F402871

General Info

Members Datasets Scaffolds Average Seq Length
314 226 282 303

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0076381|Ga0496104_0076381_1558_2598
Length 336
Sequence MRQPRSINSQLNPEVAVMTTNSAPSPGPVGTNAVALDAALPPSGGAAASGRSLREKLVGRQPIGMLLSLPYAVYIALIFAYPLGFAIWMSFHDYFFTAPGVTVAHPFVGLDNYKAVLTDPAVLASFAHVGIFLIINVPLTVVXXXXLATALNRGIRGQTFFRVAYYVPYVTASVAVVGVWLFLFSDNGLVNNILGPLAPDPSWLVSSTWAMPLIALFVTWKQLGFFILLYLAALQNVPKELYESASTDGASGFQTFMSVTGPGVRPASGLVILLAFITGANLFTEPYLLTGPVLLIYQKGIQQGNPDVASALGVIXXIVVLIVGLANLWLNERGTK

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221572 Leifsonia sp. Root60 Isolate Unclassified
3 2643221616 Leifsonia sp. Root227 Isolate Unclassified
4 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
5 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
6 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
7 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
8 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
9 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
10 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
11 2855683550 Micromonospora sp. RP3T Isolate Unclassified
12 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
13 2862574272 Streptomyces sp. AcE210 Isolate Nodule
14 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
15 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
16 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
17 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
18 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
19 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
20 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
21 2928153084 Leifsonia sp. 563 Isolate Unclassified
22 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
23 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
24 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
25 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
26 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
27 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
28 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
29 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
36 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
39 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
40 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
86 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
115 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
116 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
200 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
224 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
225 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
226 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 1.91
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 0.32
Rhizoplane 12.74
Rhizosphere 65.92
Stem 0
Stem Tuber 0.32
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010469 3300001989 Bacteria 3444
2 JGI24737J22298_10015839 3300001990 Bacteria 2437
3 JGI25164J39214_1001108 3300002772 Bacteria 7691
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 Ga0006562J51391_1035885 3300003578 Bacteria 6880
6 Ga0006562J51391_1035886 3300003578 Bacteria 5470
7 Ga0055539_1000035 3300003752 Bacteria 217588
8 Ga0055533_1000001 3300003756 Bacteria 1863437
9 Ga0055525_1000279 3300003759 Bacteria 47019
10 Ga0055527_1000012 3300003760 Bacteria 348744
11 Ga0055542_1000017 3300003762 Bacteria 348744
12 Ga0055529_1000023 3300003763 Bacteria 314383
13 Ga0055541_1002026 3300003841 Bacteria 4147
14 Ga0070658_10033663 3300005327 Bacteria 4123
15 Ga0070658_10057680 3300005327 Bacteria 3159
16 Ga0070683_100022128 3300005329 Bacteria 5679
17 Ga0070683_100055152 3300005329 Bacteria 3687
18 Ga0070683_100256979 3300005329 Bacteria 1661
19 Ga0070710_10022791 3300005437 Bacteria 3282
20 Ga0070700_100350740 3300005441 Bacteria 1094
21 Ga0070681_10265553 3300005458 Bacteria 1628
22 Ga0068867_100318751 3300005459 Bacteria 1287
23 Ga0070684_100136076 3300005535 Bacteria 2219
24 Ga0070684_100273667 3300005535 Bacteria 1546
25 Ga0070684_100308992 3300005535 Bacteria 1452
26 Ga0070665_100032742 3300005548 Bacteria 5230
27 Ga0070665_100073607 3300005548 Bacteria 3422
28 Ga0070702_100045564 3300005615 Bacteria 2482
29 Ga0081455_10080702 3300005937 Bacteria 2666
30 Ga0070717_10051702 3300006028 Bacteria 3383
31 Ga0075365_10009699 3300006038 Bacteria 5557
32 Ga0075365_10058357 3300006038 Bacteria 2569
33 Ga0075365_10146010 3300006038 Bacteria 1644
34 Ga0075364_10044452 3300006051 Bacteria 2889
35 Ga0075364_10086493 3300006051 Bacteria 2077
36 Ga0075432_10008023 3300006058 Bacteria 3601
37 Ga0075369_10041857 3300006186 Bacteria 1962
38 Ga0075430_100006843 3300006846 Bacteria 9610
39 Ga0111539_10013580 3300009094 Bacteria 10182
40 Ga0111539_10177393 3300009094 Bacteria 2489
41 Ga0105245_10530252 3300009098 Bacteria 1197
42 Ga0105247_10163112 3300009101 Bacteria 1477
43 Ga0114129_10647962 3300009147 Bacteria 1364
44 Ga0105243_10025837 3300009148 Bacteria 4491
45 Ga0105243_10055194 3300009148 Bacteria 3156
46 Ga0105243_10240234 3300009148 Bacteria 1612
47 Ga0105243_10597717 3300009148 Bacteria 1062
48 Ga0105242_10042072 3300009176 Bacteria 3687
49 Ga0105238_10340247 3300009551 Bacteria 1488
50 Ga0105029_101409 3300009984 Bacteria 1489
51 Ga0105246_10020963 3300011119 Bacteria 4198
52 Ga0105246_10079974 3300011119 Bacteria 2325
53 Ga0105246_10158367 3300011119 Bacteria 1722
54 Ga0157369_10544203 3300013105 Bacteria 1200
55 Ga0157369_10550383 3300013105 Bacteria 1193
56 Ga0157374_10201733 3300013296 Bacteria 1948
57 Ga0157378_10127241 3300013297 Bacteria 2354
58 Ga0163162_10010997 3300013306 Bacteria 8814
59 Ga0163162_10418118 3300013306 Bacteria 1473
60 Ga0157372_10019450 3300013307 Bacteria 7319
61 Ga0157372_10324114 3300013307 Bacteria 1794
62 Ga0157375_10007296 3300013308 Bacteria 9675
63 Ga0157375_10137762 3300013308 Bacteria 2566
64 Ga0163163_10038814 3300014325 Bacteria 4643
65 Ga0157380_10215048 3300014326 Bacteria 1716
66 Ga0157377_10131568 3300014745 Bacteria 1529
67 Ga0197907_10675743 3300020069 Bacteria 2176
68 Ga0206351_10307727 3300020077 Bacteria 3271
69 Ga0224712_10000912 3300022467 Bacteria 6369
70 Ga0209566_100078 3300025225 Bacteria 158974
71 Ga0209674_100001 3300025226 Bacteria 4013750
72 Ga0209672_100003 3300025228 Bacteria 1560476
73 Ga0209147_101301 3300025229 Bacteria 9623
74 Ga0209563_100001 3300025230 Bacteria 4013775
75 Ga0207427_100034 3300025231 Bacteria 320342
76 Ga0209437_100429 3300025233 Bacteria 36897
77 Ga0209677_100001 3300025253 Bacteria 4013787
78 Ga0209677_100284 3300025253 Bacteria 33586
79 Ga0209148_1000004 3300025254 Bacteria 1844481
80 Ga0209233_1000001 3300025261 Bacteria 2992747
81 Ga0209455_1000022 3300025272 Bacteria 688910
82 Ga0209455_1003162 3300025272 Bacteria 5981
83 Ga0209758_1006204 3300025297 Bacteria 8732
84 Ga0207692_10029386 3300025898 Bacteria 2612
85 Ga0207642_10107788 3300025899 Bacteria 1412
86 Ga0207710_10123057 3300025900 Bacteria 1240
87 Ga0207647_10034763 3300025904 Bacteria 3215
88 Ga0207652_10365119 3300025921 Bacteria 1303
89 Ga0207687_10024772 3300025927 Bacteria 4011
90 Ga0207686_10058506 3300025934 Bacteria 2430
91 Ga0207709_10210916 3300025935 Bacteria 1394
92 Ga0207709_10318741 3300025935 Bacteria 1163
93 Ga0207670_10447011 3300025936 Bacteria 1041
94 Ga0207689_10071634 3300025942 Bacteria 2847
95 Ga0207661_10073173 3300025944 Bacteria 2806
96 Ga0207661_10433635 3300025944 Bacteria 1195
97 Ga0207658_10084727 3300025986 Bacteria 2440
98 Ga0207677_10488655 3300026023 Bacteria 1062
99 Ga0207639_10345429 3300026041 Bacteria 1328
100 Ga0207639_10354397 3300026041 Bacteria 1311
101 Ga0207678_10315746 3300026067 Bacteria 1344
102 Ga0207708_10079447 3300026075 Bacteria 2520
103 Ga0207675_100121993 3300026118 Bacteria 2467
104 Ga0207683_10197302 3300026121 Bacteria 1829
105 Ga0207428_10078475 3300027907 Bacteria 2583
106 Ga0268266_10380025 3300028379 Bacteria 1332
107 Ga0265337_1001403 3300028556 Bacteria 11827
108 Ga0265326_10001352 3300028558 Bacteria 8683
109 Ga0265319_1003719 3300028563 Bacteria 7841
110 Ga0265334_10007398 3300028573 Bacteria 4708
111 Ga0265323_10001726 3300028653 Bacteria 10373
112 Ga0265322_10012576 3300028654 Bacteria 2449
113 Ga0265338_10003834 3300028800 Bacteria 20886
114 Ga0265324_10007214 3300029957 Bacteria 4536
115 Ga0265332_10001765 3300031238 Bacteria 11691
116 Ga0265320_10011910 3300031240 Bacteria 5092
117 Ga0265325_10004998 3300031241 Bacteria 8256
118 Ga0307513_10001603 3300031456 Bacteria 32478
119 Ga0307514_10057834 3300031649 Bacteria 2969
120 Ga0265314_10008551 3300031711 Bacteria 8752
121 Ga0265342_10005522 3300031712 Bacteria 9610
122 Ga0307405_10034842 3300031731 Bacteria 3000
123 Ga0307405_10084566 3300031731 Bacteria 2083
124 Ga0307405_10257013 3300031731 Bacteria 1303
125 Ga0307410_10104298 3300031852 Bacteria 2038
126 Ga0326468_10000172 3300031889 Bacteria 6396
127 Ga0307406_10145449 3300031901 Bacteria 1684
128 Ga0307407_10103890 3300031903 Bacteria 1769
129 Ga0307409_100019306 3300031995 Bacteria 4610
130 Ga0307409_100045564 3300031995 Bacteria 3312
131 Ga0307416_100001640 3300032002 Bacteria 12336
132 Ga0307416_100044254 3300032002 Bacteria 3494
133 Ga0307416_100223439 3300032002 Bacteria 1808
134 Ga0307414_10046775 3300032004 Bacteria 2973
135 Ga0307411_10168014 3300032005 Bacteria 1651
136 Ga0307415_100001169 3300032126 Bacteria 12268
137 Ga0307415_100029541 3300032126 Bacteria 3505
138 Ga0307415_100033249 3300032126 Bacteria 3347
139 Ga0307415_100042499 3300032126 Bacteria 3025
140 Ga0307415_100133779 3300032126 Bacteria 1882
141 Ga0265778_000424 3300036457 Bacteria 3299
142 Ga0395899_0006333 3300037312 Bacteria 9162
143 Ga0395899_0086641 3300037312 Bacteria 2274
144 Ga0395899_0095450 3300037312 Bacteria 2151
145 Ga0395900_0009418 3300037418 Bacteria 10014
146 Ga0395900_0057469 3300037418 Bacteria 4005
147 Ga0395900_0119253 3300037418 Bacteria 2708
148 Ga0395900_0146878 3300037418 Bacteria 2411
149 Ga0395898_0011190 3300037466 Bacteria 9341
150 Ga0395898_0018387 3300037466 Bacteria 7126
151 Ga0395898_0090246 3300037466 Bacteria 2949
152 Ga0395898_0465749 3300037466 Bacteria 1203
153 Ga0395905_0491274 3300037471 Bacteria 1127
154 Ga0395901_0007510 3300038443 Bacteria 11011
155 Ga0466972_0007503 3300044658 Bacteria 5477
156 Ga0466966_0047045 3300044684 Bacteria 2752
157 Ga0466961_0027141 3300044693 Bacteria 3681
158 Ga0466968_0035372 3300044735 Bacteria 2090
159 Ga0466970_0012829 3300044765 Bacteria 4289
160 Ga0466970_0013091 3300044765 Bacteria 4250
161 Ga0466970_0096779 3300044765 Bacteria 1605
162 Ga0466960_0057018 3300044901 Bacteria 1903
163 Ga0466959_0107552 3300045049 Bacteria 1993
164 Ga0466958_0027982 3300045836 Bacteria 3339
165 Ga0495627_035352 3300046453 Bacteria 1558
166 Ga0495653_0001369 3300046463 Bacteria 18935
167 Ga0495580_0020440 3300046472 Bacteria 4898
168 Ga0495582_0030161 3300046473 Bacteria 2976
169 Ga0495664_0006601 3300046477 Bacteria 6413
170 Ga0495585_0206763 3300046492 Bacteria 997
171 Ga0495594_0022086 3300046499 Bacteria 3402
172 Ga0495594_0106221 3300046499 Bacteria 1581
173 Ga0495607_0048108 3300046501 Bacteria 2495
174 Ga0495583_0098855 3300046506 Bacteria 1247
175 Ga0495620_0065990 3300046515 Bacteria 1492
176 Ga0495630_0360769 3300046517 Bacteria 1112
177 Ga0495665_0000794 3300046531 Bacteria 16521
178 Ga0495586_0001578 3300046535 Bacteria 12557
179 Ga0495645_0002190 3300046543 Bacteria 13279
180 Ga0495633_0097700 3300046558 Bacteria 1364
181 Ga0495667_0141241 3300046559 Bacteria 1552
182 Ga0495611_0019731 3300046648 Bacteria 2897
183 Ga0495611_0044611 3300046648 Bacteria 1983
184 Ga0495625_0069434 3300046660 Bacteria 2475
185 Ga0495625_0095676 3300046660 Bacteria 2047
186 Ga0495588_0178743 3300046674 Bacteria 1121
187 Ga0495657_0062768 3300046675 Bacteria 2453
188 Ga0495670_0002088 3300046691 Bacteria 9853
189 Ga0495670_0064540 3300046691 Bacteria 1845
190 Ga0495600_0214770 3300046809 Bacteria 1232
191 Ga0495581_0026270 3300047315 Bacteria 3376
192 Ga0495636_0021546 3300047318 Bacteria 2603
193 Ga0495636_0029570 3300047318 Bacteria 2237
194 Ga0495674_0294378 3300047319 Bacteria 1327
195 Ga0495680_0019762 3300047322 Bacteria 5681
196 Ga0495675_0003212 3300047444 Bacteria 9825
197 Ga0495685_038452 3300047447 Bacteria 1639
198 Ga0495593_0115026 3300047673 Bacteria 1372
199 Ga0495593_0207015 3300047673 Bacteria 985
200 Ga0496100_0001733 3300048903 Bacteria 10873
201 Ga0496100_0135907 3300048903 Bacteria 1737
202 Ga0496100_0269727 3300048903 Bacteria 1265
203 Ga0496101_0013769 3300048904 Bacteria 5425
204 Ga0496102_0019530 3300048905 Bacteria 5969
205 Ga0496102_0025612 3300048905 Bacteria 5254
206 Ga0496102_0117272 3300048905 Bacteria 2484
207 Ga0496102_0256462 3300048905 Bacteria 1649
208 Ga0496103_0002806 3300048906 Bacteria 10839
209 Ga0496103_0024366 3300048906 Bacteria 3653
210 Ga0496104_0006638 3300048907 Bacteria 10184
211 Ga0496104_0076381 3300048907 Bacteria 3191
212 Ga0496104_0121346 3300048907 Bacteria 2509
213 Ga0496105_0029740 3300048908 Bacteria 4472
214 Ga0496105_0045670 3300048908 Bacteria 3614
215 Ga0496105_0061517 3300048908 Bacteria 3098
216 Ga0496106_0003704 3300048909 Bacteria 11404
217 Ga0496106_0258314 3300048909 Bacteria 1394
218 Ga0496107_0005802 3300048910 Bacteria 8451
219 Ga0496107_0175760 3300048910 Bacteria 1590
220 Ga0496108_0000086 3300048911 Bacteria 100279
221 Ga0496108_0246393 3300048911 Bacteria 1554
222 Ga0496109_0050149 3300048912 Bacteria 3802
223 Ga0496110_0016424 3300048913 Bacteria 6180
224 Ga0496110_0055424 3300048913 Bacteria 3488
225 Ga0496110_0191396 3300048913 Bacteria 1858
226 Ga0496110_0193315 3300048913 Bacteria 1847
227 Ga0496111_0009930 3300048914 Bacteria 6363
228 Ga0496111_0097867 3300048914 Bacteria 2154
229 Ga0496112_0027014 3300048915 Bacteria 5533
230 Ga0496113_0025362 3300048916 Bacteria 4225
231 Ga0496113_0120269 3300048916 Bacteria 2052
232 Ga0496114_0001724 3300048917 Bacteria 16598
233 Ga0496114_0018723 3300048917 Bacteria 5603
234 Ga0496114_0021819 3300048917 Bacteria 5211
235 Ga0496114_0040437 3300048917 Bacteria 3861
236 Ga0496114_0047091 3300048917 Bacteria 3585
237 Ga0496114_0141698 3300048917 Bacteria 2082
238 Ga0496115_0017972 3300048918 Bacteria 5417
239 Ga0496115_0110467 3300048918 Bacteria 2258
240 Ga0496117_0000028 3300048920 Bacteria 407392
241 Ga0496117_0005632 3300048920 Bacteria 13080
242 Ga0496117_0028299 3300048920 Bacteria 4344
243 Ga0496117_0072708 3300048920 Bacteria 2297
244 Ga0496119_0025212 3300048922 Bacteria 4158
245 Ga0496122_0022672 3300048925 Bacteria 5573
246 Ga0496123_0030739 3300048926 Bacteria 3924
247 Ga0496124_0072731 3300048927 Bacteria 2846
248 Ga0496124_0100792 3300048927 Bacteria 2340
249 Ga0496125_0024707 3300048928 Bacteria 5518
250 Ga0496126_0370784 3300048929 Bacteria 1167
251 Ga0501031_0063566 3300049568 Bacteria 2404
252 Ga0501032_0142916 3300049569 Bacteria 1576
253 Ga0501033_0273937 3300049570 Bacteria 1192
254 Ga0501034_0007853 3300049571 Bacteria 11342
255 Ga0501034_0068830 3300049571 Bacteria 3550
256 Ga0501034_0114367 3300049571 Bacteria 2687
257 Ga0501036_0004959 3300049572 Bacteria 10758
258 Ga0501038_0011479 3300049574 Bacteria 8081
259 Ga0501038_0064956 3300049574 Bacteria 3111
260 Ga0501039_0002465 3300049575 Bacteria 13773
261 Ga0501043_0002030 3300049579 Bacteria 17283
262 Ga0501047_0018671 3300049581 Bacteria 6649
263 Ga0501067_0130670 3300049583 Bacteria 1398
264 Ga0501070_0011563 3300049586 Bacteria 7451
265 Ga0501074_0036844 3300049590 Bacteria 3543
266 Ga0501035_0278984 3300049822 Bacteria 1413
267 Ga0501044_0030858 3300049823 Bacteria 5644
268 nmdc:mga00v17_162274_c1 3300050491 Bacteria 1439
269 nmdc:mga00v17_97781_c1 3300050491 Bacteria 1850
270 nmdc:mga0yw44_145334_c1 3300050492 Bacteria 1544
271 nmdc:mga0yw44_179632_c1 3300050492 Bacteria 1393
272 nmdc:mga0yw44_51059_c1 3300050492 Bacteria 2503
273 nmdc:mga08y16_261695_c1 3300050511 Bacteria 1786
274 nmdc:mga08y16_9746_c1 3300050511 Bacteria 10089
275 nmdc:mga0sz30_111833_c1 3300050516 Bacteria 1197
276 nmdc:mga0sz30_15999_c1 3300050516 Bacteria 2970
277 Ga0500635_0000023 3300053080 Bacteria 108024
278 Ga0495619_0367034 3300053085 Bacteria 995
279 Ga0500573_0000005 3300053140 Bacteria 315762
280 Ga0500573_0036999 3300053140 Bacteria 2819
281 Ga0500577_0002977 3300053142 Bacteria 4366
282 Ga0500577_0012925 3300053142 Bacteria 2537

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10315746 Ga0207678_103157462 246
2 3300048920 Ga0496117_0005632 Ga0496117_0005632_7435_8451 252
3 3300028556 Ga0265337_1001403 Ga0265337_10014034 256
4 3300028558 Ga0265326_10001352 Ga0265326_100013523 256
5 3300028563 Ga0265319_1003719 Ga0265319_10037196 256
6 3300028573 Ga0265334_10007398 Ga0265334_100073983 256
7 3300028653 Ga0265323_10001726 Ga0265323_100017264 256
8 3300028654 Ga0265322_10012576 Ga0265322_100125763 256
9 3300028800 Ga0265338_10003834 Ga0265338_100038349 256
10 3300029957 Ga0265324_10007214 Ga0265324_100072142 256
11 3300031238 Ga0265332_10001765 Ga0265332_100017653 256
12 3300031240 Ga0265320_10011910 Ga0265320_100119103 256
13 3300031241 Ga0265325_10004998 Ga0265325_100049981 256
14 3300031711 Ga0265314_10008551 Ga0265314_100085516 256
15 3300031712 Ga0265342_10005522 Ga0265342_100055223 256
16 3300046492 Ga0495585_0206763 Ga0495585_0206763_10_909 264
17 3300046648 Ga0495611_0019731 Ga0495611_0019731_275_1174 264
18 3300049570 Ga0501033_0273937 Ga0501033_0273937_20_955 264
19 3300049571 Ga0501034_0007853 Ga0501034_0007853_7442_8377 264
20 3300049572 Ga0501036_0004959 Ga0501036_0004959_3553_4488 264
21 3300049574 Ga0501038_0064956 Ga0501038_0064956_1542_2477 264
22 3300049575 Ga0501039_0002465 Ga0501039_0002465_3098_4033 264
23 3300049579 Ga0501043_0002030 Ga0501043_0002030_9738_10673 264
24 3300049581 Ga0501047_0018671 Ga0501047_0018671_2146_3081 264
25 3300049586 Ga0501070_0011563 Ga0501070_0011563_504_1439 264
26 3300049590 Ga0501074_0036844 Ga0501074_0036844_245_1180 264
27 3300031649 Ga0307514_10057834 Ga0307514_100578342 266
28 3300048917 Ga0496114_0047091 Ga0496114_0047091_427_1383 266
29 3300036457 Ga0265778_000424 Ga0265778_000424_225_1193 267
30 3300009984 Ga0105029_101409 Ga0105029_1014092 268
31 3300003578 Ga0006562J51391_1035885 Ga0006562J51391_10358853 270
32 3300003578 Ga0006562J51391_1035886 Ga0006562J51391_10358863 270
33 3300006028 Ga0070717_10051702 Ga0070717_100517023 270
34 3300048916 Ga0496113_0120269 Ga0496113_0120269_47_895 270
35 3300048917 Ga0496114_0040437 Ga0496114_0040437_2215_3153 271
36 3300048928 Ga0496125_0024707 Ga0496125_0024707_4014_4988 273
37 3300009094 Ga0111539_10013580 Ga0111539_100135803 275
38 3300027907 Ga0207428_10078475 Ga0207428_100784753 275
39 3300050511 nmdc:mga08y16_9746_c1 nmdc:mga08y16_9746_c1_7863_8813 275
40 3300009147 Ga0114129_10647962 Ga0114129_106479622 276
41 3300009551 Ga0105238_10340247 Ga0105238_103402472 276
42 3300037418 Ga0395900_0146878 Ga0395900_0146878_1146_2012 277
43 3300037466 Ga0395898_0090246 Ga0395898_0090246_1277_2143 277
44 3300038443 Ga0395901_0007510 Ga0395901_0007510_727_1593 277
45 3300005327 Ga0070658_10033663 Ga0070658_100336634 278
46 3300047673 Ga0495593_0115026 Ga0495593_0115026_347_1243 278
47 3300049571 Ga0501034_0114367 Ga0501034_0114367_74_1075 278
48 3300005329 Ga0070683_100022128 Ga0070683_1000221285 279
49 3300005459 Ga0068867_100318751 Ga0068867_1003187511 279
50 3300005535 Ga0070684_100273667 Ga0070684_1002736672 279
51 3300005548 Ga0070665_100073607 Ga0070665_1000736072 279
52 3300009101 Ga0105247_10163112 Ga0105247_101631122 279
53 3300009148 Ga0105243_10025837 Ga0105243_100258372 279
54 3300011119 Ga0105246_10158367 Ga0105246_101583672 279
55 3300013306 Ga0163162_10418118 Ga0163162_104181182 279
56 3300013308 Ga0157375_10137762 Ga0157375_101377622 279
57 3300014325 Ga0163163_10038814 Ga0163163_100388142 279
58 3300014745 Ga0157377_10131568 Ga0157377_101315682 279
59 3300025900 Ga0207710_10123057 Ga0207710_101230572 279
60 3300025927 Ga0207687_10024772 Ga0207687_100247722 279
61 3300025944 Ga0207661_10073173 Ga0207661_100731732 279
62 3300028379 Ga0268266_10380025 Ga0268266_103800252 279
63 3300047673 Ga0495593_0207015 Ga0495593_0207015_130_975 280
64 3300048911 Ga0496108_0000086 Ga0496108_0000086_61732_62574 280
65 3300049571 Ga0501034_0068830 Ga0501034_0068830_1445_2287 280
66 3300053085 Ga0495619_0367034 Ga0495619_0367034_130_972 280
67 3300005441 Ga0070700_100350740 Ga0070700_1003507401 281
68 3300026041 Ga0207639_10345429 Ga0207639_103454292 281
69 3300009148 Ga0105243_10597717 Ga0105243_105977171 283
70 3300013306 Ga0163162_10010997 Ga0163162_100109972 283
71 3300013308 Ga0157375_10007296 Ga0157375_100072964 283
72 3300046674 Ga0495588_0178743 Ga0495588_0178743_130_984 283
73 3300048903 Ga0496100_0001733 Ga0496100_0001733_9940_10794 283
74 3300048904 Ga0496101_0013769 Ga0496101_0013769_2220_3074 283
75 3300048905 Ga0496102_0019530 Ga0496102_0019530_1451_2305 283
76 3300048906 Ga0496103_0002806 Ga0496103_0002806_8483_9337 283
77 3300048909 Ga0496106_0003704 Ga0496106_0003704_2307_3161 283
78 3300048910 Ga0496107_0005802 Ga0496107_0005802_5335_6189 283
79 3300048912 Ga0496109_0050149 Ga0496109_0050149_1240_2094 283
80 3300048913 Ga0496110_0016424 Ga0496110_0016424_2212_3066 283
81 3300048914 Ga0496111_0009930 Ga0496111_0009930_2291_3145 283
82 3300031731 Ga0307405_10257013 Ga0307405_102570132 284
83 3300032126 Ga0307415_100133779 Ga0307415_1001337792 284
84 3300032126 Ga0307415_100033249 Ga0307415_1000332492 285
85 3300032002 Ga0307416_100044254 Ga0307416_1000442542 286
86 3300009098 Ga0105245_10530252 Ga0105245_105302522 287
87 3300032002 Ga0307416_100223439 Ga0307416_1002234392 287
88 3300048913 Ga0496110_0193315 Ga0496110_0193315_624_1487 287
89 iso_pu_bacteria 2795385470 2795782387 287
90 iso_pu_bacteria 2855683550 2855685447 287
91 3300009176 Ga0105242_10042072 Ga0105242_100420722 288
92 3300025934 Ga0207686_10058506 Ga0207686_100585062 288
93 iso_pu_bacteria 2816332119 2816423906 288
94 3300002772 JGI25164J39214_1001108 JGI25164J39214_10011083 289
95 3300003214 JGI25165J46597_1000002 JGI25165J46597_1000002276 289
96 3300025231 Ga0207427_100034 Ga0207427_100034204 289
97 3300025233 Ga0209437_100429 Ga0209437_10042933 289
98 3300025261 Ga0209233_1000001 Ga0209233_10000012529 289
99 3300046809 Ga0495600_0214770 Ga0495600_0214770_173_1135 289
100 3300048907 Ga0496104_0006638 Ga0496104_0006638_6477_7439 289
101 3300048908 Ga0496105_0061517 Ga0496105_0061517_902_1864 289
102 iso_pu_bacteria 2862290372 2862292681 289
103 3300048922 Ga0496119_0025212 Ga0496119_0025212_233_1207 290
104 3300048925 Ga0496122_0022672 Ga0496122_0022672_1898_2872 290
105 3300048926 Ga0496123_0030739 Ga0496123_0030739_2319_3293 290
106 3300048927 Ga0496124_0100792 Ga0496124_0100792_1332_2306 290
107 3300049569 Ga0501032_0142916 Ga0501032_0142916_371_1243 290
108 3300049574 Ga0501038_0011479 Ga0501038_0011479_354_1226 290
109 3300049823 Ga0501044_0030858 Ga0501044_0030858_3096_3968 290
110 iso_pu_bacteria 2912757875 2912764844 291
111 3300031889 Ga0326468_10000172 Ga0326468_100001726 292
112 3300048903 Ga0496100_0135907 Ga0496100_0135907_597_1586 292
113 3300050492 nmdc:mga0yw44_179632_c1 nmdc:mga0yw44_179632_c1_136_1014 292
114 3300031731 Ga0307405_10084566 Ga0307405_100845662 293
115 3300031852 Ga0307410_10104298 Ga0307410_101042982 293
116 3300031903 Ga0307407_10103890 Ga0307407_101038902 293
117 3300031995 Ga0307409_100019306 Ga0307409_1000193063 293
118 3300032002 Ga0307416_100001640 Ga0307416_1000016408 293
119 3300032004 Ga0307414_10046775 Ga0307414_100467752 293
120 3300032005 Ga0307411_10168014 Ga0307411_101680142 293
121 3300032126 Ga0307415_100001169 Ga0307415_1000011695 293
122 3300032126 Ga0307415_100042499 Ga0307415_1000424992 293
123 3300013307 Ga0157372_10324114 Ga0157372_103241142 294
124 3300025904 Ga0207647_10034763 Ga0207647_100347632 294
125 3300025942 Ga0207689_10071634 Ga0207689_100716344 294
126 3300048907 Ga0496104_0121346 Ga0496104_0121346_1242_2195 294
127 3300048910 Ga0496107_0175760 Ga0496107_0175760_137_1090 294
128 3300048917 Ga0496114_0018723 Ga0496114_0018723_4488_5441 294
129 3300048918 Ga0496115_0110467 Ga0496115_0110467_187_1140 294
130 iso_pu_bacteria 2862574272 2862581670 294
131 3300003760 Ga0055527_1000012 Ga0055527_1000012155 295
132 3300003762 Ga0055542_1000017 Ga0055542_1000017155 295
133 3300003763 Ga0055529_1000023 Ga0055529_1000023122 295
134 3300006846 Ga0075430_100006843 Ga0075430_1000068439 295
135 3300025228 Ga0209672_100003 Ga0209672_100003191 295
136 3300025229 Ga0209147_101301 Ga0209147_1013014 295
137 3300025254 Ga0209148_1000004 Ga0209148_1000004486 295
138 3300025272 Ga0209455_1000022 Ga0209455_1000022498 295
139 3300031901 Ga0307406_10145449 Ga0307406_101454492 295
140 3300037466 Ga0395898_0465749 Ga0395898_0465749_133_1020 295
141 3300046558 Ga0495633_0097700 Ga0495633_0097700_264_1160 295
142 3300046691 Ga0495670_0002088 Ga0495670_0002088_3898_4794 295
143 3300047318 Ga0495636_0021546 Ga0495636_0021546_1015_1911 295
144 3300048908 Ga0496105_0029740 Ga0496105_0029740_3327_4280 295
145 3300048920 Ga0496117_0000028 Ga0496117_0000028_8438_9412 295
146 3300048920 Ga0496117_0072708 Ga0496117_0072708_120_1076 295
147 3300048927 Ga0496124_0072731 Ga0496124_0072731_137_1111 295
148 3300049822 Ga0501035_0278984 Ga0501035_0278984_69_1070 295
149 3300053142 Ga0500577_0002977 Ga0500577_0002977_2070_2987 295
150 3300053142 Ga0500577_0012925 Ga0500577_0012925_800_1717 295
151 iso_pu_bacteria 2919443155 2919444888 295
152 3300013296 Ga0157374_10201733 Ga0157374_102017331 296
153 3300013297 Ga0157378_10127241 Ga0157378_101272412 296
154 3300025297 Ga0209758_1006204 Ga0209758_10062043 296
155 3300037471 Ga0395905_0491274 Ga0395905_0491274_160_1101 296
156 3300046472 Ga0495580_0020440 Ga0495580_0020440_721_1629 296
157 3300048903 Ga0496100_0269727 Ga0496100_0269727_207_1115 296
158 3300048905 Ga0496102_0025612 Ga0496102_0025612_1771_2679 296
159 3300048906 Ga0496103_0024366 Ga0496103_0024366_817_1725 296
160 3300053140 Ga0500573_0000005 Ga0500573_0000005_198773_199708 296
161 3300053140 Ga0500573_0036999 Ga0500573_0036999_68_997 296
162 iso_pu_bacteria 2643221572 2643876979 296
163 iso_pu_bacteria 2643221669 2644384034 296
164 iso_pu_bacteria 2811994882 2812374786 296
165 iso_pu_bacteria 2895660088 2895662241 296
166 3300046499 Ga0495594_0106221 Ga0495594_0106221_85_1029 297
167 3300046515 Ga0495620_0065990 Ga0495620_0065990_320_1264 297
168 3300046660 Ga0495625_0095676 Ga0495625_0095676_577_1521 297
169 3300046691 Ga0495670_0064540 Ga0495670_0064540_83_1027 297
170 3300047318 Ga0495636_0029570 Ga0495636_0029570_1103_2047 297
171 3300047447 Ga0495685_038452 Ga0495685_038452_529_1473 297
172 iso_pu_bacteria 2990088156 2990088796 297
173 3300006038 Ga0075365_10009699 Ga0075365_100096994 298
174 3300006051 Ga0075364_10044452 Ga0075364_100444522 298
175 3300006186 Ga0075369_10041857 Ga0075369_100418572 298
176 3300049583 Ga0501067_0130670 Ga0501067_0130670_162_1118 298
177 3300050491 nmdc:mga00v17_162274_c1 nmdc:mga00v17_162274_c1_17_973 298
178 iso_pu_bacteria 2811994872 2812322236 298
179 iso_pu_bacteria 2919523602 2919524035 298
180 iso_pu_bacteria 2939598168 2939602176 298
181 iso_pu_bacteria 8004025490 8004027150 298
182 iso_pu_bacteria 8016254467 8016254878 298
183 3300031731 Ga0307405_10034842 Ga0307405_100348422 299
184 3300031995 Ga0307409_100045564 Ga0307409_1000455642 299
185 3300049568 Ga0501031_0063566 Ga0501031_0063566_1210_2148 299
186 iso_pu_bacteria 2833709550 2833710089 299
187 iso_pu_bacteria 2954711539 2954719741 299
188 iso_pu_bacteria 2954721474 2954729776 299
189 iso_pu_bacteria 2954731030 2954732005 299
190 iso_pu_bacteria 2954740390 2954748681 299
191 iso_pu_bacteria 2954749733 2954750972 299
192 iso_pu_bacteria 2954759201 2954767797 299
193 3300005437 Ga0070710_10022791 Ga0070710_100227912 300
194 3300006051 Ga0075364_10086493 Ga0075364_100864932 300
195 3300025898 Ga0207692_10029386 Ga0207692_100293863 300
196 3300032126 Ga0307415_100029541 Ga0307415_1000295411 300
197 3300048907 Ga0496104_0076381 Ga0496104_0076381_1558_2598 300
198 3300048908 Ga0496105_0045670 Ga0496105_0045670_301_1341 300
199 3300048917 Ga0496114_0001724 Ga0496114_0001724_9175_10215 300
200 3300048917 Ga0496114_0141698 Ga0496114_0141698_719_1759 300
201 3300050491 nmdc:mga00v17_97781_c1 nmdc:mga00v17_97781_c1_27_968 300
202 iso_pu_bacteria 2919051321 2919052062 300
203 3300003752 Ga0055539_1000035 Ga0055539_1000035198 301
204 3300003756 Ga0055533_1000001 Ga0055533_1000001324 301
205 3300003759 Ga0055525_1000279 Ga0055525_100027920 301
206 3300003841 Ga0055541_1002026 Ga0055541_10020264 301
207 3300005329 Ga0070683_100055152 Ga0070683_1000551523 301
208 3300005329 Ga0070683_100256979 Ga0070683_1002569792 301
209 3300005458 Ga0070681_10265553 Ga0070681_102655532 301
210 3300005535 Ga0070684_100136076 Ga0070684_1001360762 301
211 3300005535 Ga0070684_100308992 Ga0070684_1003089922 301
212 3300013105 Ga0157369_10550383 Ga0157369_105503832 301
213 3300025225 Ga0209566_100078 Ga0209566_10007848 301
214 3300025226 Ga0209674_100001 Ga0209674_100001325 301
215 3300025230 Ga0209563_100001 Ga0209563_100001325 301
216 3300025253 Ga0209677_100001 Ga0209677_100001325 301
217 3300025272 Ga0209455_1003162 Ga0209455_10031624 301
218 3300025921 Ga0207652_10365119 Ga0207652_103651191 301
219 3300025935 Ga0207709_10318741 Ga0207709_103187412 301
220 3300025944 Ga0207661_10433635 Ga0207661_104336351 301
221 3300026023 Ga0207677_10488655 Ga0207677_104886552 301
222 3300026041 Ga0207639_10354397 Ga0207639_103543972 301
223 3300026121 Ga0207683_10197302 Ga0207683_101973022 301
224 3300037312 Ga0395899_0095450 Ga0395899_0095450_954_1910 301
225 3300037418 Ga0395900_0009418 Ga0395900_0009418_4270_5226 301
226 3300037466 Ga0395898_0011190 Ga0395898_0011190_2460_3416 301
227 3300044658 Ga0466972_0007503 Ga0466972_0007503_3719_4675 301
228 3300044684 Ga0466966_0047045 Ga0466966_0047045_1695_2651 301
229 3300044693 Ga0466961_0027141 Ga0466961_0027141_2064_3020 301
230 3300044735 Ga0466968_0035372 Ga0466968_0035372_894_1850 301
231 3300044765 Ga0466970_0012829 Ga0466970_0012829_1696_2652 301
232 3300044765 Ga0466970_0013091 Ga0466970_0013091_2834_3790 301
233 3300044765 Ga0466970_0096779 Ga0466970_0096779_263_1219 301
234 3300044901 Ga0466960_0057018 Ga0466960_0057018_718_1674 301
235 3300045049 Ga0466959_0107552 Ga0466959_0107552_460_1416 301
236 3300045836 Ga0466958_0027982 Ga0466958_0027982_288_1244 301
237 3300048909 Ga0496106_0258314 Ga0496106_0258314_437_1381 301
238 3300048911 Ga0496108_0246393 Ga0496108_0246393_223_1167 301
239 3300048913 Ga0496110_0055424 Ga0496110_0055424_1817_2761 301
240 3300048914 Ga0496111_0097867 Ga0496111_0097867_1017_1961 301
241 3300048915 Ga0496112_0027014 Ga0496112_0027014_984_1928 301
242 3300048916 Ga0496113_0025362 Ga0496113_0025362_2532_3476 301
243 3300050492 nmdc:mga0yw44_145334_c1 nmdc:mga0yw44_145334_c1_11_985 301
244 3300050516 nmdc:mga0sz30_15999_c1 nmdc:mga0sz30_15999_c1_224_1198 301
245 iso_pu_bacteria 2643221616 2644095610 301
246 iso_pu_bacteria 2844841374 2844841994 301
247 iso_pu_bacteria 2884763398 2884764990 301
248 iso_pu_bacteria 2919055335 2919057628 301
249 iso_pu_bacteria 2928153084 2928155804 301
250 3300005937 Ga0081455_10080702 Ga0081455_100807022 302
251 3300006038 Ga0075365_10058357 Ga0075365_100583573 302
252 3300006038 Ga0075365_10146010 Ga0075365_101460102 302
253 3300006058 Ga0075432_10008023 Ga0075432_100080233 302
254 3300011119 Ga0105246_10020963 Ga0105246_100209633 302
255 3300013105 Ga0157369_10544203 Ga0157369_105442032 302
256 3300046463 Ga0495653_0001369 Ga0495653_0001369_17870_18835 302
257 3300046473 Ga0495582_0030161 Ga0495582_0030161_1671_2636 302
258 3300046477 Ga0495664_0006601 Ga0495664_0006601_739_1704 302
259 3300046499 Ga0495594_0022086 Ga0495594_0022086_2200_3165 302
260 3300046501 Ga0495607_0048108 Ga0495607_0048108_1163_2125 302
261 3300046506 Ga0495583_0098855 Ga0495583_0098855_161_1123 302
262 3300046517 Ga0495630_0360769 Ga0495630_0360769_10_975 302
263 3300046531 Ga0495665_0000794 Ga0495665_0000794_8717_9682 302
264 3300046535 Ga0495586_0001578 Ga0495586_0001578_8645_9610 302
265 3300046543 Ga0495645_0002190 Ga0495645_0002190_4911_5876 302
266 3300046559 Ga0495667_0141241 Ga0495667_0141241_125_1057 302
267 3300046648 Ga0495611_0044611 Ga0495611_0044611_606_1568 302
268 3300046660 Ga0495625_0069434 Ga0495625_0069434_1335_2297 302
269 3300046675 Ga0495657_0062768 Ga0495657_0062768_1386_2351 302
270 3300047315 Ga0495581_0026270 Ga0495581_0026270_1720_2685 302
271 3300047319 Ga0495674_0294378 Ga0495674_0294378_49_981 302
272 3300047322 Ga0495680_0019762 Ga0495680_0019762_226_1191 302
273 3300047444 Ga0495675_0003212 Ga0495675_0003212_8667_9632 302
274 3300048905 Ga0496102_0117272 Ga0496102_0117272_1064_2029 302
275 3300048905 Ga0496102_0256462 Ga0496102_0256462_651_1583 302
276 3300048913 Ga0496110_0191396 Ga0496110_0191396_87_1019 302
277 3300050492 nmdc:mga0yw44_51059_c1 nmdc:mga0yw44_51059_c1_708_1628 302
278 3300005548 Ga0070665_100032742 Ga0070665_1000327425 303
279 3300005615 Ga0070702_100045564 Ga0070702_1000455642 303
280 3300009094 Ga0111539_10177393 Ga0111539_101773932 303
281 3300009148 Ga0105243_10055194 Ga0105243_100551943 303
282 3300014326 Ga0157380_10215048 Ga0157380_102150482 303
283 3300025899 Ga0207642_10107788 Ga0207642_101077882 303
284 3300025936 Ga0207670_10447011 Ga0207670_104470111 303
285 3300026075 Ga0207708_10079447 Ga0207708_100794473 303
286 3300026118 Ga0207675_100121993 Ga0207675_1001219933 303
287 3300031456 Ga0307513_10001603 Ga0307513_1000160316 303
288 3300050511 nmdc:mga08y16_261695_c1 nmdc:mga08y16_261695_c1_616_1554 303
289 3300053080 Ga0500635_0000023 Ga0500635_0000023_103507_104496 303
290 iso_pu_bacteria 8048127548 8048133408 303
291 3300005327 Ga0070658_10057680 Ga0070658_100576802 304
292 3300020069 Ga0197907_10675743 Ga0197907_106757432 304
293 3300020077 Ga0206351_10307727 Ga0206351_103077272 304
294 3300022467 Ga0224712_10000912 Ga0224712_100009124 304
295 3300025253 Ga0209677_100284 Ga0209677_10028417 304
296 3300037312 Ga0395899_0006333 Ga0395899_0006333_5023_5994 304
297 3300037312 Ga0395899_0086641 Ga0395899_0086641_1223_2200 304
298 3300037418 Ga0395900_0057469 Ga0395900_0057469_2498_3469 304
299 3300037418 Ga0395900_0119253 Ga0395900_0119253_1199_2176 304
300 3300037466 Ga0395898_0018387 Ga0395898_0018387_3607_4578 304
301 3300048917 Ga0496114_0021819 Ga0496114_0021819_3037_4017 304
302 3300048918 Ga0496115_0017972 Ga0496115_0017972_1930_2910 304
303 3300048920 Ga0496117_0028299 Ga0496117_0028299_986_1963 304
304 3300048929 Ga0496126_0370784 Ga0496126_0370784_116_1096 304
305 3300050516 nmdc:mga0sz30_111833_c1 nmdc:mga0sz30_111833_c1_123_1100 304
306 iso_pu_bacteria 2515154155 2515850995 304
307 3300046453 Ga0495627_035352 Ga0495627_035352_565_1491 306
308 3300001989 JGI24739J22299_10010469 JGI24739J22299_100104692 314
309 3300001990 JGI24737J22298_10015839 JGI24737J22298_100158392 314
310 3300009148 Ga0105243_10240234 Ga0105243_102402342 314
311 3300011119 Ga0105246_10079974 Ga0105246_100799742 314
312 3300013307 Ga0157372_10019450 Ga0157372_100194507 314
313 3300025935 Ga0207709_10210916 Ga0207709_102109162 314
314 3300025986 Ga0207658_10084727 Ga0207658_100847272 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

146

333

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8527 30 310
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8518 30 310
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.847 30 308
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8386 30 314
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8271 30 308
ID Description Score Start End Superfamily
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8636 30 305 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8635 74 314 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.86 74 314 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8494 74 311 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8394 74 314 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0K2R9X7-F1-model_v4 deleted 0.959 180 314
AF-A0A0K2R9X7-F1-model_v4 deleted 0.9454 180 314
AF-R0CST3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8795 31 314 GO:0005886
GO:0055085
AF-A0A6I1GDL7-F1-model_v4 ABC transporter permease 0.8749 30 311 GO:0005886
GO:0055085
AF-R0CST3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8737 31 314 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
79.3 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map