F403031

General Info

Members Datasets Scaffolds Average Seq Length
315 190 630 226

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100117141|Ga0070659_1001171413
Length 255
Sequence VPFRGDTKATASQDVSYDRGMSDARSSIGRAAFASIPGGWFTMGTELGQDDERPPHRVFVDAFELGVFPVTRAEYERFVSATKHEPPRDWSHALFAQPDLPVVGVSWLDAIAYCDWRSKEEGRPVRLPTEAEWEFAARGGQEALFPWGDVLPAWIPNDGRGPLSAPWPVTLGEPTVFGLFGISTNVHEWCADWHDKEYYRRSPERNPAGPDCGVRRASRGGSWRHVYTMCRVTLRSKLDPSFRYNDYGFRLARSV

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
143 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
146 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
147 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
148 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
167 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0
Rhizoplane 2.86
Rhizosphere 91.43
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100117141 3300005366 Bacteria 2154
2 Ga0065712_10179702 3300005290 Unclassified 1199
3 Ga0065707_10009388 3300005295 Unclassified 2522
4 Ga0065707_10275522 3300005295 Bacteria 1060
5 Ga0070683_100044740 3300005329 Bacteria 4084
6 Ga0070690_100027064 3300005330 Bacteria 3542
7 Ga0070690_100078210 3300005330 Bacteria 2161
8 Ga0070670_100048675 3300005331 Unclassified 3647
9 Ga0070677_10136916 3300005333 Bacteria 1125
10 Ga0068869_100195136 3300005334 Bacteria 1594
11 Ga0070666_10035042 3300005335 Bacteria 3327
12 Ga0070666_10148299 3300005335 Bacteria 1636
13 Ga0070680_100865635 3300005336 Bacteria 779
14 Ga0068868_100143096 3300005338 Bacteria 1965
15 Ga0070660_100002622 3300005339 Bacteria 12355
16 Ga0070689_100045611 3300005340 Bacteria 3375
17 Ga0070691_10021251 3300005341 Bacteria 3002
18 Ga0070687_100010406 3300005343 Bacteria 4022
19 Ga0070669_100335430 3300005353 Bacteria 1224
20 Ga0070675_100002099 3300005354 Bacteria 14757
21 Ga0070675_100320945 3300005354 Bacteria 1368
22 Ga0070674_100011793 3300005356 Bacteria 5335
23 Ga0070674_100319794 3300005356 Bacteria 1244
24 Ga0070673_100042743 3300005364 Bacteria 3496
25 Ga0070673_100052353 3300005364 Bacteria 3203
26 Ga0070673_100121564 3300005364 Bacteria 2179
27 Ga0070673_100490685 3300005364 Bacteria 1110
28 Ga0070688_100085118 3300005365 Bacteria 2054
29 Ga0070667_100095461 3300005367 Bacteria 2564
30 Ga0070709_10157397 3300005434 Bacteria 1576
31 Ga0070714_100004063 3300005435 Bacteria 10996
32 Ga0070713_100039037 3300005436 Unclassified 3851
33 Ga0070701_10025199 3300005438 Bacteria 2885
34 Ga0070705_100023887 3300005440 Bacteria 3291
35 Ga0070700_100259780 3300005441 Bacteria 1250
36 Ga0070700_100445176 3300005441 Bacteria 984
37 Ga0070694_100556643 3300005444 Bacteria 919
38 Ga0070708_100039038 3300005445 Bacteria 4152
39 Ga0070678_100196974 3300005456 Bacteria 1660
40 Ga0070678_100299581 3300005456 Bacteria 1366
41 Ga0070678_100334816 3300005456 Bacteria 1296
42 Ga0070678_100669731 3300005456 Bacteria 932
43 Ga0070681_10153627 3300005458 Bacteria 2227
44 Ga0068867_100399774 3300005459 Bacteria 1158
45 Ga0070706_100142662 3300005467 Bacteria 2236
46 Ga0070707_100484772 3300005468 Bacteria 1198
47 Ga0070698_100079648 3300005471 Bacteria 3272
48 Ga0070698_100122502 3300005471 Bacteria 2559
49 Ga0070698_100122844 3300005471 Bacteria 2555
50 Ga0070698_100640709 3300005471 Bacteria 1004
51 Ga0070699_100008699 3300005518 Bacteria 8799
52 Ga0070699_100187932 3300005518 Bacteria 1835
53 Ga0070699_100423047 3300005518 Bacteria 1206
54 Ga0070697_100155054 3300005536 Bacteria 1933
55 Ga0070697_100999118 3300005536 Bacteria 744
56 Ga0070672_100001717 3300005543 Bacteria 13683
57 Ga0070672_100283527 3300005543 Bacteria 1401
58 Ga0070672_100386344 3300005543 Bacteria 1198
59 Ga0070686_100094980 3300005544 Bacteria 2002
60 Ga0070695_100977126 3300005545 Bacteria 688
61 Ga0070696_100019326 3300005546 Bacteria 4613
62 Ga0070664_100061440 3300005564 Unclassified 3202
63 Ga0070664_100450306 3300005564 Bacteria 1182
64 Ga0068857_100039607 3300005577 Unclassified 4175
65 Ga0068854_100031110 3300005578 Bacteria 3707
66 Ga0068854_100054401 3300005578 Bacteria 2878
67 Ga0068854_100093046 3300005578 Bacteria 2246
68 Ga0068854_100392126 3300005578 Bacteria 1147
69 Ga0068859_100172415 3300005617 Bacteria 2245
70 Ga0068859_100241263 3300005617 Bacteria 1896
71 Ga0068859_100284735 3300005617 Bacteria 1746
72 Ga0068861_100098271 3300005719 Bacteria 2323
73 Ga0068863_100451579 3300005841 Bacteria 1261
74 Ga0068858_100029519 3300005842 Bacteria 5092
75 Ga0068858_100180208 3300005842 Bacteria 1995
76 Ga0068858_100320736 3300005842 Bacteria 1481
77 Ga0068862_100129356 3300005844 Bacteria 2232
78 Ga0068862_100651259 3300005844 Bacteria 1016
79 Ga0081455_10225373 3300005937 Bacteria 1387
80 Ga0075365_10040003 3300006038 Bacteria 3056
81 Ga0075364_10019664 3300006051 Bacteria 4240
82 Ga0075432_10013116 3300006058 Bacteria 2816
83 Ga0075362_10017786 3300006177 Bacteria 2932
84 Ga0075367_10005220 3300006178 Bacteria 6419
85 Ga0075366_10037738 3300006195 Bacteria 2853
86 Ga0075366_10047213 3300006195 Bacteria 2552
87 Ga0097621_100669269 3300006237 Bacteria 954
88 Ga0075370_10025078 3300006353 Bacteria 3296
89 Ga0075428_100001260 3300006844 Bacteria 27027
90 Ga0075428_100005117 3300006844 Bacteria 14572
91 Ga0075430_100000363 3300006846 Bacteria 33258
92 Ga0075430_100018236 3300006846 Bacteria 5973
93 Ga0075431_100011390 3300006847 Bacteria 8959
94 Ga0075431_100067247 3300006847 Bacteria 3699
95 Ga0075433_10026854 3300006852 Bacteria 4879
96 Ga0075434_100004913 3300006871 Bacteria 12112
97 Ga0075434_100013127 3300006871 Bacteria 7869
98 Ga0075434_100045577 3300006871 Bacteria 4350
99 Ga0075434_100054449 3300006871 Bacteria 3975
100 Ga0075434_100166451 3300006871 Bacteria 2224
101 Ga0075429_100000831 3300006880 Bacteria 24224
102 Ga0075429_100062607 3300006880 Bacteria 3241
103 Ga0075429_100533156 3300006880 Bacteria 1029
104 Ga0068865_100085360 3300006881 Bacteria 2277
105 Ga0075436_100004489 3300006914 Bacteria 9576
106 Ga0075436_100087937 3300006914 Bacteria 2158
107 Ga0075436_100420392 3300006914 Bacteria 970
108 Ga0097620_100172421 3300006931 Bacteria 2245
109 Ga0097620_100241262 3300006931 Bacteria 1896
110 Ga0097620_100284728 3300006931 Bacteria 1746
111 Ga0075435_100000004 3300007076 Bacteria 122128
112 Ga0075435_100001751 3300007076 Bacteria 14125
113 Ga0075435_100006003 3300007076 Bacteria 8550
114 Ga0075435_100028567 3300007076 Bacteria 4375
115 Ga0075435_100093877 3300007076 Bacteria 2479
116 Ga0075435_100148779 3300007076 Bacteria 1968
117 Ga0075435_100209619 3300007076 Bacteria 1653
118 Ga0105240_10096251 3300009093 Bacteria 3608
119 Ga0105240_10171878 3300009093 Bacteria 2566
120 Ga0111539_10000472 3300009094 Bacteria 50726
121 Ga0111539_10677570 3300009094 Bacteria 1200
122 Ga0111539_11012557 3300009094 Bacteria 966
123 Ga0105245_10039255 3300009098 Bacteria 4214
124 Ga0105245_10185937 3300009098 Bacteria 1988
125 Ga0105245_10696032 3300009098 Unclassified 1049
126 Ga0114129_10000490 3300009147 Bacteria 47893
127 Ga0114129_10001780 3300009147 Bacteria 29349
128 Ga0114129_10003673 3300009147 Bacteria 21588
129 Ga0114129_10110138 3300009147 Bacteria 3801
130 Ga0114129_10204778 3300009147 Bacteria 2670
131 Ga0114129_10559332 3300009147 Bacteria 1486
132 Ga0114129_10751664 3300009147 Bacteria 1248
133 Ga0114129_10875229 3300009147 Bacteria 1140
134 Ga0114129_11570778 3300009147 Bacteria 806
135 Ga0105243_10394547 3300009148 Bacteria 1284
136 Ga0105241_10019949 3300009174 Bacteria 4948
137 Ga0105242_10062796 3300009176 Bacteria 3058
138 Ga0105248_10082532 3300009177 Bacteria 3615
139 Ga0105248_10163319 3300009177 Bacteria 2511
140 Ga0105248_10296504 3300009177 Bacteria 1821
141 Ga0105248_10477251 3300009177 Bacteria 1406
142 Ga0105239_10279769 3300010375 Bacteria 1878
143 Ga0157378_10348149 3300013297 Bacteria 1447
144 Ga0157378_10488576 3300013297 Bacteria 1228
145 Ga0157375_11207776 3300013308 Bacteria 887
146 Ga0163163_10103163 3300014325 Bacteria 2876
147 Ga0157377_10154181 3300014745 Bacteria 1423
148 Ga0157379_10887380 3300014968 Archaea 845
149 Ga0157376_10045001 3300014969 Bacteria 3631
150 Ga0207697_10025550 3300025315 Bacteria 2413
151 Ga0207680_10089457 3300025903 Bacteria 1954
152 Ga0207680_10090941 3300025903 Bacteria 1941
153 Ga0207647_10080932 3300025904 Bacteria 1947
154 Ga0207699_10332224 3300025906 Bacteria 1069
155 Ga0207645_10007150 3300025907 Bacteria 7919
156 Ga0207654_10088625 3300025911 Bacteria 1881
157 Ga0207707_10049592 3300025912 Bacteria 3658
158 Ga0207695_10472254 3300025913 Bacteria 1137
159 Ga0207693_10194203 3300025915 Bacteria 1597
160 Ga0207662_10004053 3300025918 Bacteria 7643
161 Ga0207662_10076099 3300025918 Bacteria 2039
162 Ga0207652_10022417 3300025921 Bacteria 5224
163 Ga0207646_10212313 3300025922 Bacteria 1748
164 Ga0207646_10405104 3300025922 Bacteria 1232
165 Ga0207681_10151806 3300025923 Bacteria 1737
166 Ga0207650_10140509 3300025925 Bacteria 1898
167 Ga0207659_10001329 3300025926 Bacteria 14774
168 Ga0207659_10106994 3300025926 Bacteria 2119
169 Ga0207700_10038463 3300025928 Bacteria 3473
170 Ga0207700_10412139 3300025928 Bacteria 1185
171 Ga0207690_10109180 3300025932 Bacteria 1990
172 Ga0207706_10236829 3300025933 Bacteria 1596
173 Ga0207709_10398074 3300025935 Unclassified 1052
174 Ga0207669_10023790 3300025937 Bacteria 3279
175 Ga0207669_10297568 3300025937 Bacteria 1225
176 Ga0207691_10006164 3300025940 Bacteria 11597
177 Ga0207711_10066117 3300025941 Bacteria 3127
178 Ga0207711_10257510 3300025941 Bacteria 1603
179 Ga0207711_10362313 3300025941 Bacteria 1343
180 Ga0207689_10179090 3300025942 Bacteria 1748
181 Ga0207661_10041955 3300025944 Bacteria 3605
182 Ga0207679_10069341 3300025945 Bacteria 2653
183 Ga0207651_10091297 3300025960 Bacteria 2229
184 Ga0207640_10031208 3300025981 Bacteria 3290
185 Ga0207640_10068585 3300025981 Bacteria 2377
186 Ga0207640_10115678 3300025981 Bacteria 1910
187 Ga0207703_10020127 3300026035 Bacteria 5216
188 Ga0207708_10003682 3300026075 Bacteria 11315
189 Ga0207708_10147579 3300026075 Unclassified 1849
190 Ga0207708_10195831 3300026075 Bacteria 1610
191 Ga0207708_10267310 3300026075 Bacteria 1382
192 Ga0207648_10030748 3300026089 Bacteria 4752
193 Ga0207674_10031856 3300026116 Bacteria 5534
194 Ga0207675_100073658 3300026118 Bacteria 3195
195 Ga0207428_10000583 3300027907 Bacteria 43081
196 Ga0207428_10191392 3300027907 Bacteria 1542
197 Ga0268264_10039720 3300028381 Bacteria 3888
198 Ga0265316_10017332 3300031344 Bacteria 6232
199 Ga0307408_100002843 3300031548 Bacteria 12008
200 Ga0307408_100021740 3300031548 Bacteria 4346
201 Ga0307413_10159255 3300031824 Bacteria 1584
202 Ga0307412_10019417 3300031911 Bacteria 4116
203 Ga0307412_10072267 3300031911 Bacteria 2357
204 Ga0307409_100330188 3300031995 Bacteria 1431
205 Ga0307416_100068430 3300032002 Bacteria 2934
206 Ga0307416_100348250 3300032002 Bacteria 1498
207 Ga0307416_100442439 3300032002 Bacteria 1350
208 Ga0307416_100638126 3300032002 Unclassified 1149
209 Ga0307416_100889936 3300032002 Unclassified 990
210 Ga0307414_10031073 3300032004 Unclassified 3498
211 Ga0307411_10040844 3300032005 Bacteria 2946
212 Ga0307411_10056247 3300032005 Bacteria 2592
213 Ga0373948_0009106 3300034817 Bacteria 1706
214 Ga0373926_0045296 3300035083 Unclassified 1577
215 Ga0373929_0000386 3300035085 Bacteria 8286
216 Ga0373940_0023855 3300035088 Unclassified 1582
217 Ga0373949_0009620 3300035090 Bacteria 2116
218 Ga0373949_0136197 3300035090 Bacteria 700
219 Ga0373952_0000385 3300035092 Bacteria 7564
220 Ga0373952_0024486 3300035092 Bacteria 1297
221 Ga0373932_0116221 3300035112 Unclassified 887
222 Ga0373936_0148247 3300035113 Bacteria 1016
223 Ga0373939_0002239 3300035114 Bacteria 4584
224 Ga0373941_0011327 3300035115 Bacteria 2301
225 Ga0373960_0000096 3300035121 Bacteria 13691
226 Ga0373962_0026315 3300035242 Unclassified 1567
227 Ga0373931_0066230 3300035691 Bacteria 1960
228 Ga0373947_0368429 3300035725 Bacteria 966
229 Ga0373925_0017697 3300037068 Bacteria 5169
230 Ga0373925_0451093 3300037068 Bacteria 1053
231 Ga0395901_1028357 3300038443 Bacteria 798
232 Ga0439447_084780 3300041407 Bacteria 730
233 Ga0439453_0050037 3300041408 Bacteria 842
234 Ga0451853_1806875 3300041512 Bacteria 854
235 Ga0439431_0008784 3300041997 Bacteria 2275
236 Ga0439431_0014394 3300041997 Bacteria 1833
237 Ga0439433_0007514 3300041999 Bacteria 2353
238 Ga0450923_014137 3300042125 Unclassified 1477
239 Ga0450905_021157 3300042142 Bacteria 960
240 Ga0439446_0004809 3300042156 Bacteria 3442
241 Ga0439435_0036742 3300042436 Bacteria 1355
242 Ga0439464_0004682 3300042439 Bacteria 3506
243 Ga0439464_0098933 3300042439 Bacteria 885
244 Ga0451577_0329253 3300042876 Bacteria 1385
245 Ga0451577_1025631 3300042876 Bacteria 740
246 Ga0451576_0016342 3300045051 Bacteria 8195
247 Ga0466967_0265253 3300045976 Bacteria 1644
248 Ga0495580_0413896 3300046472 Bacteria 908
249 Ga0495662_0355812 3300046476 Bacteria 720
250 Ga0495667_0455974 3300046559 Bacteria 803
251 Ga0495659_0077449 3300046664 Bacteria 1256
252 Ga0495658_0085930 3300046683 Bacteria 1855
253 Ga0495658_0139635 3300046683 Bacteria 1481
254 Ga0496101_0522677 3300048904 Bacteria 938
255 Ga0496102_0339880 3300048905 Bacteria 1414
256 Ga0496106_0236302 3300048909 Bacteria 1460
257 Ga0496106_0381996 3300048909 Bacteria 1132
258 Ga0496107_0195642 3300048910 Bacteria 1503
259 Ga0496112_0028484 3300048915 Bacteria 5392
260 Ga0496113_0027529 3300048916 Bacteria 4077
261 Ga0496113_0151170 3300048916 Bacteria 1832
262 Ga0496113_0194697 3300048916 Bacteria 1610
263 Ga0501291_005269 3300049514 Bacteria 1683
264 Ga0501299_073081 3300049522 Unclassified 748
265 Ga0501034_0002844 3300049571 Bacteria 20171
266 Ga0501074_0158033 3300049590 Bacteria 1619
267 Ga0501225_0112098 3300049705 Bacteria 805
268 nmdc:mga03683_6336_c1 3300050489 Bacteria 4046
269 nmdc:mga00v17_517767_c1 3300050491 Bacteria 773
270 nmdc:mga00v17_979_c1 3300050491 Bacteria 15302
271 nmdc:mga0yw44_269385_c1 3300050492 Bacteria 1136
272 nmdc:mga0yw44_558023_c1 3300050492 Bacteria 778
273 nmdc:mga0k408_16477_c1 3300050493 Bacteria 4102
274 nmdc:mga0k408_5210_c1 3300050493 Bacteria 6897
275 nmdc:mga06z11_23333_c1 3300050494 Bacteria 2905
276 nmdc:mga07m45_167565_c1 3300050496 Bacteria 1276
277 nmdc:mga05p37_254055_c1 3300050507 Bacteria 2107
278 nmdc:mga05p37_2676_c1 3300050507 Bacteria 20740
279 nmdc:mga05p37_349428_c1 3300050507 Bacteria 1741
280 nmdc:mga05p37_3777_c1 3300050507 Bacteria 17721
281 nmdc:mga05p37_57804_c1 3300050507 Bacteria 4776
282 nmdc:mga05p37_752103_c1 3300050507 Bacteria 1074
283 nmdc:mga09592_28786_c1 3300050508 Bacteria 4618
284 nmdc:mga0qj67_96720_c1 3300050509 Bacteria 2377
285 nmdc:mga0qj67_97231_c1 3300050509 Bacteria 2371
286 nmdc:mga06r32_10364_c1 3300050510 Bacteria 8408
287 nmdc:mga06r32_2008_c1 3300050510 Bacteria 18193
288 nmdc:mga06r32_205798_c1 3300050510 Bacteria 1956
289 nmdc:mga06r32_693887_c1 3300050510 Bacteria 984
290 nmdc:mga08y16_546046_c1 3300050511 Bacteria 1173
291 nmdc:mga08y16_69684_c1 3300050511 Bacteria 3666
292 nmdc:mga08y16_80031_c1 3300050511 Bacteria 3407
293 nmdc:mga0n895_133002_c1 3300050512 Bacteria 2513
294 nmdc:mga0n895_356188_c1 3300050512 Bacteria 1482
295 nmdc:mga0n895_44398_c1 3300050512 Bacteria 4334
296 nmdc:mga0n895_6_c1 3300050512 Bacteria 122829
297 nmdc:mga0n895_969_c2 3300050512 Bacteria 6825
298 nmdc:mga0rr50_10558_c1 3300050513 Bacteria 5868
299 nmdc:mga0rr50_21624_c1 3300050513 Bacteria 4396
300 nmdc:mga0rr50_259_c1 3300050513 Bacteria 28683
301 nmdc:mga0rr50_507031_c1 3300050513 Bacteria 1026
302 nmdc:mga0rr50_7_c1 3300050513 Bacteria 297175
303 nmdc:mga08x19_198267_c1 3300050514 Bacteria 1375
304 nmdc:mga08x19_67_c1 3300050514 Bacteria 80016
305 nmdc:mga08x19_7848_c1 3300050514 Bacteria 6338
306 nmdc:mga08x19_80845_c1 3300050514 Bacteria 2134
307 nmdc:mga0a205_106740_c1 3300050515 Bacteria 2698
308 nmdc:mga0a205_177428_c1 3300050515 Bacteria 2025
309 nmdc:mga0a205_330679_c1 3300050515 Bacteria 1394
310 nmdc:mga0a205_499876_c1 3300050515 Bacteria 1073
311 Ga0500628_010088 3300053129 Bacteria 1682
312 Ga0590071_000312 3300059421 Bacteria 14170
313 Ga0590074_000777 3300059423 Bacteria 4895
314 Ga0590075_000223 3300059424 Bacteria 15855
315 Ga0590077_000389 3300059426 Bacteria 12367
316 Ga0070659_100117141
317 Ga0065712_10179702
318 Ga0065707_10009388
319 Ga0065707_10275522
320 Ga0070683_100044740
321 Ga0070690_100027064
322 Ga0070690_100078210
323 Ga0070670_100048675
324 Ga0070677_10136916
325 Ga0068869_100195136
326 Ga0070666_10035042
327 Ga0070666_10148299
328 Ga0070680_100865635
329 Ga0068868_100143096
330 Ga0070660_100002622
331 Ga0070689_100045611
332 Ga0070691_10021251
333 Ga0070687_100010406
334 Ga0070669_100335430
335 Ga0070675_100002099
336 Ga0070675_100320945
337 Ga0070674_100011793
338 Ga0070674_100319794
339 Ga0070673_100042743
340 Ga0070673_100052353
341 Ga0070673_100121564
342 Ga0070673_100490685
343 Ga0070688_100085118
344 Ga0070667_100095461
345 Ga0070709_10157397
346 Ga0070714_100004063
347 Ga0070713_100039037
348 Ga0070701_10025199
349 Ga0070705_100023887
350 Ga0070700_100259780
351 Ga0070700_100445176
352 Ga0070694_100556643
353 Ga0070708_100039038
354 Ga0070678_100196974
355 Ga0070678_100299581
356 Ga0070678_100334816
357 Ga0070678_100669731
358 Ga0070681_10153627
359 Ga0068867_100399774
360 Ga0070706_100142662
361 Ga0070707_100484772
362 Ga0070698_100079648
363 Ga0070698_100122502
364 Ga0070698_100122844
365 Ga0070698_100640709
366 Ga0070699_100008699
367 Ga0070699_100187932
368 Ga0070699_100423047
369 Ga0070697_100155054
370 Ga0070697_100999118
371 Ga0070672_100001717
372 Ga0070672_100283527
373 Ga0070672_100386344
374 Ga0070686_100094980
375 Ga0070695_100977126
376 Ga0070696_100019326
377 Ga0070664_100061440
378 Ga0070664_100450306
379 Ga0068857_100039607
380 Ga0068854_100031110
381 Ga0068854_100054401
382 Ga0068854_100093046
383 Ga0068854_100392126
384 Ga0068859_100172415
385 Ga0068859_100241263
386 Ga0068859_100284735
387 Ga0068861_100098271
388 Ga0068863_100451579
389 Ga0068858_100029519
390 Ga0068858_100180208
391 Ga0068858_100320736
392 Ga0068862_100129356
393 Ga0068862_100651259
394 Ga0081455_10225373
395 Ga0075365_10040003
396 Ga0075364_10019664
397 Ga0075432_10013116
398 Ga0075362_10017786
399 Ga0075367_10005220
400 Ga0075366_10037738
401 Ga0075366_10047213
402 Ga0097621_100669269
403 Ga0075370_10025078
404 Ga0075428_100001260
405 Ga0075428_100005117
406 Ga0075430_100000363
407 Ga0075430_100018236
408 Ga0075431_100011390
409 Ga0075431_100067247
410 Ga0075433_10026854
411 Ga0075434_100004913
412 Ga0075434_100013127
413 Ga0075434_100045577
414 Ga0075434_100054449
415 Ga0075434_100166451
416 Ga0075429_100000831
417 Ga0075429_100062607
418 Ga0075429_100533156
419 Ga0068865_100085360
420 Ga0075436_100004489
421 Ga0075436_100087937
422 Ga0075436_100420392
423 Ga0097620_100172421
424 Ga0097620_100241262
425 Ga0097620_100284728
426 Ga0075435_100000004
427 Ga0075435_100001751
428 Ga0075435_100006003
429 Ga0075435_100028567
430 Ga0075435_100093877
431 Ga0075435_100148779
432 Ga0075435_100209619
433 Ga0105240_10096251
434 Ga0105240_10171878
435 Ga0111539_10000472
436 Ga0111539_10677570
437 Ga0111539_11012557
438 Ga0105245_10039255
439 Ga0105245_10185937
440 Ga0105245_10696032
441 Ga0114129_10000490
442 Ga0114129_10001780
443 Ga0114129_10003673
444 Ga0114129_10110138
445 Ga0114129_10204778
446 Ga0114129_10559332
447 Ga0114129_10751664
448 Ga0114129_10875229
449 Ga0114129_11570778
450 Ga0105243_10394547
451 Ga0105241_10019949
452 Ga0105242_10062796
453 Ga0105248_10082532
454 Ga0105248_10163319
455 Ga0105248_10296504
456 Ga0105248_10477251
457 Ga0105239_10279769
458 Ga0157378_10348149
459 Ga0157378_10488576
460 Ga0157375_11207776
461 Ga0163163_10103163
462 Ga0157377_10154181
463 Ga0157379_10887380
464 Ga0157376_10045001
465 Ga0207697_10025550
466 Ga0207680_10089457
467 Ga0207680_10090941
468 Ga0207647_10080932
469 Ga0207699_10332224
470 Ga0207645_10007150
471 Ga0207654_10088625
472 Ga0207707_10049592
473 Ga0207695_10472254
474 Ga0207693_10194203
475 Ga0207662_10004053
476 Ga0207662_10076099
477 Ga0207652_10022417
478 Ga0207646_10212313
479 Ga0207646_10405104
480 Ga0207681_10151806
481 Ga0207650_10140509
482 Ga0207659_10001329
483 Ga0207659_10106994
484 Ga0207700_10038463
485 Ga0207700_10412139
486 Ga0207690_10109180
487 Ga0207706_10236829
488 Ga0207709_10398074
489 Ga0207669_10023790
490 Ga0207669_10297568
491 Ga0207691_10006164
492 Ga0207711_10066117
493 Ga0207711_10257510
494 Ga0207711_10362313
495 Ga0207689_10179090
496 Ga0207661_10041955
497 Ga0207679_10069341
498 Ga0207651_10091297
499 Ga0207640_10031208
500 Ga0207640_10068585
501 Ga0207640_10115678
502 Ga0207703_10020127
503 Ga0207708_10003682
504 Ga0207708_10147579
505 Ga0207708_10195831
506 Ga0207708_10267310
507 Ga0207648_10030748
508 Ga0207674_10031856
509 Ga0207675_100073658
510 Ga0207428_10000583
511 Ga0207428_10191392
512 Ga0268264_10039720
513 Ga0265316_10017332
514 Ga0307408_100002843
515 Ga0307408_100021740
516 Ga0307413_10159255
517 Ga0307412_10019417
518 Ga0307412_10072267
519 Ga0307409_100330188
520 Ga0307416_100068430
521 Ga0307416_100348250
522 Ga0307416_100442439
523 Ga0307416_100638126
524 Ga0307416_100889936
525 Ga0307414_10031073
526 Ga0307411_10040844
527 Ga0307411_10056247
528 Ga0373948_0009106
529 Ga0373926_0045296
530 Ga0373929_0000386
531 Ga0373940_0023855
532 Ga0373949_0009620
533 Ga0373949_0136197
534 Ga0373952_0000385
535 Ga0373952_0024486
536 Ga0373932_0116221
537 Ga0373936_0148247
538 Ga0373939_0002239
539 Ga0373941_0011327
540 Ga0373960_0000096
541 Ga0373962_0026315
542 Ga0373931_0066230
543 Ga0373947_0368429
544 Ga0373925_0017697
545 Ga0373925_0451093
546 Ga0395901_1028357
547 Ga0439447_084780
548 Ga0439453_0050037
549 Ga0451853_1806875
550 Ga0439431_0008784
551 Ga0439431_0014394
552 Ga0439433_0007514
553 Ga0450923_014137
554 Ga0450905_021157
555 Ga0439446_0004809
556 Ga0439435_0036742
557 Ga0439464_0004682
558 Ga0439464_0098933
559 Ga0451577_0329253
560 Ga0451577_1025631
561 Ga0451576_0016342
562 Ga0466967_0265253
563 Ga0495580_0413896
564 Ga0495662_0355812
565 Ga0495667_0455974
566 Ga0495659_0077449
567 Ga0495658_0085930
568 Ga0495658_0139635
569 Ga0496101_0522677
570 Ga0496102_0339880
571 Ga0496106_0236302
572 Ga0496106_0381996
573 Ga0496107_0195642
574 Ga0496112_0028484
575 Ga0496113_0027529
576 Ga0496113_0151170
577 Ga0496113_0194697
578 Ga0501291_005269
579 Ga0501299_073081
580 Ga0501034_0002844
581 Ga0501074_0158033
582 Ga0501225_0112098
583 nmdc:mga03683_6336_c1
584 nmdc:mga00v17_517767_c1
585 nmdc:mga00v17_979_c1
586 nmdc:mga0yw44_269385_c1
587 nmdc:mga0yw44_558023_c1
588 nmdc:mga0k408_16477_c1
589 nmdc:mga0k408_5210_c1
590 nmdc:mga06z11_23333_c1
591 nmdc:mga07m45_167565_c1
592 nmdc:mga05p37_254055_c1
593 nmdc:mga05p37_2676_c1
594 nmdc:mga05p37_349428_c1
595 nmdc:mga05p37_3777_c1
596 nmdc:mga05p37_57804_c1
597 nmdc:mga05p37_752103_c1
598 nmdc:mga09592_28786_c1
599 nmdc:mga0qj67_96720_c1
600 nmdc:mga0qj67_97231_c1
601 nmdc:mga06r32_10364_c1
602 nmdc:mga06r32_2008_c1
603 nmdc:mga06r32_205798_c1
604 nmdc:mga06r32_693887_c1
605 nmdc:mga08y16_546046_c1
606 nmdc:mga08y16_69684_c1
607 nmdc:mga08y16_80031_c1
608 nmdc:mga0n895_133002_c1
609 nmdc:mga0n895_356188_c1
610 nmdc:mga0n895_44398_c1
611 nmdc:mga0n895_6_c1
612 nmdc:mga0n895_969_c2
613 nmdc:mga0rr50_10558_c1
614 nmdc:mga0rr50_21624_c1
615 nmdc:mga0rr50_259_c1
616 nmdc:mga0rr50_507031_c1
617 nmdc:mga0rr50_7_c1
618 nmdc:mga08x19_198267_c1
619 nmdc:mga08x19_67_c1
620 nmdc:mga08x19_7848_c1
621 nmdc:mga08x19_80845_c1
622 nmdc:mga0a205_106740_c1
623 nmdc:mga0a205_177428_c1
624 nmdc:mga0a205_330679_c1
625 nmdc:mga0a205_499876_c1
626 Ga0500628_010088
627 Ga0590071_000312
628 Ga0590074_000777
629 Ga0590075_000223
630 Ga0590077_000389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03781

FGE-sulfatase

Sulfatase-modifying factor enzyme 1

30

253

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y3c-assembly1.cif.gz_A treponema denticola variable protein 1 0.7607 13 233
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.7369 10 235
2y3c-assembly1.cif.gz_A treponema denticola variable protein 1 0.7168 13 233
6muj-assembly1.cif.gz_A formylglycine generating enzyme bound to copper 0.7079 10 235
5nxl-assembly1.cif.gz_A formylglycine generating enzyme from t. curvata in complex with ag(i) 0.7039 11 235
ID Description Score Start End Superfamily
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7546 13 233 3.90.1580.10
2y3cA00 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.7111 13 233 3.90.1580.10
af_I6Y8I5_2_297_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6675 12 235 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6625 1 234 3.90.1580.10
af_A0A2R8Q5G7_74_369_3.90.1580.10 Alpha Beta;Alpha-Beta Complex;paralog of FGE (formylglycine-generating enzyme);paralog of FGE (formylglycine-generating enzyme) 0.6572 1 234 3.90.1580.10
ID Description Score Start End GO Terms
AF-A0A6L8DQT1-F1-model_v4 Formylglycine-generating enzyme family protein 0.9679 12 122 GO:0120147
AF-A0A2E0XJD3-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9353 13 123 GO:0120147
AF-A0A2E1W2V0-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9258 8 132 GO:0120147
AF-A0A2V8FQ51-F1-model_v4 Sulfatase-modifying factor enzyme domain-containing protein 0.9126 23 171 GO:0120147
AF-A0A6L8DQT1-F1-model_v4 Formylglycine-generating enzyme family protein 0.9044 12 122 GO:0120147

Map