F402871
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 314 | 226 | 282 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0076381|Ga0496104_0076381_1558_2598 |
| Length | 336 |
| Sequence | MRQPRSINSQLNPEVAVMTTNSAPSPGPVGTNAVALDAALPPSGGAAASGRSLREKLVGRQPIGMLLSLPYAVYIALIFAYPLGFAIWMSFHDYFFTAPGVTVAHPFVGLDNYKAVLTDPAVLASFAHVGIFLIINVPLTVVXXXXLATALNRGIRGQTFFRVAYYVPYVTASVAVVGVWLFLFSDNGLVNNILGPLAPDPSWLVSSTWAMPLIALFVTWKQLGFFILLYLAALQNVPKELYESASTDGASGFQTFMSVTGPGVRPASGLVILLAFITGANLFTEPYLLTGPVLLIYQKGIQQGNPDVASALGVIXXIVVLIVGLANLWLNERGTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 3 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 4 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 5 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 6 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 7 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 8 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 9 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 10 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 11 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 12 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 13 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 14 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 15 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 16 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 17 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 18 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 19 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 20 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 21 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 22 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 23 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 24 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 25 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 26 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 27 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 28 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 29 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 30 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 31 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 32 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 34 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 35 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 41 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 116 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 124 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 125 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 129 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 134 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 138 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 139 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 140 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 143 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 193 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 194 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 198 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 199 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 200 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 220 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 221 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 223 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 224 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 225 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 226 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.9 |
| Metatranscriptomes | 1.91 |
| Isolates | 10.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.06 |
| Nodule | 0.32 |
| Rhizoplane | 12.74 |
| Rhizosphere | 65.92 |
| Stem | 0 |
| Stem Tuber | 0.32 |
| Unclassified | 7.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010469 | 3300001989 | Bacteria | 3444 |
| 2 | JGI24737J22298_10015839 | 3300001990 | Bacteria | 2437 |
| 3 | JGI25164J39214_1001108 | 3300002772 | Bacteria | 7691 |
| 4 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 5 | Ga0006562J51391_1035885 | 3300003578 | Bacteria | 6880 |
| 6 | Ga0006562J51391_1035886 | 3300003578 | Bacteria | 5470 |
| 7 | Ga0055539_1000035 | 3300003752 | Bacteria | 217588 |
| 8 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 9 | Ga0055525_1000279 | 3300003759 | Bacteria | 47019 |
| 10 | Ga0055527_1000012 | 3300003760 | Bacteria | 348744 |
| 11 | Ga0055542_1000017 | 3300003762 | Bacteria | 348744 |
| 12 | Ga0055529_1000023 | 3300003763 | Bacteria | 314383 |
| 13 | Ga0055541_1002026 | 3300003841 | Bacteria | 4147 |
| 14 | Ga0070658_10033663 | 3300005327 | Bacteria | 4123 |
| 15 | Ga0070658_10057680 | 3300005327 | Bacteria | 3159 |
| 16 | Ga0070683_100022128 | 3300005329 | Bacteria | 5679 |
| 17 | Ga0070683_100055152 | 3300005329 | Bacteria | 3687 |
| 18 | Ga0070683_100256979 | 3300005329 | Bacteria | 1661 |
| 19 | Ga0070710_10022791 | 3300005437 | Bacteria | 3282 |
| 20 | Ga0070700_100350740 | 3300005441 | Bacteria | 1094 |
| 21 | Ga0070681_10265553 | 3300005458 | Bacteria | 1628 |
| 22 | Ga0068867_100318751 | 3300005459 | Bacteria | 1287 |
| 23 | Ga0070684_100136076 | 3300005535 | Bacteria | 2219 |
| 24 | Ga0070684_100273667 | 3300005535 | Bacteria | 1546 |
| 25 | Ga0070684_100308992 | 3300005535 | Bacteria | 1452 |
| 26 | Ga0070665_100032742 | 3300005548 | Bacteria | 5230 |
| 27 | Ga0070665_100073607 | 3300005548 | Bacteria | 3422 |
| 28 | Ga0070702_100045564 | 3300005615 | Bacteria | 2482 |
| 29 | Ga0081455_10080702 | 3300005937 | Bacteria | 2666 |
| 30 | Ga0070717_10051702 | 3300006028 | Bacteria | 3383 |
| 31 | Ga0075365_10009699 | 3300006038 | Bacteria | 5557 |
| 32 | Ga0075365_10058357 | 3300006038 | Bacteria | 2569 |
| 33 | Ga0075365_10146010 | 3300006038 | Bacteria | 1644 |
| 34 | Ga0075364_10044452 | 3300006051 | Bacteria | 2889 |
| 35 | Ga0075364_10086493 | 3300006051 | Bacteria | 2077 |
| 36 | Ga0075432_10008023 | 3300006058 | Bacteria | 3601 |
| 37 | Ga0075369_10041857 | 3300006186 | Bacteria | 1962 |
| 38 | Ga0075430_100006843 | 3300006846 | Bacteria | 9610 |
| 39 | Ga0111539_10013580 | 3300009094 | Bacteria | 10182 |
| 40 | Ga0111539_10177393 | 3300009094 | Bacteria | 2489 |
| 41 | Ga0105245_10530252 | 3300009098 | Bacteria | 1197 |
| 42 | Ga0105247_10163112 | 3300009101 | Bacteria | 1477 |
| 43 | Ga0114129_10647962 | 3300009147 | Bacteria | 1364 |
| 44 | Ga0105243_10025837 | 3300009148 | Bacteria | 4491 |
| 45 | Ga0105243_10055194 | 3300009148 | Bacteria | 3156 |
| 46 | Ga0105243_10240234 | 3300009148 | Bacteria | 1612 |
| 47 | Ga0105243_10597717 | 3300009148 | Bacteria | 1062 |
| 48 | Ga0105242_10042072 | 3300009176 | Bacteria | 3687 |
| 49 | Ga0105238_10340247 | 3300009551 | Bacteria | 1488 |
| 50 | Ga0105029_101409 | 3300009984 | Bacteria | 1489 |
| 51 | Ga0105246_10020963 | 3300011119 | Bacteria | 4198 |
| 52 | Ga0105246_10079974 | 3300011119 | Bacteria | 2325 |
| 53 | Ga0105246_10158367 | 3300011119 | Bacteria | 1722 |
| 54 | Ga0157369_10544203 | 3300013105 | Bacteria | 1200 |
| 55 | Ga0157369_10550383 | 3300013105 | Bacteria | 1193 |
| 56 | Ga0157374_10201733 | 3300013296 | Bacteria | 1948 |
| 57 | Ga0157378_10127241 | 3300013297 | Bacteria | 2354 |
| 58 | Ga0163162_10010997 | 3300013306 | Bacteria | 8814 |
| 59 | Ga0163162_10418118 | 3300013306 | Bacteria | 1473 |
| 60 | Ga0157372_10019450 | 3300013307 | Bacteria | 7319 |
| 61 | Ga0157372_10324114 | 3300013307 | Bacteria | 1794 |
| 62 | Ga0157375_10007296 | 3300013308 | Bacteria | 9675 |
| 63 | Ga0157375_10137762 | 3300013308 | Bacteria | 2566 |
| 64 | Ga0163163_10038814 | 3300014325 | Bacteria | 4643 |
| 65 | Ga0157380_10215048 | 3300014326 | Bacteria | 1716 |
| 66 | Ga0157377_10131568 | 3300014745 | Bacteria | 1529 |
| 67 | Ga0197907_10675743 | 3300020069 | Bacteria | 2176 |
| 68 | Ga0206351_10307727 | 3300020077 | Bacteria | 3271 |
| 69 | Ga0224712_10000912 | 3300022467 | Bacteria | 6369 |
| 70 | Ga0209566_100078 | 3300025225 | Bacteria | 158974 |
| 71 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 72 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 73 | Ga0209147_101301 | 3300025229 | Bacteria | 9623 |
| 74 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 75 | Ga0207427_100034 | 3300025231 | Bacteria | 320342 |
| 76 | Ga0209437_100429 | 3300025233 | Bacteria | 36897 |
| 77 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 78 | Ga0209677_100284 | 3300025253 | Bacteria | 33586 |
| 79 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 80 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 81 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 82 | Ga0209455_1003162 | 3300025272 | Bacteria | 5981 |
| 83 | Ga0209758_1006204 | 3300025297 | Bacteria | 8732 |
| 84 | Ga0207692_10029386 | 3300025898 | Bacteria | 2612 |
| 85 | Ga0207642_10107788 | 3300025899 | Bacteria | 1412 |
| 86 | Ga0207710_10123057 | 3300025900 | Bacteria | 1240 |
| 87 | Ga0207647_10034763 | 3300025904 | Bacteria | 3215 |
| 88 | Ga0207652_10365119 | 3300025921 | Bacteria | 1303 |
| 89 | Ga0207687_10024772 | 3300025927 | Bacteria | 4011 |
| 90 | Ga0207686_10058506 | 3300025934 | Bacteria | 2430 |
| 91 | Ga0207709_10210916 | 3300025935 | Bacteria | 1394 |
| 92 | Ga0207709_10318741 | 3300025935 | Bacteria | 1163 |
| 93 | Ga0207670_10447011 | 3300025936 | Bacteria | 1041 |
| 94 | Ga0207689_10071634 | 3300025942 | Bacteria | 2847 |
| 95 | Ga0207661_10073173 | 3300025944 | Bacteria | 2806 |
| 96 | Ga0207661_10433635 | 3300025944 | Bacteria | 1195 |
| 97 | Ga0207658_10084727 | 3300025986 | Bacteria | 2440 |
| 98 | Ga0207677_10488655 | 3300026023 | Bacteria | 1062 |
| 99 | Ga0207639_10345429 | 3300026041 | Bacteria | 1328 |
| 100 | Ga0207639_10354397 | 3300026041 | Bacteria | 1311 |
| 101 | Ga0207678_10315746 | 3300026067 | Bacteria | 1344 |
| 102 | Ga0207708_10079447 | 3300026075 | Bacteria | 2520 |
| 103 | Ga0207675_100121993 | 3300026118 | Bacteria | 2467 |
| 104 | Ga0207683_10197302 | 3300026121 | Bacteria | 1829 |
| 105 | Ga0207428_10078475 | 3300027907 | Bacteria | 2583 |
| 106 | Ga0268266_10380025 | 3300028379 | Bacteria | 1332 |
| 107 | Ga0265337_1001403 | 3300028556 | Bacteria | 11827 |
| 108 | Ga0265326_10001352 | 3300028558 | Bacteria | 8683 |
| 109 | Ga0265319_1003719 | 3300028563 | Bacteria | 7841 |
| 110 | Ga0265334_10007398 | 3300028573 | Bacteria | 4708 |
| 111 | Ga0265323_10001726 | 3300028653 | Bacteria | 10373 |
| 112 | Ga0265322_10012576 | 3300028654 | Bacteria | 2449 |
| 113 | Ga0265338_10003834 | 3300028800 | Bacteria | 20886 |
| 114 | Ga0265324_10007214 | 3300029957 | Bacteria | 4536 |
| 115 | Ga0265332_10001765 | 3300031238 | Bacteria | 11691 |
| 116 | Ga0265320_10011910 | 3300031240 | Bacteria | 5092 |
| 117 | Ga0265325_10004998 | 3300031241 | Bacteria | 8256 |
| 118 | Ga0307513_10001603 | 3300031456 | Bacteria | 32478 |
| 119 | Ga0307514_10057834 | 3300031649 | Bacteria | 2969 |
| 120 | Ga0265314_10008551 | 3300031711 | Bacteria | 8752 |
| 121 | Ga0265342_10005522 | 3300031712 | Bacteria | 9610 |
| 122 | Ga0307405_10034842 | 3300031731 | Bacteria | 3000 |
| 123 | Ga0307405_10084566 | 3300031731 | Bacteria | 2083 |
| 124 | Ga0307405_10257013 | 3300031731 | Bacteria | 1303 |
| 125 | Ga0307410_10104298 | 3300031852 | Bacteria | 2038 |
| 126 | Ga0326468_10000172 | 3300031889 | Bacteria | 6396 |
| 127 | Ga0307406_10145449 | 3300031901 | Bacteria | 1684 |
| 128 | Ga0307407_10103890 | 3300031903 | Bacteria | 1769 |
| 129 | Ga0307409_100019306 | 3300031995 | Bacteria | 4610 |
| 130 | Ga0307409_100045564 | 3300031995 | Bacteria | 3312 |
| 131 | Ga0307416_100001640 | 3300032002 | Bacteria | 12336 |
| 132 | Ga0307416_100044254 | 3300032002 | Bacteria | 3494 |
| 133 | Ga0307416_100223439 | 3300032002 | Bacteria | 1808 |
| 134 | Ga0307414_10046775 | 3300032004 | Bacteria | 2973 |
| 135 | Ga0307411_10168014 | 3300032005 | Bacteria | 1651 |
| 136 | Ga0307415_100001169 | 3300032126 | Bacteria | 12268 |
| 137 | Ga0307415_100029541 | 3300032126 | Bacteria | 3505 |
| 138 | Ga0307415_100033249 | 3300032126 | Bacteria | 3347 |
| 139 | Ga0307415_100042499 | 3300032126 | Bacteria | 3025 |
| 140 | Ga0307415_100133779 | 3300032126 | Bacteria | 1882 |
| 141 | Ga0265778_000424 | 3300036457 | Bacteria | 3299 |
| 142 | Ga0395899_0006333 | 3300037312 | Bacteria | 9162 |
| 143 | Ga0395899_0086641 | 3300037312 | Bacteria | 2274 |
| 144 | Ga0395899_0095450 | 3300037312 | Bacteria | 2151 |
| 145 | Ga0395900_0009418 | 3300037418 | Bacteria | 10014 |
| 146 | Ga0395900_0057469 | 3300037418 | Bacteria | 4005 |
| 147 | Ga0395900_0119253 | 3300037418 | Bacteria | 2708 |
| 148 | Ga0395900_0146878 | 3300037418 | Bacteria | 2411 |
| 149 | Ga0395898_0011190 | 3300037466 | Bacteria | 9341 |
| 150 | Ga0395898_0018387 | 3300037466 | Bacteria | 7126 |
| 151 | Ga0395898_0090246 | 3300037466 | Bacteria | 2949 |
| 152 | Ga0395898_0465749 | 3300037466 | Bacteria | 1203 |
| 153 | Ga0395905_0491274 | 3300037471 | Bacteria | 1127 |
| 154 | Ga0395901_0007510 | 3300038443 | Bacteria | 11011 |
| 155 | Ga0466972_0007503 | 3300044658 | Bacteria | 5477 |
| 156 | Ga0466966_0047045 | 3300044684 | Bacteria | 2752 |
| 157 | Ga0466961_0027141 | 3300044693 | Bacteria | 3681 |
| 158 | Ga0466968_0035372 | 3300044735 | Bacteria | 2090 |
| 159 | Ga0466970_0012829 | 3300044765 | Bacteria | 4289 |
| 160 | Ga0466970_0013091 | 3300044765 | Bacteria | 4250 |
| 161 | Ga0466970_0096779 | 3300044765 | Bacteria | 1605 |
| 162 | Ga0466960_0057018 | 3300044901 | Bacteria | 1903 |
| 163 | Ga0466959_0107552 | 3300045049 | Bacteria | 1993 |
| 164 | Ga0466958_0027982 | 3300045836 | Bacteria | 3339 |
| 165 | Ga0495627_035352 | 3300046453 | Bacteria | 1558 |
| 166 | Ga0495653_0001369 | 3300046463 | Bacteria | 18935 |
| 167 | Ga0495580_0020440 | 3300046472 | Bacteria | 4898 |
| 168 | Ga0495582_0030161 | 3300046473 | Bacteria | 2976 |
| 169 | Ga0495664_0006601 | 3300046477 | Bacteria | 6413 |
| 170 | Ga0495585_0206763 | 3300046492 | Bacteria | 997 |
| 171 | Ga0495594_0022086 | 3300046499 | Bacteria | 3402 |
| 172 | Ga0495594_0106221 | 3300046499 | Bacteria | 1581 |
| 173 | Ga0495607_0048108 | 3300046501 | Bacteria | 2495 |
| 174 | Ga0495583_0098855 | 3300046506 | Bacteria | 1247 |
| 175 | Ga0495620_0065990 | 3300046515 | Bacteria | 1492 |
| 176 | Ga0495630_0360769 | 3300046517 | Bacteria | 1112 |
| 177 | Ga0495665_0000794 | 3300046531 | Bacteria | 16521 |
| 178 | Ga0495586_0001578 | 3300046535 | Bacteria | 12557 |
| 179 | Ga0495645_0002190 | 3300046543 | Bacteria | 13279 |
| 180 | Ga0495633_0097700 | 3300046558 | Bacteria | 1364 |
| 181 | Ga0495667_0141241 | 3300046559 | Bacteria | 1552 |
| 182 | Ga0495611_0019731 | 3300046648 | Bacteria | 2897 |
| 183 | Ga0495611_0044611 | 3300046648 | Bacteria | 1983 |
| 184 | Ga0495625_0069434 | 3300046660 | Bacteria | 2475 |
| 185 | Ga0495625_0095676 | 3300046660 | Bacteria | 2047 |
| 186 | Ga0495588_0178743 | 3300046674 | Bacteria | 1121 |
| 187 | Ga0495657_0062768 | 3300046675 | Bacteria | 2453 |
| 188 | Ga0495670_0002088 | 3300046691 | Bacteria | 9853 |
| 189 | Ga0495670_0064540 | 3300046691 | Bacteria | 1845 |
| 190 | Ga0495600_0214770 | 3300046809 | Bacteria | 1232 |
| 191 | Ga0495581_0026270 | 3300047315 | Bacteria | 3376 |
| 192 | Ga0495636_0021546 | 3300047318 | Bacteria | 2603 |
| 193 | Ga0495636_0029570 | 3300047318 | Bacteria | 2237 |
| 194 | Ga0495674_0294378 | 3300047319 | Bacteria | 1327 |
| 195 | Ga0495680_0019762 | 3300047322 | Bacteria | 5681 |
| 196 | Ga0495675_0003212 | 3300047444 | Bacteria | 9825 |
| 197 | Ga0495685_038452 | 3300047447 | Bacteria | 1639 |
| 198 | Ga0495593_0115026 | 3300047673 | Bacteria | 1372 |
| 199 | Ga0495593_0207015 | 3300047673 | Bacteria | 985 |
| 200 | Ga0496100_0001733 | 3300048903 | Bacteria | 10873 |
| 201 | Ga0496100_0135907 | 3300048903 | Bacteria | 1737 |
| 202 | Ga0496100_0269727 | 3300048903 | Bacteria | 1265 |
| 203 | Ga0496101_0013769 | 3300048904 | Bacteria | 5425 |
| 204 | Ga0496102_0019530 | 3300048905 | Bacteria | 5969 |
| 205 | Ga0496102_0025612 | 3300048905 | Bacteria | 5254 |
| 206 | Ga0496102_0117272 | 3300048905 | Bacteria | 2484 |
| 207 | Ga0496102_0256462 | 3300048905 | Bacteria | 1649 |
| 208 | Ga0496103_0002806 | 3300048906 | Bacteria | 10839 |
| 209 | Ga0496103_0024366 | 3300048906 | Bacteria | 3653 |
| 210 | Ga0496104_0006638 | 3300048907 | Bacteria | 10184 |
| 211 | Ga0496104_0076381 | 3300048907 | Bacteria | 3191 |
| 212 | Ga0496104_0121346 | 3300048907 | Bacteria | 2509 |
| 213 | Ga0496105_0029740 | 3300048908 | Bacteria | 4472 |
| 214 | Ga0496105_0045670 | 3300048908 | Bacteria | 3614 |
| 215 | Ga0496105_0061517 | 3300048908 | Bacteria | 3098 |
| 216 | Ga0496106_0003704 | 3300048909 | Bacteria | 11404 |
| 217 | Ga0496106_0258314 | 3300048909 | Bacteria | 1394 |
| 218 | Ga0496107_0005802 | 3300048910 | Bacteria | 8451 |
| 219 | Ga0496107_0175760 | 3300048910 | Bacteria | 1590 |
| 220 | Ga0496108_0000086 | 3300048911 | Bacteria | 100279 |
| 221 | Ga0496108_0246393 | 3300048911 | Bacteria | 1554 |
| 222 | Ga0496109_0050149 | 3300048912 | Bacteria | 3802 |
| 223 | Ga0496110_0016424 | 3300048913 | Bacteria | 6180 |
| 224 | Ga0496110_0055424 | 3300048913 | Bacteria | 3488 |
| 225 | Ga0496110_0191396 | 3300048913 | Bacteria | 1858 |
| 226 | Ga0496110_0193315 | 3300048913 | Bacteria | 1847 |
| 227 | Ga0496111_0009930 | 3300048914 | Bacteria | 6363 |
| 228 | Ga0496111_0097867 | 3300048914 | Bacteria | 2154 |
| 229 | Ga0496112_0027014 | 3300048915 | Bacteria | 5533 |
| 230 | Ga0496113_0025362 | 3300048916 | Bacteria | 4225 |
| 231 | Ga0496113_0120269 | 3300048916 | Bacteria | 2052 |
| 232 | Ga0496114_0001724 | 3300048917 | Bacteria | 16598 |
| 233 | Ga0496114_0018723 | 3300048917 | Bacteria | 5603 |
| 234 | Ga0496114_0021819 | 3300048917 | Bacteria | 5211 |
| 235 | Ga0496114_0040437 | 3300048917 | Bacteria | 3861 |
| 236 | Ga0496114_0047091 | 3300048917 | Bacteria | 3585 |
| 237 | Ga0496114_0141698 | 3300048917 | Bacteria | 2082 |
| 238 | Ga0496115_0017972 | 3300048918 | Bacteria | 5417 |
| 239 | Ga0496115_0110467 | 3300048918 | Bacteria | 2258 |
| 240 | Ga0496117_0000028 | 3300048920 | Bacteria | 407392 |
| 241 | Ga0496117_0005632 | 3300048920 | Bacteria | 13080 |
| 242 | Ga0496117_0028299 | 3300048920 | Bacteria | 4344 |
| 243 | Ga0496117_0072708 | 3300048920 | Bacteria | 2297 |
| 244 | Ga0496119_0025212 | 3300048922 | Bacteria | 4158 |
| 245 | Ga0496122_0022672 | 3300048925 | Bacteria | 5573 |
| 246 | Ga0496123_0030739 | 3300048926 | Bacteria | 3924 |
| 247 | Ga0496124_0072731 | 3300048927 | Bacteria | 2846 |
| 248 | Ga0496124_0100792 | 3300048927 | Bacteria | 2340 |
| 249 | Ga0496125_0024707 | 3300048928 | Bacteria | 5518 |
| 250 | Ga0496126_0370784 | 3300048929 | Bacteria | 1167 |
| 251 | Ga0501031_0063566 | 3300049568 | Bacteria | 2404 |
| 252 | Ga0501032_0142916 | 3300049569 | Bacteria | 1576 |
| 253 | Ga0501033_0273937 | 3300049570 | Bacteria | 1192 |
| 254 | Ga0501034_0007853 | 3300049571 | Bacteria | 11342 |
| 255 | Ga0501034_0068830 | 3300049571 | Bacteria | 3550 |
| 256 | Ga0501034_0114367 | 3300049571 | Bacteria | 2687 |
| 257 | Ga0501036_0004959 | 3300049572 | Bacteria | 10758 |
| 258 | Ga0501038_0011479 | 3300049574 | Bacteria | 8081 |
| 259 | Ga0501038_0064956 | 3300049574 | Bacteria | 3111 |
| 260 | Ga0501039_0002465 | 3300049575 | Bacteria | 13773 |
| 261 | Ga0501043_0002030 | 3300049579 | Bacteria | 17283 |
| 262 | Ga0501047_0018671 | 3300049581 | Bacteria | 6649 |
| 263 | Ga0501067_0130670 | 3300049583 | Bacteria | 1398 |
| 264 | Ga0501070_0011563 | 3300049586 | Bacteria | 7451 |
| 265 | Ga0501074_0036844 | 3300049590 | Bacteria | 3543 |
| 266 | Ga0501035_0278984 | 3300049822 | Bacteria | 1413 |
| 267 | Ga0501044_0030858 | 3300049823 | Bacteria | 5644 |
| 268 | nmdc:mga00v17_162274_c1 | 3300050491 | Bacteria | 1439 |
| 269 | nmdc:mga00v17_97781_c1 | 3300050491 | Bacteria | 1850 |
| 270 | nmdc:mga0yw44_145334_c1 | 3300050492 | Bacteria | 1544 |
| 271 | nmdc:mga0yw44_179632_c1 | 3300050492 | Bacteria | 1393 |
| 272 | nmdc:mga0yw44_51059_c1 | 3300050492 | Bacteria | 2503 |
| 273 | nmdc:mga08y16_261695_c1 | 3300050511 | Bacteria | 1786 |
| 274 | nmdc:mga08y16_9746_c1 | 3300050511 | Bacteria | 10089 |
| 275 | nmdc:mga0sz30_111833_c1 | 3300050516 | Bacteria | 1197 |
| 276 | nmdc:mga0sz30_15999_c1 | 3300050516 | Bacteria | 2970 |
| 277 | Ga0500635_0000023 | 3300053080 | Bacteria | 108024 |
| 278 | Ga0495619_0367034 | 3300053085 | Bacteria | 995 |
| 279 | Ga0500573_0000005 | 3300053140 | Bacteria | 315762 |
| 280 | Ga0500573_0036999 | 3300053140 | Bacteria | 2819 |
| 281 | Ga0500577_0002977 | 3300053142 | Bacteria | 4366 |
| 282 | Ga0500577_0012925 | 3300053142 | Bacteria | 2537 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026067 | Ga0207678_10315746 | Ga0207678_103157462 | 246 |
| 2 | 3300048920 | Ga0496117_0005632 | Ga0496117_0005632_7435_8451 | 252 |
| 3 | 3300028556 | Ga0265337_1001403 | Ga0265337_10014034 | 256 |
| 4 | 3300028558 | Ga0265326_10001352 | Ga0265326_100013523 | 256 |
| 5 | 3300028563 | Ga0265319_1003719 | Ga0265319_10037196 | 256 |
| 6 | 3300028573 | Ga0265334_10007398 | Ga0265334_100073983 | 256 |
| 7 | 3300028653 | Ga0265323_10001726 | Ga0265323_100017264 | 256 |
| 8 | 3300028654 | Ga0265322_10012576 | Ga0265322_100125763 | 256 |
| 9 | 3300028800 | Ga0265338_10003834 | Ga0265338_100038349 | 256 |
| 10 | 3300029957 | Ga0265324_10007214 | Ga0265324_100072142 | 256 |
| 11 | 3300031238 | Ga0265332_10001765 | Ga0265332_100017653 | 256 |
| 12 | 3300031240 | Ga0265320_10011910 | Ga0265320_100119103 | 256 |
| 13 | 3300031241 | Ga0265325_10004998 | Ga0265325_100049981 | 256 |
| 14 | 3300031711 | Ga0265314_10008551 | Ga0265314_100085516 | 256 |
| 15 | 3300031712 | Ga0265342_10005522 | Ga0265342_100055223 | 256 |
| 16 | 3300046492 | Ga0495585_0206763 | Ga0495585_0206763_10_909 | 264 |
| 17 | 3300046648 | Ga0495611_0019731 | Ga0495611_0019731_275_1174 | 264 |
| 18 | 3300049570 | Ga0501033_0273937 | Ga0501033_0273937_20_955 | 264 |
| 19 | 3300049571 | Ga0501034_0007853 | Ga0501034_0007853_7442_8377 | 264 |
| 20 | 3300049572 | Ga0501036_0004959 | Ga0501036_0004959_3553_4488 | 264 |
| 21 | 3300049574 | Ga0501038_0064956 | Ga0501038_0064956_1542_2477 | 264 |
| 22 | 3300049575 | Ga0501039_0002465 | Ga0501039_0002465_3098_4033 | 264 |
| 23 | 3300049579 | Ga0501043_0002030 | Ga0501043_0002030_9738_10673 | 264 |
| 24 | 3300049581 | Ga0501047_0018671 | Ga0501047_0018671_2146_3081 | 264 |
| 25 | 3300049586 | Ga0501070_0011563 | Ga0501070_0011563_504_1439 | 264 |
| 26 | 3300049590 | Ga0501074_0036844 | Ga0501074_0036844_245_1180 | 264 |
| 27 | 3300031649 | Ga0307514_10057834 | Ga0307514_100578342 | 266 |
| 28 | 3300048917 | Ga0496114_0047091 | Ga0496114_0047091_427_1383 | 266 |
| 29 | 3300036457 | Ga0265778_000424 | Ga0265778_000424_225_1193 | 267 |
| 30 | 3300009984 | Ga0105029_101409 | Ga0105029_1014092 | 268 |
| 31 | 3300003578 | Ga0006562J51391_1035885 | Ga0006562J51391_10358853 | 270 |
| 32 | 3300003578 | Ga0006562J51391_1035886 | Ga0006562J51391_10358863 | 270 |
| 33 | 3300006028 | Ga0070717_10051702 | Ga0070717_100517023 | 270 |
| 34 | 3300048916 | Ga0496113_0120269 | Ga0496113_0120269_47_895 | 270 |
| 35 | 3300048917 | Ga0496114_0040437 | Ga0496114_0040437_2215_3153 | 271 |
| 36 | 3300048928 | Ga0496125_0024707 | Ga0496125_0024707_4014_4988 | 273 |
| 37 | 3300009094 | Ga0111539_10013580 | Ga0111539_100135803 | 275 |
| 38 | 3300027907 | Ga0207428_10078475 | Ga0207428_100784753 | 275 |
| 39 | 3300050511 | nmdc:mga08y16_9746_c1 | nmdc:mga08y16_9746_c1_7863_8813 | 275 |
| 40 | 3300009147 | Ga0114129_10647962 | Ga0114129_106479622 | 276 |
| 41 | 3300009551 | Ga0105238_10340247 | Ga0105238_103402472 | 276 |
| 42 | 3300037418 | Ga0395900_0146878 | Ga0395900_0146878_1146_2012 | 277 |
| 43 | 3300037466 | Ga0395898_0090246 | Ga0395898_0090246_1277_2143 | 277 |
| 44 | 3300038443 | Ga0395901_0007510 | Ga0395901_0007510_727_1593 | 277 |
| 45 | 3300005327 | Ga0070658_10033663 | Ga0070658_100336634 | 278 |
| 46 | 3300047673 | Ga0495593_0115026 | Ga0495593_0115026_347_1243 | 278 |
| 47 | 3300049571 | Ga0501034_0114367 | Ga0501034_0114367_74_1075 | 278 |
| 48 | 3300005329 | Ga0070683_100022128 | Ga0070683_1000221285 | 279 |
| 49 | 3300005459 | Ga0068867_100318751 | Ga0068867_1003187511 | 279 |
| 50 | 3300005535 | Ga0070684_100273667 | Ga0070684_1002736672 | 279 |
| 51 | 3300005548 | Ga0070665_100073607 | Ga0070665_1000736072 | 279 |
| 52 | 3300009101 | Ga0105247_10163112 | Ga0105247_101631122 | 279 |
| 53 | 3300009148 | Ga0105243_10025837 | Ga0105243_100258372 | 279 |
| 54 | 3300011119 | Ga0105246_10158367 | Ga0105246_101583672 | 279 |
| 55 | 3300013306 | Ga0163162_10418118 | Ga0163162_104181182 | 279 |
| 56 | 3300013308 | Ga0157375_10137762 | Ga0157375_101377622 | 279 |
| 57 | 3300014325 | Ga0163163_10038814 | Ga0163163_100388142 | 279 |
| 58 | 3300014745 | Ga0157377_10131568 | Ga0157377_101315682 | 279 |
| 59 | 3300025900 | Ga0207710_10123057 | Ga0207710_101230572 | 279 |
| 60 | 3300025927 | Ga0207687_10024772 | Ga0207687_100247722 | 279 |
| 61 | 3300025944 | Ga0207661_10073173 | Ga0207661_100731732 | 279 |
| 62 | 3300028379 | Ga0268266_10380025 | Ga0268266_103800252 | 279 |
| 63 | 3300047673 | Ga0495593_0207015 | Ga0495593_0207015_130_975 | 280 |
| 64 | 3300048911 | Ga0496108_0000086 | Ga0496108_0000086_61732_62574 | 280 |
| 65 | 3300049571 | Ga0501034_0068830 | Ga0501034_0068830_1445_2287 | 280 |
| 66 | 3300053085 | Ga0495619_0367034 | Ga0495619_0367034_130_972 | 280 |
| 67 | 3300005441 | Ga0070700_100350740 | Ga0070700_1003507401 | 281 |
| 68 | 3300026041 | Ga0207639_10345429 | Ga0207639_103454292 | 281 |
| 69 | 3300009148 | Ga0105243_10597717 | Ga0105243_105977171 | 283 |
| 70 | 3300013306 | Ga0163162_10010997 | Ga0163162_100109972 | 283 |
| 71 | 3300013308 | Ga0157375_10007296 | Ga0157375_100072964 | 283 |
| 72 | 3300046674 | Ga0495588_0178743 | Ga0495588_0178743_130_984 | 283 |
| 73 | 3300048903 | Ga0496100_0001733 | Ga0496100_0001733_9940_10794 | 283 |
| 74 | 3300048904 | Ga0496101_0013769 | Ga0496101_0013769_2220_3074 | 283 |
| 75 | 3300048905 | Ga0496102_0019530 | Ga0496102_0019530_1451_2305 | 283 |
| 76 | 3300048906 | Ga0496103_0002806 | Ga0496103_0002806_8483_9337 | 283 |
| 77 | 3300048909 | Ga0496106_0003704 | Ga0496106_0003704_2307_3161 | 283 |
| 78 | 3300048910 | Ga0496107_0005802 | Ga0496107_0005802_5335_6189 | 283 |
| 79 | 3300048912 | Ga0496109_0050149 | Ga0496109_0050149_1240_2094 | 283 |
| 80 | 3300048913 | Ga0496110_0016424 | Ga0496110_0016424_2212_3066 | 283 |
| 81 | 3300048914 | Ga0496111_0009930 | Ga0496111_0009930_2291_3145 | 283 |
| 82 | 3300031731 | Ga0307405_10257013 | Ga0307405_102570132 | 284 |
| 83 | 3300032126 | Ga0307415_100133779 | Ga0307415_1001337792 | 284 |
| 84 | 3300032126 | Ga0307415_100033249 | Ga0307415_1000332492 | 285 |
| 85 | 3300032002 | Ga0307416_100044254 | Ga0307416_1000442542 | 286 |
| 86 | 3300009098 | Ga0105245_10530252 | Ga0105245_105302522 | 287 |
| 87 | 3300032002 | Ga0307416_100223439 | Ga0307416_1002234392 | 287 |
| 88 | 3300048913 | Ga0496110_0193315 | Ga0496110_0193315_624_1487 | 287 |
| 89 | iso_pu_bacteria | 2795385470 | 2795782387 | 287 |
| 90 | iso_pu_bacteria | 2855683550 | 2855685447 | 287 |
| 91 | 3300009176 | Ga0105242_10042072 | Ga0105242_100420722 | 288 |
| 92 | 3300025934 | Ga0207686_10058506 | Ga0207686_100585062 | 288 |
| 93 | iso_pu_bacteria | 2816332119 | 2816423906 | 288 |
| 94 | 3300002772 | JGI25164J39214_1001108 | JGI25164J39214_10011083 | 289 |
| 95 | 3300003214 | JGI25165J46597_1000002 | JGI25165J46597_1000002276 | 289 |
| 96 | 3300025231 | Ga0207427_100034 | Ga0207427_100034204 | 289 |
| 97 | 3300025233 | Ga0209437_100429 | Ga0209437_10042933 | 289 |
| 98 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000012529 | 289 |
| 99 | 3300046809 | Ga0495600_0214770 | Ga0495600_0214770_173_1135 | 289 |
| 100 | 3300048907 | Ga0496104_0006638 | Ga0496104_0006638_6477_7439 | 289 |
| 101 | 3300048908 | Ga0496105_0061517 | Ga0496105_0061517_902_1864 | 289 |
| 102 | iso_pu_bacteria | 2862290372 | 2862292681 | 289 |
| 103 | 3300048922 | Ga0496119_0025212 | Ga0496119_0025212_233_1207 | 290 |
| 104 | 3300048925 | Ga0496122_0022672 | Ga0496122_0022672_1898_2872 | 290 |
| 105 | 3300048926 | Ga0496123_0030739 | Ga0496123_0030739_2319_3293 | 290 |
| 106 | 3300048927 | Ga0496124_0100792 | Ga0496124_0100792_1332_2306 | 290 |
| 107 | 3300049569 | Ga0501032_0142916 | Ga0501032_0142916_371_1243 | 290 |
| 108 | 3300049574 | Ga0501038_0011479 | Ga0501038_0011479_354_1226 | 290 |
| 109 | 3300049823 | Ga0501044_0030858 | Ga0501044_0030858_3096_3968 | 290 |
| 110 | iso_pu_bacteria | 2912757875 | 2912764844 | 291 |
| 111 | 3300031889 | Ga0326468_10000172 | Ga0326468_100001726 | 292 |
| 112 | 3300048903 | Ga0496100_0135907 | Ga0496100_0135907_597_1586 | 292 |
| 113 | 3300050492 | nmdc:mga0yw44_179632_c1 | nmdc:mga0yw44_179632_c1_136_1014 | 292 |
| 114 | 3300031731 | Ga0307405_10084566 | Ga0307405_100845662 | 293 |
| 115 | 3300031852 | Ga0307410_10104298 | Ga0307410_101042982 | 293 |
| 116 | 3300031903 | Ga0307407_10103890 | Ga0307407_101038902 | 293 |
| 117 | 3300031995 | Ga0307409_100019306 | Ga0307409_1000193063 | 293 |
| 118 | 3300032002 | Ga0307416_100001640 | Ga0307416_1000016408 | 293 |
| 119 | 3300032004 | Ga0307414_10046775 | Ga0307414_100467752 | 293 |
| 120 | 3300032005 | Ga0307411_10168014 | Ga0307411_101680142 | 293 |
| 121 | 3300032126 | Ga0307415_100001169 | Ga0307415_1000011695 | 293 |
| 122 | 3300032126 | Ga0307415_100042499 | Ga0307415_1000424992 | 293 |
| 123 | 3300013307 | Ga0157372_10324114 | Ga0157372_103241142 | 294 |
| 124 | 3300025904 | Ga0207647_10034763 | Ga0207647_100347632 | 294 |
| 125 | 3300025942 | Ga0207689_10071634 | Ga0207689_100716344 | 294 |
| 126 | 3300048907 | Ga0496104_0121346 | Ga0496104_0121346_1242_2195 | 294 |
| 127 | 3300048910 | Ga0496107_0175760 | Ga0496107_0175760_137_1090 | 294 |
| 128 | 3300048917 | Ga0496114_0018723 | Ga0496114_0018723_4488_5441 | 294 |
| 129 | 3300048918 | Ga0496115_0110467 | Ga0496115_0110467_187_1140 | 294 |
| 130 | iso_pu_bacteria | 2862574272 | 2862581670 | 294 |
| 131 | 3300003760 | Ga0055527_1000012 | Ga0055527_1000012155 | 295 |
| 132 | 3300003762 | Ga0055542_1000017 | Ga0055542_1000017155 | 295 |
| 133 | 3300003763 | Ga0055529_1000023 | Ga0055529_1000023122 | 295 |
| 134 | 3300006846 | Ga0075430_100006843 | Ga0075430_1000068439 | 295 |
| 135 | 3300025228 | Ga0209672_100003 | Ga0209672_100003191 | 295 |
| 136 | 3300025229 | Ga0209147_101301 | Ga0209147_1013014 | 295 |
| 137 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004486 | 295 |
| 138 | 3300025272 | Ga0209455_1000022 | Ga0209455_1000022498 | 295 |
| 139 | 3300031901 | Ga0307406_10145449 | Ga0307406_101454492 | 295 |
| 140 | 3300037466 | Ga0395898_0465749 | Ga0395898_0465749_133_1020 | 295 |
| 141 | 3300046558 | Ga0495633_0097700 | Ga0495633_0097700_264_1160 | 295 |
| 142 | 3300046691 | Ga0495670_0002088 | Ga0495670_0002088_3898_4794 | 295 |
| 143 | 3300047318 | Ga0495636_0021546 | Ga0495636_0021546_1015_1911 | 295 |
| 144 | 3300048908 | Ga0496105_0029740 | Ga0496105_0029740_3327_4280 | 295 |
| 145 | 3300048920 | Ga0496117_0000028 | Ga0496117_0000028_8438_9412 | 295 |
| 146 | 3300048920 | Ga0496117_0072708 | Ga0496117_0072708_120_1076 | 295 |
| 147 | 3300048927 | Ga0496124_0072731 | Ga0496124_0072731_137_1111 | 295 |
| 148 | 3300049822 | Ga0501035_0278984 | Ga0501035_0278984_69_1070 | 295 |
| 149 | 3300053142 | Ga0500577_0002977 | Ga0500577_0002977_2070_2987 | 295 |
| 150 | 3300053142 | Ga0500577_0012925 | Ga0500577_0012925_800_1717 | 295 |
| 151 | iso_pu_bacteria | 2919443155 | 2919444888 | 295 |
| 152 | 3300013296 | Ga0157374_10201733 | Ga0157374_102017331 | 296 |
| 153 | 3300013297 | Ga0157378_10127241 | Ga0157378_101272412 | 296 |
| 154 | 3300025297 | Ga0209758_1006204 | Ga0209758_10062043 | 296 |
| 155 | 3300037471 | Ga0395905_0491274 | Ga0395905_0491274_160_1101 | 296 |
| 156 | 3300046472 | Ga0495580_0020440 | Ga0495580_0020440_721_1629 | 296 |
| 157 | 3300048903 | Ga0496100_0269727 | Ga0496100_0269727_207_1115 | 296 |
| 158 | 3300048905 | Ga0496102_0025612 | Ga0496102_0025612_1771_2679 | 296 |
| 159 | 3300048906 | Ga0496103_0024366 | Ga0496103_0024366_817_1725 | 296 |
| 160 | 3300053140 | Ga0500573_0000005 | Ga0500573_0000005_198773_199708 | 296 |
| 161 | 3300053140 | Ga0500573_0036999 | Ga0500573_0036999_68_997 | 296 |
| 162 | iso_pu_bacteria | 2643221572 | 2643876979 | 296 |
| 163 | iso_pu_bacteria | 2643221669 | 2644384034 | 296 |
| 164 | iso_pu_bacteria | 2811994882 | 2812374786 | 296 |
| 165 | iso_pu_bacteria | 2895660088 | 2895662241 | 296 |
| 166 | 3300046499 | Ga0495594_0106221 | Ga0495594_0106221_85_1029 | 297 |
| 167 | 3300046515 | Ga0495620_0065990 | Ga0495620_0065990_320_1264 | 297 |
| 168 | 3300046660 | Ga0495625_0095676 | Ga0495625_0095676_577_1521 | 297 |
| 169 | 3300046691 | Ga0495670_0064540 | Ga0495670_0064540_83_1027 | 297 |
| 170 | 3300047318 | Ga0495636_0029570 | Ga0495636_0029570_1103_2047 | 297 |
| 171 | 3300047447 | Ga0495685_038452 | Ga0495685_038452_529_1473 | 297 |
| 172 | iso_pu_bacteria | 2990088156 | 2990088796 | 297 |
| 173 | 3300006038 | Ga0075365_10009699 | Ga0075365_100096994 | 298 |
| 174 | 3300006051 | Ga0075364_10044452 | Ga0075364_100444522 | 298 |
| 175 | 3300006186 | Ga0075369_10041857 | Ga0075369_100418572 | 298 |
| 176 | 3300049583 | Ga0501067_0130670 | Ga0501067_0130670_162_1118 | 298 |
| 177 | 3300050491 | nmdc:mga00v17_162274_c1 | nmdc:mga00v17_162274_c1_17_973 | 298 |
| 178 | iso_pu_bacteria | 2811994872 | 2812322236 | 298 |
| 179 | iso_pu_bacteria | 2919523602 | 2919524035 | 298 |
| 180 | iso_pu_bacteria | 2939598168 | 2939602176 | 298 |
| 181 | iso_pu_bacteria | 8004025490 | 8004027150 | 298 |
| 182 | iso_pu_bacteria | 8016254467 | 8016254878 | 298 |
| 183 | 3300031731 | Ga0307405_10034842 | Ga0307405_100348422 | 299 |
| 184 | 3300031995 | Ga0307409_100045564 | Ga0307409_1000455642 | 299 |
| 185 | 3300049568 | Ga0501031_0063566 | Ga0501031_0063566_1210_2148 | 299 |
| 186 | iso_pu_bacteria | 2833709550 | 2833710089 | 299 |
| 187 | iso_pu_bacteria | 2954711539 | 2954719741 | 299 |
| 188 | iso_pu_bacteria | 2954721474 | 2954729776 | 299 |
| 189 | iso_pu_bacteria | 2954731030 | 2954732005 | 299 |
| 190 | iso_pu_bacteria | 2954740390 | 2954748681 | 299 |
| 191 | iso_pu_bacteria | 2954749733 | 2954750972 | 299 |
| 192 | iso_pu_bacteria | 2954759201 | 2954767797 | 299 |
| 193 | 3300005437 | Ga0070710_10022791 | Ga0070710_100227912 | 300 |
| 194 | 3300006051 | Ga0075364_10086493 | Ga0075364_100864932 | 300 |
| 195 | 3300025898 | Ga0207692_10029386 | Ga0207692_100293863 | 300 |
| 196 | 3300032126 | Ga0307415_100029541 | Ga0307415_1000295411 | 300 |
| 197 | 3300048907 | Ga0496104_0076381 | Ga0496104_0076381_1558_2598 | 300 |
| 198 | 3300048908 | Ga0496105_0045670 | Ga0496105_0045670_301_1341 | 300 |
| 199 | 3300048917 | Ga0496114_0001724 | Ga0496114_0001724_9175_10215 | 300 |
| 200 | 3300048917 | Ga0496114_0141698 | Ga0496114_0141698_719_1759 | 300 |
| 201 | 3300050491 | nmdc:mga00v17_97781_c1 | nmdc:mga00v17_97781_c1_27_968 | 300 |
| 202 | iso_pu_bacteria | 2919051321 | 2919052062 | 300 |
| 203 | 3300003752 | Ga0055539_1000035 | Ga0055539_1000035198 | 301 |
| 204 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001324 | 301 |
| 205 | 3300003759 | Ga0055525_1000279 | Ga0055525_100027920 | 301 |
| 206 | 3300003841 | Ga0055541_1002026 | Ga0055541_10020264 | 301 |
| 207 | 3300005329 | Ga0070683_100055152 | Ga0070683_1000551523 | 301 |
| 208 | 3300005329 | Ga0070683_100256979 | Ga0070683_1002569792 | 301 |
| 209 | 3300005458 | Ga0070681_10265553 | Ga0070681_102655532 | 301 |
| 210 | 3300005535 | Ga0070684_100136076 | Ga0070684_1001360762 | 301 |
| 211 | 3300005535 | Ga0070684_100308992 | Ga0070684_1003089922 | 301 |
| 212 | 3300013105 | Ga0157369_10550383 | Ga0157369_105503832 | 301 |
| 213 | 3300025225 | Ga0209566_100078 | Ga0209566_10007848 | 301 |
| 214 | 3300025226 | Ga0209674_100001 | Ga0209674_100001325 | 301 |
| 215 | 3300025230 | Ga0209563_100001 | Ga0209563_100001325 | 301 |
| 216 | 3300025253 | Ga0209677_100001 | Ga0209677_100001325 | 301 |
| 217 | 3300025272 | Ga0209455_1003162 | Ga0209455_10031624 | 301 |
| 218 | 3300025921 | Ga0207652_10365119 | Ga0207652_103651191 | 301 |
| 219 | 3300025935 | Ga0207709_10318741 | Ga0207709_103187412 | 301 |
| 220 | 3300025944 | Ga0207661_10433635 | Ga0207661_104336351 | 301 |
| 221 | 3300026023 | Ga0207677_10488655 | Ga0207677_104886552 | 301 |
| 222 | 3300026041 | Ga0207639_10354397 | Ga0207639_103543972 | 301 |
| 223 | 3300026121 | Ga0207683_10197302 | Ga0207683_101973022 | 301 |
| 224 | 3300037312 | Ga0395899_0095450 | Ga0395899_0095450_954_1910 | 301 |
| 225 | 3300037418 | Ga0395900_0009418 | Ga0395900_0009418_4270_5226 | 301 |
| 226 | 3300037466 | Ga0395898_0011190 | Ga0395898_0011190_2460_3416 | 301 |
| 227 | 3300044658 | Ga0466972_0007503 | Ga0466972_0007503_3719_4675 | 301 |
| 228 | 3300044684 | Ga0466966_0047045 | Ga0466966_0047045_1695_2651 | 301 |
| 229 | 3300044693 | Ga0466961_0027141 | Ga0466961_0027141_2064_3020 | 301 |
| 230 | 3300044735 | Ga0466968_0035372 | Ga0466968_0035372_894_1850 | 301 |
| 231 | 3300044765 | Ga0466970_0012829 | Ga0466970_0012829_1696_2652 | 301 |
| 232 | 3300044765 | Ga0466970_0013091 | Ga0466970_0013091_2834_3790 | 301 |
| 233 | 3300044765 | Ga0466970_0096779 | Ga0466970_0096779_263_1219 | 301 |
| 234 | 3300044901 | Ga0466960_0057018 | Ga0466960_0057018_718_1674 | 301 |
| 235 | 3300045049 | Ga0466959_0107552 | Ga0466959_0107552_460_1416 | 301 |
| 236 | 3300045836 | Ga0466958_0027982 | Ga0466958_0027982_288_1244 | 301 |
| 237 | 3300048909 | Ga0496106_0258314 | Ga0496106_0258314_437_1381 | 301 |
| 238 | 3300048911 | Ga0496108_0246393 | Ga0496108_0246393_223_1167 | 301 |
| 239 | 3300048913 | Ga0496110_0055424 | Ga0496110_0055424_1817_2761 | 301 |
| 240 | 3300048914 | Ga0496111_0097867 | Ga0496111_0097867_1017_1961 | 301 |
| 241 | 3300048915 | Ga0496112_0027014 | Ga0496112_0027014_984_1928 | 301 |
| 242 | 3300048916 | Ga0496113_0025362 | Ga0496113_0025362_2532_3476 | 301 |
| 243 | 3300050492 | nmdc:mga0yw44_145334_c1 | nmdc:mga0yw44_145334_c1_11_985 | 301 |
| 244 | 3300050516 | nmdc:mga0sz30_15999_c1 | nmdc:mga0sz30_15999_c1_224_1198 | 301 |
| 245 | iso_pu_bacteria | 2643221616 | 2644095610 | 301 |
| 246 | iso_pu_bacteria | 2844841374 | 2844841994 | 301 |
| 247 | iso_pu_bacteria | 2884763398 | 2884764990 | 301 |
| 248 | iso_pu_bacteria | 2919055335 | 2919057628 | 301 |
| 249 | iso_pu_bacteria | 2928153084 | 2928155804 | 301 |
| 250 | 3300005937 | Ga0081455_10080702 | Ga0081455_100807022 | 302 |
| 251 | 3300006038 | Ga0075365_10058357 | Ga0075365_100583573 | 302 |
| 252 | 3300006038 | Ga0075365_10146010 | Ga0075365_101460102 | 302 |
| 253 | 3300006058 | Ga0075432_10008023 | Ga0075432_100080233 | 302 |
| 254 | 3300011119 | Ga0105246_10020963 | Ga0105246_100209633 | 302 |
| 255 | 3300013105 | Ga0157369_10544203 | Ga0157369_105442032 | 302 |
| 256 | 3300046463 | Ga0495653_0001369 | Ga0495653_0001369_17870_18835 | 302 |
| 257 | 3300046473 | Ga0495582_0030161 | Ga0495582_0030161_1671_2636 | 302 |
| 258 | 3300046477 | Ga0495664_0006601 | Ga0495664_0006601_739_1704 | 302 |
| 259 | 3300046499 | Ga0495594_0022086 | Ga0495594_0022086_2200_3165 | 302 |
| 260 | 3300046501 | Ga0495607_0048108 | Ga0495607_0048108_1163_2125 | 302 |
| 261 | 3300046506 | Ga0495583_0098855 | Ga0495583_0098855_161_1123 | 302 |
| 262 | 3300046517 | Ga0495630_0360769 | Ga0495630_0360769_10_975 | 302 |
| 263 | 3300046531 | Ga0495665_0000794 | Ga0495665_0000794_8717_9682 | 302 |
| 264 | 3300046535 | Ga0495586_0001578 | Ga0495586_0001578_8645_9610 | 302 |
| 265 | 3300046543 | Ga0495645_0002190 | Ga0495645_0002190_4911_5876 | 302 |
| 266 | 3300046559 | Ga0495667_0141241 | Ga0495667_0141241_125_1057 | 302 |
| 267 | 3300046648 | Ga0495611_0044611 | Ga0495611_0044611_606_1568 | 302 |
| 268 | 3300046660 | Ga0495625_0069434 | Ga0495625_0069434_1335_2297 | 302 |
| 269 | 3300046675 | Ga0495657_0062768 | Ga0495657_0062768_1386_2351 | 302 |
| 270 | 3300047315 | Ga0495581_0026270 | Ga0495581_0026270_1720_2685 | 302 |
| 271 | 3300047319 | Ga0495674_0294378 | Ga0495674_0294378_49_981 | 302 |
| 272 | 3300047322 | Ga0495680_0019762 | Ga0495680_0019762_226_1191 | 302 |
| 273 | 3300047444 | Ga0495675_0003212 | Ga0495675_0003212_8667_9632 | 302 |
| 274 | 3300048905 | Ga0496102_0117272 | Ga0496102_0117272_1064_2029 | 302 |
| 275 | 3300048905 | Ga0496102_0256462 | Ga0496102_0256462_651_1583 | 302 |
| 276 | 3300048913 | Ga0496110_0191396 | Ga0496110_0191396_87_1019 | 302 |
| 277 | 3300050492 | nmdc:mga0yw44_51059_c1 | nmdc:mga0yw44_51059_c1_708_1628 | 302 |
| 278 | 3300005548 | Ga0070665_100032742 | Ga0070665_1000327425 | 303 |
| 279 | 3300005615 | Ga0070702_100045564 | Ga0070702_1000455642 | 303 |
| 280 | 3300009094 | Ga0111539_10177393 | Ga0111539_101773932 | 303 |
| 281 | 3300009148 | Ga0105243_10055194 | Ga0105243_100551943 | 303 |
| 282 | 3300014326 | Ga0157380_10215048 | Ga0157380_102150482 | 303 |
| 283 | 3300025899 | Ga0207642_10107788 | Ga0207642_101077882 | 303 |
| 284 | 3300025936 | Ga0207670_10447011 | Ga0207670_104470111 | 303 |
| 285 | 3300026075 | Ga0207708_10079447 | Ga0207708_100794473 | 303 |
| 286 | 3300026118 | Ga0207675_100121993 | Ga0207675_1001219933 | 303 |
| 287 | 3300031456 | Ga0307513_10001603 | Ga0307513_1000160316 | 303 |
| 288 | 3300050511 | nmdc:mga08y16_261695_c1 | nmdc:mga08y16_261695_c1_616_1554 | 303 |
| 289 | 3300053080 | Ga0500635_0000023 | Ga0500635_0000023_103507_104496 | 303 |
| 290 | iso_pu_bacteria | 8048127548 | 8048133408 | 303 |
| 291 | 3300005327 | Ga0070658_10057680 | Ga0070658_100576802 | 304 |
| 292 | 3300020069 | Ga0197907_10675743 | Ga0197907_106757432 | 304 |
| 293 | 3300020077 | Ga0206351_10307727 | Ga0206351_103077272 | 304 |
| 294 | 3300022467 | Ga0224712_10000912 | Ga0224712_100009124 | 304 |
| 295 | 3300025253 | Ga0209677_100284 | Ga0209677_10028417 | 304 |
| 296 | 3300037312 | Ga0395899_0006333 | Ga0395899_0006333_5023_5994 | 304 |
| 297 | 3300037312 | Ga0395899_0086641 | Ga0395899_0086641_1223_2200 | 304 |
| 298 | 3300037418 | Ga0395900_0057469 | Ga0395900_0057469_2498_3469 | 304 |
| 299 | 3300037418 | Ga0395900_0119253 | Ga0395900_0119253_1199_2176 | 304 |
| 300 | 3300037466 | Ga0395898_0018387 | Ga0395898_0018387_3607_4578 | 304 |
| 301 | 3300048917 | Ga0496114_0021819 | Ga0496114_0021819_3037_4017 | 304 |
| 302 | 3300048918 | Ga0496115_0017972 | Ga0496115_0017972_1930_2910 | 304 |
| 303 | 3300048920 | Ga0496117_0028299 | Ga0496117_0028299_986_1963 | 304 |
| 304 | 3300048929 | Ga0496126_0370784 | Ga0496126_0370784_116_1096 | 304 |
| 305 | 3300050516 | nmdc:mga0sz30_111833_c1 | nmdc:mga0sz30_111833_c1_123_1100 | 304 |
| 306 | iso_pu_bacteria | 2515154155 | 2515850995 | 304 |
| 307 | 3300046453 | Ga0495627_035352 | Ga0495627_035352_565_1491 | 306 |
| 308 | 3300001989 | JGI24739J22299_10010469 | JGI24739J22299_100104692 | 314 |
| 309 | 3300001990 | JGI24737J22298_10015839 | JGI24737J22298_100158392 | 314 |
| 310 | 3300009148 | Ga0105243_10240234 | Ga0105243_102402342 | 314 |
| 311 | 3300011119 | Ga0105246_10079974 | Ga0105246_100799742 | 314 |
| 312 | 3300013307 | Ga0157372_10019450 | Ga0157372_100194507 | 314 |
| 313 | 3300025935 | Ga0207709_10210916 | Ga0207709_102109162 | 314 |
| 314 | 3300025986 | Ga0207658_10084727 | Ga0207658_100847272 | 314 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
146
333
0.87
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8527 | 30 | 310 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8518 | 30 | 310 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.847 | 30 | 308 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8386 | 30 | 314 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8271 | 30 | 308 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8636 | 30 | 305 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8635 | 74 | 314 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.86 | 74 | 314 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8494 | 74 | 311 | 1.10.3720.10 |
| af_I6XFF3_60_302_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8394 | 74 | 314 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2R9X7-F1-model_v4 | deleted | 0.959 | 180 | 314 |
|
| AF-A0A0K2R9X7-F1-model_v4 | deleted | 0.9454 | 180 | 314 |
|
| AF-R0CST3-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8795 | 31 | 314 |
GO:0005886
GO:0055085 |
| AF-A0A6I1GDL7-F1-model_v4 | ABC transporter permease | 0.8749 | 30 | 311 |
GO:0005886
GO:0055085 |
| AF-R0CST3-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8737 | 31 | 314 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar