga0070672_100152605
380 Ga0070672_100175798
381 Ga0070686_100000427
382 Ga0070695_100000638
383 Ga0070696_100001053
384 Ga0070693_100000085
385 Ga0070665_100024700
386 Ga0070665_100112010
387 Ga0070704_100000062
388 Ga0068855_100008068
389 Ga0068855_100028188
390 Ga0068855_100675808
391 Ga0070664_100004974
392 Ga0068854_100001875
393 Ga0070702_100001805
394 Ga0068852_100024829
395 Ga0068859_100000539
396 Ga0068859_100024524
397 Ga0068859_100075261
398 Ga0068859_100156133
399 Ga0068859_100173689
400 Ga0068866_10000063
401 Ga0068866_10091811
402 Ga0068861_100000191
403 Ga0068861_100018816
404 Ga0068870_10000921
405 Ga0068870_10035334
406 Ga0068858_100005333
407 Ga0068858_100043325
408 Ga0068860_100002955
409 Ga0068862_100001064
410 Ga0068862_100031612
411 Ga0068862_100225508
412 Ga0068862_100274406
413 Ga0097621_100000471
414 Ga0097621_100012921
415 Ga0068871_100000464
416 Ga0075428_100023956
417 Ga0075428_100024455
418 Ga0075428_100027417
419 Ga0075430_100003436
420 Ga0075430_100024622
421 Ga0075430_100027842
422 Ga0075431_100004849
423 Ga0075431_100279801
424 Ga0075431_100371867
425 Ga0075433_10000654
426 Ga0075433_10001714
427 Ga0075434_100055386
428 Ga0075429_100029598
429 Ga0075429_100080440
430 Ga0075429_100137488
431 Ga0075429_100200136
432 Ga0068865_100000605
433 Ga0068865_100072318
434 Ga0068865_100091152
435 Ga0097620_100000539
436 Ga0097620_100024524
437 Ga0097620_100075260
438 Ga0097620_100156138
439 Ga0097620_100173695
440 Ga0075435_100088950
441 Ga0105240_10000026
442 Ga0105240_10020247
443 Ga0111539_10077409
444 Ga0111539_10143950
445 Ga0111539_10190450
446 Ga0105245_10001663
447 Ga0105247_10000988
448 Ga0114129_10327013
449 Ga0114129_10649343
450 Ga0105243_10000476
451 Ga0105243_10441952
452 Ga0105241_10006450
453 Ga0105242_10000253
454 Ga0105242_10093876
455 Ga0105248_10011179
456 Ga0105248_10185405
457 Ga0105249_10006650
458 Ga0105249_10007805
459 Ga0105239_10018410
460 Ga0105239_10096529
461 Ga0105239_10166156
462 Ga0157371_10058826
463 Ga0157370_10137998
464 Ga0157374_10121751
465 Ga0157378_10001351
466 Ga0163162_10000004
467 Ga0163162_10006840
468 Ga0163162_10052849
469 Ga0157375_10027748
470 Ga0163163_10454596
471 Ga0157380_10009698
472 Ga0157379_10243474
473 Ga0157376_10008979
474 Ga0157376_10021733
475 Ga0157376_10025344
476 Ga0163161_10211069
477 Ga0209676_1000348
478 Ga0207682_10000172
479 Ga0207642_10000538
480 Ga0207710_10003831
481 Ga0207680_10023398
482 Ga0207645_10000280
483 Ga0207645_10101330
484 Ga0207643_10000344
485 Ga0207643_10002846
486 Ga0207643_10110394
487 Ga0207705_10002665
488 Ga0207654_10053902
489 Ga0207707_10357266
490 Ga0207695_10000246
491 Ga0207695_10015717
492 Ga0207660_10004903
493 Ga0207660_10008028
494 Ga0207662_10000049
495 Ga0207657_10001124
496 Ga0207649_10059005
497 Ga0207649_10115916
498 Ga0207652_10009426
499 Ga0207650_10014296
500 Ga0207659_10046599
501 Ga0207659_10051627
502 Ga0207659_10061927
503 Ga0207687_10002481
504 Ga0207664_10009286
505 Ga0207706_10002135
506 Ga0207706_10012467
507 Ga0207706_10232538
508 Ga0207706_10306723
509 Ga0207686_10001045
510 Ga0207709_10002414
511 Ga0207709_10227233
512 Ga0207669_10003259
513 Ga0207704_10001639
514 Ga0207704_10219157
515 Ga0207691_10023903
516 Ga0207691_10049074
517 Ga0207711_10029921
518 Ga0207711_10036335
519 Ga0207711_10084745
520 Ga0207689_10003116
521 Ga0207689_10081717
522 Ga0207689_10226569
523 Ga0207679_10003112
524 Ga0207667_10014370
525 Ga0207667_10021224
526 Ga0207651_10284178
527 Ga0207712_10036197
528 Ga0207668_10044218
529 Ga0207640_10005022
530 Ga0207677_10017726
531 Ga0207677_10296217
532 Ga0207703_10022370
533 Ga0207639_10089012
534 Ga0207678_10054526
535 Ga0207708_10000238
536 Ga0207708_10103020
537 Ga0207648_10000265
538 Ga0207648_10030415
539 Ga0207648_10047839
540 Ga0207648_10086554
541 Ga0207648_10193942
542 Ga0207675_100000182
543 Ga0207675_100005636
544 Ga0207683_10005097
545 Ga0207683_10041807
546 Ga0207683_10141144
547 Ga0207698_10018775
548 Ga0209971_1021679
549 Ga0209974_10004073
550 Ga0209974_10018674
551 Ga0207428_10006980
552 Ga0268265_10002976
553 Ga0268265_10047030
554 Ga0268265_10050581
555 Ga0268264_10005809
556 Ga0307516_10014480
557 Ga0307416_100017288
558 Ga0307414_10015696
559 Ga0373957_0082606
560 Ga0373931_0001920
561 Ga0373935_0230550
562 Ga0436360_1243429
563 Ga0436362_0200381
564 Ga0436362_1032347
565 Ga0451577_0048762
566 Ga0466966_0048600
567 Ga0466966_0061178
568 Ga0466963_0006502
569 Ga0453684_0003900
570 Ga0466959_0097170
571 Ga0451576_0167833
572 Ga0466958_0042873
573 Ga0466967_0003351
574 Ga0495667_0119260
575 Ga0495684_0256271
576 Ga0496101_0177825
577 Ga0496104_0002404
578 Ga0496104_0029063
579 Ga0496105_0055750
580 Ga0496108_0016082
581 Ga0496109_0059510
582 Ga0496111_0117829
583 Ga0496112_0045851
584 Ga0496112_0269393
585 Ga0496114_0008053
586 Ga0496114_0012904
587 Ga0496115_0053270
588 Ga0501031_0002116
589 Ga0501036_0132064
590 Ga0501037_0151782
591 Ga0501039_0000714
592 Ga0501039_0046348
593 Ga0501040_0105577
594 Ga0501041_0006988
595 Ga0501042_0009282
596 Ga0501042_0032403
597 Ga0501046_0023683
598 Ga0501046_0029312
599 Ga0501048_0009972
600 Ga0501068_0024747
601 Ga0501069_0142966
602 Ga0501071_0125568
603 Ga0501076_0273128
604 Ga0501035_0025811
605 Ga0501035_0249030
606 Ga0501044_0235470
607 Ga0501045_0077782
608 nmdc:mga05p37_652629_c1
609 nmdc:mga09592_15559_c1
610 nmdc:mga09592_37548_c1
611 nmdc:mga09592_68270_c1
612 nmdc:mga0qj67_19353_c1
613 nmdc:mga0qj67_322775_c1
614 nmdc:mga06r32_136199_c1
615 nmdc:mga06r32_2868_c1
616 nmdc:mga06r32_407897_c1
617 nmdc:mga08y16_240493_c1
618 nmdc:mga08y16_464366_c1
619 nmdc:mga08y16_519908_c1
620 nmdc:mga0n895_195905_c1
621 nmdc:mga0n895_94525_c1
622 nmdc:mga0a205_48613_c1
623 nmdc:mga0a205_5154_c2
624 nmdc:mga0a205_67403_c1
625 Ga0495601_0012173
626 Ga0500644_0058539
627 Ga0501082_0230009
628 Ga0530510_0000997
629 Ga0530510_0179250
630 2522547727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21338

Top1B_N_bact

Bacterial DNA topoisomerase IB, N-terminal domain

56

100

0.96

PF01028

Topoisom_I

Eukaryotic DNA topoisomerase I, catalytic core

110

339

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k4t-assembly1.cif.gz_A human dna topoisomerase i (70 kda) in complex with the poison topotecan and covalent complex with a 22 base pair dna duplex 0.8293 93 313
2b9s-assembly1.cif.gz_A crystal structure of heterodimeric l. donovani topoisomerase i-vanadate-dna complex 0.8175 93 315
1r49-assembly1.cif.gz_A human topoisomerase i (topo70) double mutant k532r/y723f 0.8052 93 315
1ej9-assembly1.cif.gz_A crystal structure of human topoisomerase i dna complex 0.7564 93 362
2h7g-assembly1.cif.gz_X structure of variola topoisomerase non-covalently bound to dna 0.7468 48 360
ID Description Score Start End Superfamily
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9672 149 261 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9232 149 261 3.90.15.10
3m4aA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.9196 149 261 3.90.15.10
af_A0A2R8S0L3_185_312_3.90.15.10 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8916 121 224 3.90.15.10
2f4qA03 Alpha Beta;Alpha-Beta Complex;Topoisomerase I; Chain A, domain 3;Topoisomerase I; Chain A, domain 3 0.8733 149 261 3.90.15.10
ID Description Score Start End GO Terms
AF-A0A2A2KIQ3-F1-model_v4 DNA topoisomerase I catalytic core eukaryotic-type domain-containing protein 0.9907 132 251 GO:0003677
GO:0003917
GO:0006265
AF-A0A536GTZ5-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9873 149 288 GO:0003677
GO:0003917
GO:0006265
AF-A0A3M2ZKQ3-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.987 183 276 GO:0003677
GO:0003917
GO:0006265
AF-A0A436L3U7-F1-model_v4 deleted 0.9844 146 303
AF-A0A536GTZ5-F1-model_v4 DNA topoisomerase (EC 5.6.2.1) 0.9803 149 288 GO:0003677
GO:0003917
GO:0006265

Map