F402820

General Info

Members Datasets Scaffolds Average Seq Length
314 210 628 120

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0533325|Ga0466958_0533325_36_425
Length 129
Sequence MRSHDTLGRAMGLAADFQEILDVLPSDWTDLEFDLRVDESQYIEASTYMVTCNAQPYSNYDWHWRVLVAHQFGHAASIGAVLTSLKNLDQAGIPGELVLRELREGRVEVTHEWGRPESVRREFKRIRAQ

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
52 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
205 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0
Rhizoplane 2.55
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 10.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0533325 3300045836 Unclassified 762
2 LJNas_1008303 3300000546 Bacteria 1117
3 JGI25407J50210_10045279 3300003373 Bacteria 1122
4 Ga0070670_100827866 3300005331 Bacteria 837
5 Ga0068868_100638273 3300005338 Bacteria 947
6 Ga0070660_100577314 3300005339 Bacteria 939
7 Ga0070660_101527049 3300005339 Bacteria 568
8 Ga0070691_10719813 3300005341 Bacteria 601
9 Ga0070671_100668249 3300005355 Bacteria 900
10 Ga0070674_100278552 3300005356 Bacteria 1325
11 Ga0070674_101666519 3300005356 Bacteria 576
12 Ga0070667_100986312 3300005367 Bacteria 786
13 Ga0070714_100398138 3300005435 Bacteria 1301
14 Ga0070713_100142814 3300005436 Bacteria 2122
15 Ga0070710_10130340 3300005437 Bacteria 1533
16 Ga0070710_10164304 3300005437 Bacteria 1379
17 Ga0070705_101319791 3300005440 Bacteria 599
18 Ga0070700_100637670 3300005441 Unclassified 840
19 Ga0070663_100028165 3300005455 Bacteria 3822
20 Ga0070678_100171375 3300005456 Bacteria 1768
21 Ga0070678_101066000 3300005456 Bacteria 745
22 Ga0070662_100082937 3300005457 Bacteria 2391
23 Ga0070707_101119949 3300005468 Bacteria 753
24 Ga0070665_100010286 3300005548 Bacteria 9467
25 Ga0070704_100329106 3300005549 Bacteria 1283
26 Ga0070704_100920677 3300005549 Bacteria 787
27 Ga0070664_100104949 3300005564 Bacteria 2461
28 Ga0068857_101455826 3300005577 Bacteria 667
29 Ga0070702_100262348 3300005615 Bacteria 1177
30 Ga0070702_100683850 3300005615 Bacteria 780
31 Ga0068852_101519599 3300005616 Bacteria 692
32 Ga0068866_10991499 3300005718 Bacteria 596
33 Ga0068861_101054199 3300005719 Bacteria 779
34 Ga0068861_101603363 3300005719 Bacteria 641
35 Ga0068870_10254467 3300005840 Bacteria 1090
36 Ga0081538_10007595 3300005981 Bacteria 9353
37 Ga0081538_10017312 3300005981 Bacteria 5475
38 Ga0081538_10041790 3300005981 Bacteria 2903
39 Ga0081538_10059466 3300005981 Bacteria 2207
40 Ga0081538_10172637 3300005981 Bacteria 940
41 Ga0081539_10003509 3300005985 Bacteria 19131
42 Ga0081539_10059342 3300005985 Bacteria 2106
43 Ga0070717_10003305 3300006028 Bacteria 11535
44 Ga0070717_10251098 3300006028 Bacteria 1563
45 Ga0075365_10055015 3300006038 Bacteria 2640
46 Ga0075365_10207964 3300006038 Unclassified 1372
47 Ga0075365_10591194 3300006038 Bacteria 785
48 Ga0075364_10166607 3300006051 Unclassified 1489
49 Ga0070712_100252783 3300006175 Bacteria 1409
50 Ga0075428_100267254 3300006844 Bacteria 1841
51 Ga0075428_102003955 3300006844 Bacteria 600
52 Ga0075430_100004059 3300006846 Bacteria 12357
53 Ga0075430_101087201 3300006846 Bacteria 659
54 Ga0075431_100001218 3300006847 Bacteria 23289
55 Ga0075429_100258052 3300006880 Bacteria 1526
56 Ga0097620_102339897 3300006931 Bacteria 589
57 Ga0075435_100186809 3300007076 Bacteria 1753
58 Ga0111539_10011765 3300009094 Bacteria 10973
59 Ga0111539_10301318 3300009094 Bacteria 1865
60 Ga0111539_11018785 3300009094 Bacteria 962
61 Ga0105245_11499706 3300009098 Bacteria 725
62 Ga0105247_10302766 3300009101 Bacteria 1110
63 Ga0114129_10005961 3300009147 Bacteria 17257
64 Ga0114129_10105804 3300009147 Bacteria 3887
65 Ga0114129_10408624 3300009147 Bacteria 1788
66 Ga0105243_11194996 3300009148 Bacteria 773
67 Ga0105241_12663708 3300009174 Bacteria 503
68 Ga0105249_11896431 3300009553 Bacteria 669
69 Ga0105246_10626679 3300011119 Bacteria 933
70 Ga0157369_10562633 3300013105 Bacteria 1178
71 Ga0157369_10689291 3300013105 Bacteria 1052
72 Ga0157377_10151763 3300014745 Bacteria 1433
73 Ga0213876_10004539 3300021384 Bacteria 7753
74 Ga0207426_1020792 3300025302 Bacteria 2277
75 Ga0207692_10136929 3300025898 Bacteria 1389
76 Ga0207692_10186229 3300025898 Bacteria 1212
77 Ga0207692_10473412 3300025898 Bacteria 791
78 Ga0207688_10784447 3300025901 Bacteria 604
79 Ga0207699_10489293 3300025906 Bacteria 887
80 Ga0207643_10499300 3300025908 Bacteria 778
81 Ga0207693_10076172 3300025915 Bacteria 2627
82 Ga0207663_11097518 3300025916 Unclassified 640
83 Ga0207657_10188406 3300025919 Bacteria 1665
84 Ga0207657_10910227 3300025919 Bacteria 677
85 Ga0207649_10811013 3300025920 Bacteria 731
86 Ga0207649_11036370 3300025920 Bacteria 646
87 Ga0207646_11140252 3300025922 Bacteria 685
88 Ga0207681_10898936 3300025923 Bacteria 742
89 Ga0207700_10227609 3300025928 Bacteria 1584
90 Ga0207664_10205496 3300025929 Bacteria 1702
91 Ga0207644_11380547 3300025931 Bacteria 592
92 Ga0207690_10480515 3300025932 Bacteria 1003
93 Ga0207706_10476399 3300025933 Bacteria 1079
94 Ga0207709_10617740 3300025935 Bacteria 860
95 Ga0207669_10440241 3300025937 Bacteria 1030
96 Ga0207665_10314631 3300025939 Bacteria 1173
97 Ga0207689_10621293 3300025942 Bacteria 910
98 Ga0207661_10104086 3300025944 Bacteria 2390
99 Ga0207640_11377738 3300025981 Bacteria 631
100 Ga0207640_11802542 3300025981 Bacteria 553
101 Ga0207678_10160559 3300026067 Bacteria 1920
102 Ga0207678_10244988 3300026067 Bacteria 1535
103 Ga0207708_10172759 3300026075 Unclassified 1713
104 Ga0207708_10252632 3300026075 Unclassified 1421
105 Ga0207702_10372701 3300026078 Bacteria 1371
106 Ga0207674_10406320 3300026116 Bacteria 1316
107 Ga0207675_101030689 3300026118 Bacteria 842
108 Ga0207683_10181845 3300026121 Bacteria 1906
109 Ga0207683_11816901 3300026121 Bacteria 558
110 Ga0207698_11677285 3300026142 Unclassified 651
111 Ga0207428_10054876 3300027907 Bacteria 3171
112 Ga0268266_11047205 3300028379 Bacteria 789
113 Ga0268264_12144701 3300028381 Bacteria 567
114 Ga0265337_1003640 3300028556 Bacteria 6616
115 Ga0265326_10013219 3300028558 Bacteria 2417
116 Ga0265319_1000109 3300028563 Bacteria 63717
117 Ga0265318_10002095 3300028577 Bacteria 10911
118 Ga0265318_10097390 3300028577 Bacteria 1083
119 Ga0265336_10000060 3300028666 Bacteria 103055
120 Ga0265338_10000234 3300028800 Bacteria 103028
121 Ga0265338_10284900 3300028800 Bacteria 1206
122 Ga0265324_10003619 3300029957 Bacteria 7267
123 Ga0265320_10277467 3300031240 Bacteria 742
124 Ga0265340_10000014 3300031247 Bacteria 103055
125 Ga0265327_10011196 3300031251 Bacteria 6212
126 Ga0265327_10024947 3300031251 Bacteria 3497
127 Ga0265316_10171799 3300031344 Bacteria 1616
128 Ga0307408_100092327 3300031548 Bacteria 2288
129 Ga0307405_10158056 3300031731 Bacteria 1602
130 Ga0307413_10458293 3300031824 Bacteria 1014
131 Ga0307413_11019856 3300031824 Bacteria 710
132 Ga0307413_11415079 3300031824 Bacteria 612
133 Ga0307410_10003755 3300031852 Bacteria 7695
134 Ga0307410_10302373 3300031852 Bacteria 1263
135 Ga0307410_10670156 3300031852 Unclassified 872
136 Ga0307406_10126652 3300031901 Bacteria 1786
137 Ga0307407_10046960 3300031903 Bacteria 2447
138 Ga0307412_10539072 3300031911 Bacteria 978
139 Ga0307409_100011730 3300031995 Bacteria 5544
140 Ga0307409_100948102 3300031995 Bacteria 876
141 Ga0307409_101791742 3300031995 Bacteria 643
142 Ga0307416_100538964 3300032002 Unclassified 1238
143 Ga0307414_10506501 3300032004 Bacteria 1069
144 Ga0307411_10473571 3300032005 Unclassified 1053
145 Ga0307415_100008824 3300032126 Bacteria 5612
146 Ga0307415_100040266 3300032126 Bacteria 3094
147 Ga0307415_100093964 3300032126 Bacteria 2179
148 Ga0307415_100106518 3300032126 Bacteria 2070
149 Ga0307415_102445030 3300032126 Bacteria 514
150 Ga0373923_0310278 3300035111 Unclassified 748
151 Ga0373923_0503194 3300035111 Bacteria 591
152 Ga0373946_0144231 3300035171 Bacteria 1106
153 Ga0373955_0216235 3300035172 Unclassified 1144
154 Ga0373933_0900712 3300035724 Unclassified 582
155 Ga0373937_0159002 3300036401 Bacteria 2118
156 Ga0395898_0536437 3300037466 Bacteria 1112
157 Ga0395905_0980687 3300037471 Bacteria 748
158 Ga0395901_0664112 3300038443 Bacteria 1044
159 Ga0395901_0947190 3300038443 Bacteria 840
160 Ga0436365_1894217 3300039437 Bacteria 4164
161 Ga0439440_0098274 3300042993 Bacteria 794
162 Ga0466963_0341252 3300044694 Bacteria 1055
163 Ga0466957_0976118 3300044842 Bacteria 608
164 Ga0466960_0133063 3300044901 Unclassified 1315
165 Ga0466960_0677838 3300044901 Bacteria 617
166 Ga0466967_0063474 3300045976 Bacteria 3282
167 Ga0466967_0072721 3300045976 Bacteria 3083
168 Ga0466967_0698652 3300045976 Bacteria 1004
169 Ga0466967_1220350 3300045976 Bacteria 749
170 Ga0466967_1603293 3300045976 Bacteria 648
171 Ga0495629_0197886 3300046459 Bacteria 1390
172 Ga0495629_1103332 3300046459 Unclassified 513
173 Ga0495641_0000742 3300046461 Bacteria 27572
174 Ga0495641_0046989 3300046461 Bacteria 1983
175 Ga0495653_0132742 3300046463 Bacteria 1760
176 Ga0495650_0201749 3300046471 Bacteria 691
177 Ga0495582_0646282 3300046473 Bacteria 612
178 Ga0495639_0311180 3300046475 Unclassified 787
179 Ga0495662_0109871 3300046476 Bacteria 1351
180 Ga0495664_0407735 3300046477 Unclassified 816
181 Ga0495596_0018412 3300046500 Bacteria 2879
182 Ga0495607_0410151 3300046501 Unclassified 615
183 Ga0495616_0233370 3300046513 Bacteria 796
184 Ga0495618_0000054 3300046514 Bacteria 83787
185 Ga0495620_0051029 3300046515 Bacteria 1762
186 Ga0495620_0348370 3300046515 Bacteria 562
187 Ga0495620_0429822 3300046515 Unclassified 500
188 Ga0495628_0323900 3300046516 Unclassified 1137
189 Ga0495630_0000548 3300046517 Bacteria 27475
190 Ga0495643_0494358 3300046522 Bacteria 527
191 Ga0495644_0291636 3300046523 Unclassified 637
192 Ga0495652_0157736 3300046529 Bacteria 1765
193 Ga0495645_0000354 3300046543 Bacteria 32418
194 Ga0495656_0002063 3300046615 Bacteria 6626
195 Ga0495668_0325575 3300046616 Bacteria 843
196 Ga0495668_0384805 3300046616 Bacteria 771
197 Ga0495657_0000006 3300046675 Bacteria 250610
198 Ga0495658_0068204 3300046683 Bacteria 2059
199 Ga0495658_0329791 3300046683 Bacteria 968
200 Ga0495581_0560237 3300047315 Bacteria 663
201 Ga0495604_0076485 3300047317 Bacteria 2518
202 Ga0495674_1233136 3300047319 Unclassified 564
203 Ga0495676_0439661 3300047321 Bacteria 861
204 Ga0495675_0518525 3300047444 Bacteria 683
205 Ga0495673_0038751 3300047469 Bacteria 2166
206 Ga0495684_0440318 3300047471 Bacteria 908
207 Ga0495686_0022616 3300047472 Bacteria 4159
208 Ga0495602_0781784 3300048088 Unclassified 642
209 Ga0496100_0003365 3300048903 Bacteria 8326
210 Ga0496103_0174588 3300048906 Bacteria 1380
211 Ga0496105_0230820 3300048908 Bacteria 1504
212 Ga0496106_1066399 3300048909 Bacteria 634
213 Ga0496108_0968843 3300048911 Bacteria 728
214 Ga0496114_0259818 3300048917 Bacteria 1529
215 Ga0496115_0000101 3300048918 Bacteria 80831
216 Ga0496115_0000198 3300048918 Bacteria 56167
217 Ga0501031_0044997 3300049568 Bacteria 2880
218 Ga0501033_0313018 3300049570 Bacteria 1104
219 Ga0501034_0372296 3300049571 Unclassified 1354
220 Ga0501034_1380850 3300049571 Unclassified 580
221 Ga0501036_0031603 3300049572 Bacteria 4474
222 Ga0501036_0241334 3300049572 Bacteria 1515
223 Ga0501037_0408059 3300049573 Bacteria 931
224 Ga0501037_0451549 3300049573 Bacteria 877
225 Ga0501038_0182018 3300049574 Bacteria 1695
226 Ga0501038_0487477 3300049574 Bacteria 944
227 Ga0501039_0098857 3300049575 Bacteria 2277
228 Ga0501039_0735845 3300049575 Bacteria 771
229 Ga0501040_0045664 3300049576 Bacteria 2989
230 Ga0501041_0012904 3300049577 Bacteria 4951
231 Ga0501041_0065501 3300049577 Bacteria 2226
232 Ga0501041_0328265 3300049577 Bacteria 965
233 Ga0501042_0041917 3300049578 Bacteria 3256
234 Ga0501042_0233350 3300049578 Bacteria 1327
235 Ga0501042_0315660 3300049578 Unclassified 1129
236 Ga0501042_0801754 3300049578 Bacteria 685
237 Ga0501043_0289851 3300049579 Bacteria 1253
238 Ga0501046_0063082 3300049580 Bacteria 2894
239 Ga0501046_0595304 3300049580 Bacteria 785
240 Ga0501047_0146915 3300049581 Bacteria 2234
241 Ga0501047_1447789 3300049581 Unclassified 503
242 Ga0501048_0057430 3300049582 Bacteria 2760
243 Ga0501048_0501066 3300049582 Bacteria 871
244 Ga0501048_0738897 3300049582 Bacteria 707
245 Ga0501068_0474020 3300049584 Bacteria 811
246 Ga0501070_0280056 3300049586 Bacteria 1361
247 Ga0501071_0006936 3300049587 Bacteria 7391
248 Ga0501072_0114010 3300049588 Bacteria 2152
249 Ga0501072_0389239 3300049588 Bacteria 1106
250 Ga0501072_0513224 3300049588 Bacteria 948
251 Ga0501072_0753451 3300049588 Bacteria 764
252 Ga0501073_0547812 3300049589 Bacteria 799
253 Ga0501073_0574938 3300049589 Bacteria 778
254 Ga0501074_0207353 3300049590 Bacteria 1397
255 Ga0501075_0064903 3300049591 Bacteria 2754
256 Ga0501075_0071220 3300049591 Bacteria 2627
257 Ga0501075_0487202 3300049591 Bacteria 941
258 Ga0501075_0523986 3300049591 Bacteria 904
259 Ga0501075_0897933 3300049591 Bacteria 674
260 Ga0501076_0054584 3300049592 Bacteria 3167
261 Ga0501076_0730976 3300049592 Bacteria 817
262 Ga0501077_0018912 3300049593 Bacteria 4359
263 Ga0501077_0575059 3300049593 Bacteria 723
264 Ga0501077_0797597 3300049593 Bacteria 607
265 Ga0501077_0836861 3300049593 Unclassified 592
266 Ga0501209_151341 3300049656 Bacteria 699
267 Ga0501079_0028212 3300049741 Bacteria 4306
268 Ga0501079_0498535 3300049741 Bacteria 957
269 Ga0501079_0619999 3300049741 Bacteria 851
270 Ga0501079_0911414 3300049741 Bacteria 692
271 Ga0501080_0360303 3300049742 Bacteria 1312
272 Ga0501080_1849790 3300049742 Unclassified 506
273 Ga0501081_0142708 3300049743 Bacteria 1717
274 Ga0501081_0262815 3300049743 Bacteria 1261
275 Ga0501081_0559048 3300049743 Bacteria 855
276 Ga0501081_1398365 3300049743 Bacteria 531
277 Ga0501083_0819430 3300049744 Bacteria 606
278 Ga0501035_0803380 3300049822 Bacteria 751
279 Ga0501044_0085859 3300049823 Bacteria 3180
280 Ga0501045_0045286 3300049824 Bacteria 3203
281 nmdc:mga03n38_936051_c1 3300050490 Unclassified 511
282 nmdc:mga03n38_958665_c1 3300050490 Bacteria 505
283 nmdc:mga00v17_794841_c1 3300050491 Archaea 603
284 nmdc:mga0yw44_169372_c1 3300050492 Bacteria 1433
285 nmdc:mga0yw44_198019_c1 3300050492 Bacteria 1326
286 nmdc:mga0yw44_405803_c1 3300050492 Unclassified 922
287 nmdc:mga05p37_1895228_c1 3300050507 Bacteria 570
288 nmdc:mga05p37_348944_c1 3300050507 Bacteria 1743
289 nmdc:mga09592_1206158_c1 3300050508 Bacteria 625
290 nmdc:mga09592_375723_c1 3300050508 Bacteria 1229
291 nmdc:mga0qj67_189657_c1 3300050509 Bacteria 1671
292 nmdc:mga0qj67_883082_c1 3300050509 Bacteria 705
293 nmdc:mga06r32_172719_c1 3300050510 Bacteria 2146
294 nmdc:mga08y16_109507_c1 3300050511 Bacteria 2876
295 nmdc:mga08y16_1325986_c1 3300050511 Bacteria 685
296 nmdc:mga08y16_1458380_c1 3300050511 Bacteria 646
297 nmdc:mga08y16_1579278_c1 3300050511 Bacteria 614
298 nmdc:mga08y16_763834_c1 3300050511 Bacteria 962
299 nmdc:mga0n895_371628_c1 3300050512 Bacteria 1447
300 nmdc:mga0rr50_309028_c1 3300050513 Bacteria 1324
301 Ga0495601_0000577 3300053077 Bacteria 19478
302 Ga0495612_0000176 3300053078 Bacteria 26921
303 Ga0495655_0207108 3300053083 Bacteria 644
304 Ga0500556_0002691 3300053104 Bacteria 5512
305 Ga0500628_028561 3300053129 Unclassified 1192
306 Ga0500616_0021265 3300053153 Bacteria 3640
307 Ga0500599_018569 3300053736 Bacteria 973
308 Ga0501084_0062889 3300054114 Bacteria 3107
309 Ga0501084_0280695 3300054114 Bacteria 1406
310 Ga0501082_0032945 3300060353 Bacteria 4468
311 Ga0501082_0799586 3300060353 Bacteria 825
312 Ga0501082_0982654 3300060353 Bacteria 738
313 Ga0530510_0024480 3300061734 Bacteria 4308
314 Ga0530510_0085899 3300061734 Bacteria 2292
315 Ga0466958_0533325
316 LJNas_1008303
317 JGI25407J50210_10045279
318 Ga0070670_100827866
319 Ga0068868_100638273
320 Ga0070660_100577314
321 Ga0070660_101527049
322 Ga0070691_10719813
323 Ga0070671_100668249
324 Ga0070674_100278552
325 Ga0070674_101666519
326 Ga0070667_100986312
327 Ga0070714_100398138
328 Ga0070713_100142814
329 Ga0070710_10130340
330 Ga0070710_10164304
331 Ga0070705_101319791
332 Ga0070700_100637670
333 Ga0070663_100028165
334 Ga0070678_100171375
335 Ga0070678_101066000
336 Ga0070662_100082937
337 Ga0070707_101119949
338 Ga0070665_100010286
339 Ga0070704_100329106
340 Ga0070704_100920677
341 Ga0070664_100104949
342 Ga0068857_101455826
343 Ga0070702_100262348
344 Ga0070702_100683850
345 Ga0068852_101519599
346 Ga0068866_10991499
347 Ga0068861_101054199
348 Ga0068861_101603363
349 Ga0068870_10254467
350 Ga0081538_10007595
351 Ga0081538_10017312
352 Ga0081538_10041790
353 Ga0081538_10059466
354 Ga0081538_10172637
355 Ga0081539_10003509
356 Ga0081539_10059342
357 Ga0070717_10003305
358 Ga0070717_10251098
359 Ga0075365_10055015
360 Ga0075365_10207964
361 Ga0075365_10591194
362 Ga0075364_10166607
363 Ga0070712_100252783
364 Ga0075428_100267254
365 Ga0075428_102003955
366 Ga0075430_100004059
367 Ga0075430_101087201
368 Ga0075431_100001218
369 Ga0075429_100258052
370 Ga0097620_102339897
371 Ga0075435_100186809
372 Ga0111539_10011765
373 Ga0111539_10301318
374 Ga0111539_11018785
375 Ga0105245_11499706
376 Ga0105247_10302766
377 Ga0114129_10005961
378 Ga0114129_10105804
379 Ga0114129_10408624
380 Ga0105243_11194996
381 Ga0105241_12663708
382 Ga0105249_11896431
383 Ga0105246_10626679
384 Ga0157369_10562633
385 Ga0157369_10689291
386 Ga0157377_10151763
387 Ga0213876_10004539
388 Ga0207426_1020792
389 Ga0207692_10136929
390 Ga0207692_10186229
391 Ga0207692_10473412
392 Ga0207688_10784447
393 Ga0207699_10489293
394 Ga0207643_10499300
395 Ga0207693_10076172
396 Ga0207663_11097518
397 Ga0207657_10188406
398 Ga0207657_10910227
399 Ga0207649_10811013
400 Ga0207649_11036370
401 Ga0207646_11140252
402 Ga0207681_10898936
403 Ga0207700_10227609
404 Ga0207664_10205496
405 Ga0207644_11380547
406 Ga0207690_10480515
407 Ga0207706_10476399
408 Ga0207709_10617740
409 Ga0207669_10440241
410 Ga0207665_10314631
411 Ga0207689_10621293
412 Ga0207661_10104086
413 Ga0207640_11377738
414 Ga0207640_11802542
415 Ga0207678_10160559
416 Ga0207678_10244988
417 Ga0207708_10172759
418 Ga0207708_10252632
419 Ga0207702_10372701
420 Ga0207674_10406320
421 Ga0207675_101030689
422 Ga0207683_10181845
423 Ga0207683_11816901
424 Ga0207698_11677285
425 Ga0207428_10054876
426 Ga0268266_11047205
427 Ga0268264_12144701
428 Ga0265337_1003640
429 Ga0265326_10013219
430 Ga0265319_1000109
431 Ga0265318_10002095
432 Ga0265318_10097390
433 Ga0265336_10000060
434 Ga0265338_10000234
435 Ga0265338_10284900
436 Ga0265324_10003619
437 Ga0265320_10277467
438 Ga0265340_10000014
439 Ga0265327_10011196
440 Ga0265327_10024947
441 Ga0265316_10171799
442 Ga0307408_100092327
443 Ga0307405_10158056
444 Ga0307413_10458293
445 Ga0307413_11019856
446 Ga0307413_11415079
447 Ga0307410_10003755
448 Ga0307410_10302373
449 Ga0307410_10670156
450 Ga0307406_10126652
451 Ga0307407_10046960
452 Ga0307412_10539072
453 Ga0307409_100011730
454 Ga0307409_100948102
455 Ga0307409_101791742
456 Ga0307416_100538964
457 Ga0307414_10506501
458 Ga0307411_10473571
459 Ga0307415_100008824
460 Ga0307415_100040266
461 Ga0307415_100093964
462 Ga0307415_100106518
463 Ga0307415_102445030
464 Ga0373923_0310278
465 Ga0373923_0503194
466 Ga0373946_0144231
467 Ga0373955_0216235
468 Ga0373933_0900712
469 Ga0373937_0159002
470 Ga0395898_0536437
471 Ga0395905_0980687
472 Ga0395901_0664112
473 Ga0395901_0947190
474 Ga0436365_1894217
475 Ga0439440_0098274
476 Ga0466963_0341252
477 Ga0466957_0976118
478 Ga0466960_0133063
479 Ga0466960_0677838
480 Ga0466967_0063474
481 Ga0466967_0072721
482 Ga0466967_0698652
483 Ga0466967_1220350
484 Ga0466967_1603293
485 Ga0495629_0197886
486 Ga0495629_1103332
487 Ga0495641_0000742
488 Ga0495641_0046989
489 Ga0495653_0132742
490 Ga0495650_0201749
491 Ga0495582_0646282
492 Ga0495639_0311180
493 Ga0495662_0109871
494 Ga0495664_0407735
495 Ga0495596_0018412
496 Ga0495607_0410151
497 Ga0495616_0233370
498 Ga0495618_0000054
499 Ga0495620_0051029
500 Ga0495620_0348370
501 Ga0495620_0429822
502 Ga0495628_0323900
503 Ga0495630_0000548
504 Ga0495643_0494358
505 Ga0495644_0291636
506 Ga0495652_0157736
507 Ga0495645_0000354
508 Ga0495656_0002063
509 Ga0495668_0325575
510 Ga0495668_0384805
511 Ga0495657_0000006
512 Ga0495658_0068204
513 Ga0495658_0329791
514 Ga0495581_0560237
515 Ga0495604_0076485
516 Ga0495674_1233136
517 Ga0495676_0439661
518 Ga0495675_0518525
519 Ga0495673_0038751
520 Ga0495684_0440318
521 Ga0495686_0022616
522 Ga0495602_0781784
523 Ga0496100_0003365
524 Ga0496103_0174588
525 Ga0496105_0230820
526 Ga0496106_1066399
527 Ga0496108_0968843
528 Ga0496114_0259818
529 Ga0496115_0000101
530 Ga0496115_0000198
531 Ga0501031_0044997
532 Ga0501033_0313018
533 Ga0501034_0372296
534 Ga0501034_1380850
535 Ga0501036_0031603
536 Ga0501036_0241334
537 Ga0501037_0408059
538 Ga0501037_0451549
539 Ga0501038_0182018
540 Ga0501038_0487477
541 Ga0501039_0098857
542 Ga0501039_0735845
543 Ga0501040_0045664
544 Ga0501041_0012904
545 Ga0501041_0065501
546 Ga0501041_0328265
547 Ga0501042_0041917
548 Ga0501042_0233350
549 Ga0501042_0315660
550 Ga0501042_0801754
551 Ga0501043_0289851
552 Ga0501046_0063082
553 Ga0501046_0595304
554 Ga0501047_0146915
555 Ga0501047_1447789
556 Ga0501048_0057430
557 Ga0501048_0501066
558 Ga0501048_0738897
559 Ga0501068_0474020
560 Ga0501070_0280056
561 Ga0501071_0006936
562 Ga0501072_0114010
563 Ga0501072_0389239
564 Ga0501072_0513224
565 Ga0501072_0753451
566 Ga0501073_0547812
567 Ga0501073_0574938
568 Ga0501074_0207353
569 Ga0501075_0064903
570 Ga0501075_0071220
571 Ga0501075_0487202
572 Ga0501075_0523986
573 Ga0501075_0897933
574 Ga0501076_0054584
575 Ga0501076_0730976
576 Ga0501077_0018912
577 Ga0501077_0575059
578 Ga0501077_0797597
579 Ga0501077_0836861
580 Ga0501209_151341
581 Ga0501079_0028212
582 Ga0501079_0498535
583 Ga0501079_0619999
584 Ga0501079_0911414
585 Ga0501080_0360303
586 Ga0501080_1849790
587 Ga0501081_0142708
588 Ga0501081_0262815
589 Ga0501081_0559048
590 Ga0501081_1398365
591 Ga0501083_0819430
592 Ga0501035_0803380
593 Ga0501044_0085859
594 Ga0501045_0045286
595 nmdc:mga03n38_936051_c1
596 nmdc:mga03n38_958665_c1
597 nmdc:mga00v17_794841_c1
598 nmdc:mga0yw44_169372_c1
599 nmdc:mga0yw44_198019_c1
600 nmdc:mga0yw44_405803_c1
601 nmdc:mga05p37_1895228_c1
602 nmdc:mga05p37_348944_c1
603 nmdc:mga09592_1206158_c1
604 nmdc:mga09592_375723_c1
605 nmdc:mga0qj67_189657_c1
606 nmdc:mga0qj67_883082_c1
607 nmdc:mga06r32_172719_c1
608 nmdc:mga08y16_109507_c1
609 nmdc:mga08y16_1325986_c1
610 nmdc:mga08y16_1458380_c1
611 nmdc:mga08y16_1579278_c1
612 nmdc:mga08y16_763834_c1
613 nmdc:mga0n895_371628_c1
614 nmdc:mga0rr50_309028_c1
615 Ga0495601_0000577
616 Ga0495612_0000176
617 Ga0495655_0207108
618 Ga0500556_0002691
619 Ga0500628_028561
620 Ga0500616_0021265
621 Ga0500599_018569
622 Ga0501084_0062889
623 Ga0501084_0280695
624 Ga0501082_0032945
625 Ga0501082_0799586
626 Ga0501082_0982654
627 Ga0530510_0024480
628 Ga0530510_0085899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoq-assembly1.cif.gz_A crystal structure of a lanthipeptide protease 0.6756 22 89
4zoq-assembly1.cif.gz_A crystal structure of a lanthipeptide protease 0.6504 22 89
4wk3-assembly1.cif.gz_A structure of staphyloccus aureus psta 0.6188 19 102
1jqg-assembly1.cif.gz_A crystal structure of the carboxypeptidase a from helicoverpa armigera 0.6147 14 95
4d3g-assembly1.cif.gz_A structure of psta 0.6059 20 102
ID Description Score Start End Superfamily
4d3gA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6572 20 92 3.30.70.120
2mzwA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.6455 14 89 3.30.70.870
2mzwA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Elongation Factor G (Translational Gtpase), domain 3 0.6387 14 89 3.30.70.870
4d3gA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6358 20 92 3.30.70.120
2cg4B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.5783 19 91 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A7W0NIP1-F1-model_v4 Uncharacterized protein 0.9333 1 100
AF-A0A7W0Q0U9-F1-model_v4 Uncharacterized protein 0.9325 2 100
AF-A0A538L6C6-F1-model_v4 Uncharacterized protein 0.9144 1 100
AF-A0A7V9CRW9-F1-model_v4 Uncharacterized protein 0.9138 1 100
AF-A0A7V9KXI2-F1-model_v4 Uncharacterized protein 0.9128 1 101

Map