F402690

General Info

Members Datasets Scaffolds Average Seq Length
314 216 628 222

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10805677|Ga0157375_108056772
Length 250
Sequence MSPFVELMTSRSAQGLRTASKGPIMTTSAITTPSRTATCDPASRVTRSLLGYGVIAGPVYVTISLVQAFTREGFDLSRHQWSMLANGGPGWIQVANFVITGLMVIAFAVGLRRALVSGRGSRWAPRLIAVYGASLIAAGAFRADPALGFPVGTPEGPGTISWHGLLHFAAGGVGFTALAIACIVMGRRFAAEGSRGWAAFSVLTGVVFLTGFAMIASTGGSTMATVLFTAAVLLVWAWMTAVAVNRYRRV

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
140 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
141 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
152 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
155 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
195 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
213 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
214 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
215 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
216 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.19
Nodule 0
Rhizoplane 11.46
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 4.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10805677 3300013308 Bacteria 1088
2 JGI24743J22301_10017981 3300001991 Bacteria 1332
3 JGI24744J21845_10013817 3300002077 Bacteria 1627
4 JGI25406J46586_10147459 3300003203 Bacteria 687
5 rootH1_10056200 3300003316 Bacteria 1512
6 JGI25407J50210_10003614 3300003373 Bacteria 3716
7 JGI25407J50210_10041266 3300003373 Bacteria 1182
8 Ga0070683_100113275 3300005329 Bacteria 2560
9 Ga0070690_100271359 3300005330 Bacteria 1207
10 Ga0068869_100477866 3300005334 Unclassified 1037
11 Ga0070680_100274134 3300005336 Unclassified 1429
12 Ga0070682_100110988 3300005337 Bacteria 1827
13 Ga0068868_100161585 3300005338 Bacteria 1850
14 Ga0070661_100650134 3300005344 Bacteria 856
15 Ga0070692_10070456 3300005345 Bacteria 1861
16 Ga0070668_100307936 3300005347 Bacteria 1330
17 Ga0070674_100133768 3300005356 Bacteria 1852
18 Ga0070667_100090041 3300005367 Bacteria 2636
19 Ga0070714_100000001 3300005435 Bacteria 469087
20 Ga0070714_100410080 3300005435 Bacteria 1282
21 Ga0070714_100523844 3300005435 Bacteria 1132
22 Ga0070714_100631453 3300005435 Unclassified 1030
23 Ga0070700_100278998 3300005441 Bacteria 1211
24 Ga0070663_100048197 3300005455 Bacteria 3020
25 Ga0070678_100146525 3300005456 Bacteria 1896
26 Ga0070678_100469986 3300005456 Bacteria 1105
27 Ga0070681_10782086 3300005458 Bacteria 871
28 Ga0068867_100528178 3300005459 Bacteria 1019
29 Ga0070706_100017450 3300005467 Bacteria 6624
30 Ga0070707_100105570 3300005468 Bacteria 2731
31 Ga0070698_100008200 3300005471 Bacteria 11299
32 Ga0070698_100672338 3300005471 Bacteria 977
33 Ga0070684_100238998 3300005535 Bacteria 1659
34 Ga0070693_100084948 3300005547 Bacteria 1895
35 Ga0070693_100403075 3300005547 Bacteria 949
36 Ga0070665_100006678 3300005548 Bacteria 11734
37 Ga0070664_100173566 3300005564 Bacteria 1913
38 Ga0068857_100068439 3300005577 Bacteria 3160
39 Ga0070702_100128284 3300005615 Bacteria 1598
40 Ga0068852_100247682 3300005616 Bacteria 1706
41 Ga0068859_100715590 3300005617 Bacteria 1091
42 Ga0068864_100248060 3300005618 Bacteria 1652
43 Ga0068861_100397933 3300005719 Bacteria 1221
44 Ga0068863_100007926 3300005841 Bacteria 10382
45 Ga0068863_100644675 3300005841 Bacteria 1050
46 Ga0068858_100212883 3300005842 Bacteria 1829
47 Ga0068862_100741076 3300005844 Unclassified 955
48 Ga0081540_1006880 3300005983 Bacteria 8206
49 Ga0081539_10003198 3300005985 Bacteria 20708
50 Ga0081539_10029348 3300005985 Bacteria 3437
51 Ga0070717_10000589 3300006028 Bacteria 23222
52 Ga0070717_10001367 3300006028 Bacteria 16807
53 Ga0070717_10095527 3300006028 Bacteria 2516
54 Ga0075365_10001543 3300006038 Bacteria 10540
55 Ga0075365_10013609 3300006038 Bacteria 4874
56 Ga0075363_100057202 3300006048 Bacteria 2092
57 Ga0075364_10003026 3300006051 Bacteria 9496
58 Ga0075364_10036351 3300006051 Bacteria 3184
59 Ga0075364_10071016 3300006051 Bacteria 2293
60 Ga0070716_100331578 3300006173 Bacteria 1070
61 Ga0075362_10051256 3300006177 Bacteria 1847
62 Ga0075367_10076356 3300006178 Bacteria 2022
63 Ga0075369_10001209 3300006186 Bacteria 8756
64 Ga0075369_10001363 3300006186 Bacteria 8308
65 Ga0075369_10122975 3300006186 Bacteria 1176
66 Ga0075366_10314555 3300006195 Bacteria 959
67 Ga0097621_100216902 3300006237 Bacteria 1666
68 Ga0075370_10018885 3300006353 Bacteria 3744
69 Ga0075370_10038145 3300006353 Bacteria 2704
70 Ga0075370_10046951 3300006353 Bacteria 2445
71 Ga0075428_100003675 3300006844 Bacteria 16830
72 Ga0075428_100164110 3300006844 Bacteria 2410
73 Ga0075428_100216546 3300006844 Bacteria 2069
74 Ga0075430_100000153 3300006846 Bacteria 44870
75 Ga0075430_100001881 3300006846 Bacteria 17188
76 Ga0075430_100123698 3300006846 Bacteria 2156
77 Ga0075430_100440675 3300006846 Bacteria 1075
78 Ga0075431_100387218 3300006847 Bacteria 1401
79 Ga0097620_100715543 3300006931 Bacteria 1091
80 Ga0105244_10092765 3300009036 Bacteria 1484
81 Ga0111539_10759264 3300009094 Bacteria 1129
82 Ga0105247_10395554 3300009101 Bacteria 983
83 Ga0114129_10163397 3300009147 Bacteria 3040
84 Ga0114129_10819808 3300009147 Bacteria 1185
85 Ga0105248_10374130 3300009177 Bacteria 1604
86 Ga0105238_10823131 3300009551 Bacteria 945
87 Ga0105249_10040897 3300009553 Bacteria 4212
88 Ga0105249_10345206 3300009553 Bacteria 1506
89 Ga0105239_10756460 3300010375 Bacteria 1112
90 Ga0157378_10181379 3300013297 Bacteria 1981
91 Ga0163162_10673657 3300013306 Bacteria 1157
92 Ga0157372_10291186 3300013307 Bacteria 1899
93 Ga0157375_10409945 3300013308 Unclassified 1521
94 Ga0157375_10446890 3300013308 Bacteria 1458
95 Ga0163163_10036468 3300014325 Bacteria 4777
96 Ga0163163_10356497 3300014325 Bacteria 1519
97 Ga0157380_10022726 3300014326 Bacteria 4728
98 Ga0157377_10060890 3300014745 Bacteria 2156
99 Ga0157376_10148836 3300014969 Bacteria 2109
100 Ga0157376_10336249 3300014969 Bacteria 1440
101 Ga0157376_10588304 3300014969 Bacteria 1106
102 Ga0163161_10067275 3300017792 Bacteria 2617
103 Ga0213875_10003876 3300021388 Bacteria 8378
104 Ga0207696_1041198 3300025711 Bacteria 1350
105 Ga0207692_10048074 3300025898 Bacteria 2145
106 Ga0207692_10367233 3300025898 Unclassified 890
107 Ga0207710_10032221 3300025900 Bacteria 2295
108 Ga0207688_10003926 3300025901 Bacteria 8109
109 Ga0207647_10022139 3300025904 Bacteria 4227
110 Ga0207685_10038593 3300025905 Bacteria 1767
111 Ga0207684_10015083 3300025910 Bacteria 6652
112 Ga0207660_10239584 3300025917 Unclassified 1429
113 Ga0207646_10066537 3300025922 Bacteria 3218
114 Ga0207687_10015740 3300025927 Bacteria 4964
115 Ga0207687_10309864 3300025927 Bacteria 1274
116 Ga0207700_10625968 3300025928 Bacteria 959
117 Ga0207664_10000010 3300025929 Bacteria 298623
118 Ga0207664_10348159 3300025929 Bacteria 1311
119 Ga0207664_10558312 3300025929 Bacteria 1027
120 Ga0207644_10034935 3300025931 Bacteria 3519
121 Ga0207706_10281486 3300025933 Bacteria 1450
122 Ga0207686_10059845 3300025934 Bacteria 2408
123 Ga0207670_10064182 3300025936 Bacteria 2516
124 Ga0207669_10226055 3300025937 Bacteria 1377
125 Ga0207704_10338751 3300025938 Bacteria 1167
126 Ga0207665_10002698 3300025939 Bacteria 11898
127 Ga0207691_10055890 3300025940 Bacteria 3597
128 Ga0207689_10031623 3300025942 Bacteria 4404
129 Ga0207661_10502054 3300025944 Bacteria 1108
130 Ga0207679_10663308 3300025945 Bacteria 944
131 Ga0207712_10424844 3300025961 Unclassified 1122
132 Ga0207658_10046039 3300025986 Bacteria 3183
133 Ga0207658_10174735 3300025986 Bacteria 1773
134 Ga0207677_10161531 3300026023 Bacteria 1741
135 Ga0207677_10459039 3300026023 Bacteria 1093
136 Ga0207677_10632793 3300026023 Bacteria 942
137 Ga0207703_10353553 3300026035 Bacteria 1353
138 Ga0207678_10033916 3300026067 Bacteria 4446
139 Ga0207708_10010880 3300026075 Bacteria 6767
140 Ga0207702_10341025 3300026078 Bacteria 1431
141 Ga0207641_10004062 3300026088 Bacteria 12768
142 Ga0207641_10329571 3300026088 Bacteria 1450
143 Ga0207648_10039066 3300026089 Bacteria 4173
144 Ga0207674_10079970 3300026116 Bacteria 3272
145 Ga0207674_10172097 3300026116 Bacteria 2119
146 Ga0207675_100046021 3300026118 Bacteria 4076
147 Ga0207675_100171070 3300026118 Bacteria 2077
148 Ga0207683_10029822 3300026121 Bacteria 4723
149 Ga0207683_10062971 3300026121 Bacteria 3267
150 Ga0207683_10079128 3300026121 Bacteria 2914
151 Ga0209813_10089601 3300027866 Bacteria 1030
152 Ga0268266_10077534 3300028379 Bacteria 2889
153 Ga0268265_10719633 3300028380 Bacteria 966
154 Ga0307515_10041066 3300028794 Bacteria 7289
155 Ga0307515_10258175 3300028794 Bacteria 1483
156 Ga0307512_10005997 3300030522 Bacteria 12461
157 Ga0307512_10006662 3300030522 Bacteria 11638
158 Ga0307513_10000509 3300031456 Bacteria 56039
159 Ga0307513_10005007 3300031456 Bacteria 17555
160 Ga0307513_10008538 3300031456 Bacteria 13091
161 Ga0307508_10077647 3300031616 Bacteria 2900
162 Ga0307508_10098490 3300031616 Bacteria 2517
163 Ga0307516_10019531 3300031730 Bacteria 7019
164 Ga0307405_10531924 3300031731 Bacteria 948
165 Ga0307413_10002459 3300031824 Bacteria 7539
166 Ga0307406_10010253 3300031901 Bacteria 5280
167 Ga0307406_10243170 3300031901 Bacteria 1351
168 Ga0307406_10486372 3300031901 Bacteria 998
169 Ga0307407_10006346 3300031903 Bacteria 5237
170 Ga0307407_10297641 3300031903 Bacteria 1124
171 Ga0307412_10096132 3300031911 Bacteria 2084
172 Ga0307412_10170043 3300031911 Bacteria 1629
173 Ga0307409_100001940 3300031995 Bacteria 10570
174 Ga0307409_100288948 3300031995 Bacteria 1519
175 Ga0307409_100353122 3300031995 Bacteria 1388
176 Ga0307409_100367732 3300031995 Bacteria 1363
177 Ga0307409_100485395 3300031995 Bacteria 1200
178 Ga0307416_100005024 3300032002 Bacteria 8067
179 Ga0307416_100019669 3300032002 Bacteria 4794
180 Ga0307414_10036856 3300032004 Bacteria 3269
181 Ga0307411_10000830 3300032005 Bacteria 11550
182 Ga0307415_100008996 3300032126 Bacteria 5570
183 Ga0307415_100015600 3300032126 Bacteria 4504
184 Ga0307415_100055243 3300032126 Bacteria 2716
185 Ga0373936_0343512 3300035113 Bacteria 679
186 Ga0373953_0234905 3300035117 Bacteria 795
187 Ga0373960_0079857 3300035121 Bacteria 1028
188 Ga0373946_0232224 3300035171 Bacteria 894
189 Ga0373955_0236028 3300035172 Bacteria 1095
190 Ga0373935_0016550 3300035692 Bacteria 4461
191 Ga0373927_0391025 3300035695 Bacteria 917
192 Ga0373925_0060204 3300037068 Bacteria 2851
193 Ga0395898_0195742 3300037466 Bacteria 1931
194 Ga0395905_0105593 3300037471 Bacteria 2645
195 Ga0436364_0135217 3300037853 Bacteria 16245
196 Ga0439461_0008947 3300041410 Bacteria 1806
197 Ga0439466_0003851 3300041411 Bacteria 5789
198 Ga0439466_0012262 3300041411 Bacteria 3162
199 Ga0439465_0000181 3300041413 Bacteria 16193
200 Ga0439465_0002487 3300041413 Bacteria 6017
201 Ga0451787_792975 3300041441 Bacteria 1183
202 Ga0451793_0042953 3300041452 Bacteria 6258
203 Ga0451797_0487905 3300041453 Bacteria 981
204 Ga0451795_0938911 3300041456 Bacteria 2482
205 Ga0451795_1561928 3300041456 Bacteria 1098
206 Ga0451833_1023836 3300041491 Bacteria 1646
207 Ga0451849_1147222 3300041505 Bacteria 1518
208 Ga0451843_0308893 3300041509 Bacteria 737
209 Ga0451843_1014394 3300041509 Bacteria 2492
210 Ga0451853_1019714 3300041512 Bacteria 5162
211 Ga0451853_1369251 3300041512 Bacteria 5246
212 Ga0439431_0010174 3300041997 Bacteria 2132
213 Ga0439445_0034957 3300042004 Bacteria 1318
214 Ga0439448_0012756 3300042005 Bacteria 2518
215 Ga0439448_0081347 3300042005 Bacteria 1088
216 Ga0439455_0072161 3300042012 Bacteria 929
217 Ga0439463_002772 3300042016 Bacteria 4444
218 Ga0450908_036288 3300042184 Unclassified 854
219 Ga0439440_0002923 3300042993 Bacteria 3255
220 Ga0439440_0018804 3300042993 Bacteria 1534
221 Ga0466969_0025055 3300044656 Bacteria 3069
222 Ga0466972_0035259 3300044658 Bacteria 2449
223 Ga0466966_0014559 3300044684 Bacteria 5206
224 Ga0466966_0102912 3300044684 Unclassified 1765
225 Ga0466961_0024491 3300044693 Bacteria 3882
226 Ga0466961_0025095 3300044693 Unclassified 3836
227 Ga0466961_0343470 3300044693 Unclassified 909
228 Ga0466964_0243364 3300044706 Bacteria 883
229 Ga0466968_0003411 3300044735 Bacteria 5876
230 Ga0466968_0045630 3300044735 Bacteria 1860
231 Ga0466970_0017819 3300044765 Bacteria 3672
232 Ga0466959_0000637 3300045049 Bacteria 20397
233 Ga0466959_0028469 3300045049 Bacteria 4143
234 Ga0466959_0064853 3300045049 Bacteria 2651
235 Ga0466959_0330807 3300045049 Unclassified 1040
236 Ga0466958_0020309 3300045836 Bacteria 3872
237 Ga0466967_0085430 3300045976 Bacteria 2857
238 Ga0495603_0202012 3300046455 Bacteria 1149
239 Ga0495638_0120099 3300046460 Bacteria 1554
240 Ga0495582_0296749 3300046473 Bacteria 929
241 Ga0495664_0527573 3300046477 Bacteria 704
242 Ga0495594_0278539 3300046499 Bacteria 953
243 Ga0495608_0099367 3300046511 Bacteria 1877
244 Ga0495632_0129575 3300046519 Bacteria 1175
245 Ga0495586_0173655 3300046535 Bacteria 1218
246 Ga0495624_0132230 3300046690 Bacteria 1530
247 Ga0495600_0112898 3300046809 Bacteria 1769
248 Ga0495600_0422467 3300046809 Bacteria 827
249 Ga0495676_0112692 3300047321 Bacteria 1992
250 Ga0496100_0115598 3300048903 Bacteria 1871
251 Ga0496100_0129925 3300048903 Bacteria 1773
252 Ga0496101_0222815 3300048904 Bacteria 1464
253 Ga0496102_0052858 3300048905 Bacteria 3702
254 Ga0496102_0297113 3300048905 Bacteria 1522
255 Ga0496102_0322035 3300048905 Bacteria 1456
256 Ga0496103_0070024 3300048906 Bacteria 2194
257 Ga0496104_0002751 3300048907 Bacteria 15144
258 Ga0496104_0042864 3300048907 Bacteria 4249
259 Ga0496104_0468887 3300048907 Bacteria 1171
260 Ga0496105_0006007 3300048908 Bacteria 9275
261 Ga0496105_0011760 3300048908 Bacteria 6926
262 Ga0496105_0045278 3300048908 Bacteria 3630
263 Ga0496106_0163998 3300048909 Bacteria 1758
264 Ga0496108_0002331 3300048911 Bacteria 15211
265 Ga0496108_0041189 3300048911 Bacteria 3854
266 Ga0496108_0560511 3300048911 Bacteria 996
267 Ga0496109_0004710 3300048912 Bacteria 11387
268 Ga0496109_0050152 3300048912 Bacteria 3802
269 Ga0496109_0054402 3300048912 Bacteria 3651
270 Ga0496110_0008625 3300048913 Bacteria 8209
271 Ga0496111_0205511 3300048914 Bacteria 1463
272 Ga0496111_0559826 3300048914 Bacteria 839
273 Ga0496112_0696064 3300048915 Bacteria 944
274 Ga0496114_0058773 3300048917 Bacteria 3211
275 Ga0496114_0072046 3300048917 Bacteria 2905
276 Ga0496114_0098512 3300048917 Bacteria 2493
277 Ga0496114_0111934 3300048917 Bacteria 2340
278 Ga0496115_0102728 3300048918 Bacteria 2344
279 Ga0496115_0396111 3300048918 Bacteria 1121
280 Ga0496115_0635711 3300048918 Bacteria 845
281 Ga0496119_0267250 3300048922 Bacteria 856
282 nmdc:mga03n38_2011_c1 3300050490 Bacteria 6118
283 nmdc:mga00v17_12081_c1 3300050491 Bacteria 4756
284 nmdc:mga00v17_524672_c1 3300050491 Bacteria 767
285 nmdc:mga00v17_6853_c1 3300050491 Bacteria 6056
286 nmdc:mga06z11_202535_c1 3300050494 Bacteria 1153
287 nmdc:mga04h51_143217_c1 3300050495 Bacteria 908
288 nmdc:mga07m45_43206_c1 3300050496 Bacteria 2527
289 nmdc:mga05p37_161737_c1 3300050507 Bacteria 2734
290 nmdc:mga05p37_356306_c1 3300050507 Bacteria 1721
291 nmdc:mga0qj67_168009_c1 3300050509 Bacteria 1781
292 nmdc:mga0qj67_82454_c1 3300050509 Bacteria 2579
293 nmdc:mga0qj67_8720_c1 3300050509 Bacteria 7531
294 nmdc:mga06r32_468878_c1 3300050510 Bacteria 1238
295 nmdc:mga08x19_301563_c1 3300050514 Bacteria 1113
296 nmdc:mga0sz30_1075_c3 3300050516 Bacteria 5412
297 nmdc:mga0sz30_26659_c1 3300050516 Bacteria 2370
298 nmdc:mga0sz30_8602_c1 3300050516 Bacteria 3857
299 Ga0495619_0090485 3300053085 Bacteria 2072
300 Ga0500644_0029751 3300053088 Bacteria 1721
301 Ga0500641_0093701 3300053096 Bacteria 1284
302 Ga0500569_033474 3300053109 Bacteria 1460
303 Ga0500652_007213 3300053131 Bacteria 3625
304 Ga0500600_0117527 3300053149 Bacteria 1376
305 Ga0500616_0002196 3300053153 Bacteria 16795
306 Ga0590071_003564 3300059421 Bacteria 3825
307 Ga0590074_003123 3300059423 Bacteria 2733
308 Ga0466962_0058012 3300061719 Bacteria 1848
309 Ga0466962_0146274 3300061719 Bacteria 1146
310 2676484322 2675903059 Bacteria 8644972
311 2739329216 2738543028 Bacteria 6917070
312 2891398847 2891395885 Bacteria 9251614
313 2902800293 2902799365 Bacteria 5419524
314 8001782765 8001781756 Bacteria 9586736
315 Ga0157375_10805677
316 JGI24743J22301_10017981
317 JGI24744J21845_10013817
318 JGI25406J46586_10147459
319 rootH1_10056200
320 JGI25407J50210_10003614
321 JGI25407J50210_10041266
322 Ga0070683_100113275
323 Ga0070690_100271359
324 Ga0068869_100477866
325 Ga0070680_100274134
326 Ga0070682_100110988
327 Ga0068868_100161585
328 Ga0070661_100650134
329 Ga0070692_10070456
330 Ga0070668_100307936
331 Ga0070674_100133768
332 Ga0070667_100090041
333 Ga0070714_100000001
334 Ga0070714_100410080
335 Ga0070714_100523844
336 Ga0070714_100631453
337 Ga0070700_100278998
338 Ga0070663_100048197
339 Ga0070678_100146525
340 Ga0070678_100469986
341 Ga0070681_10782086
342 Ga0068867_100528178
343 Ga0070706_100017450
344 Ga0070707_100105570
345 Ga0070698_100008200
346 Ga0070698_100672338
347 Ga0070684_100238998
348 Ga0070693_100084948
349 Ga0070693_100403075
350 Ga0070665_100006678
351 Ga0070664_100173566
352 Ga0068857_100068439
353 Ga0070702_100128284
354 Ga0068852_100247682
355 Ga0068859_100715590
356 Ga0068864_100248060
357 Ga0068861_100397933
358 Ga0068863_100007926
359 Ga0068863_100644675
360 Ga0068858_100212883
361 Ga0068862_100741076
362 Ga0081540_1006880
363 Ga0081539_10003198
364 Ga0081539_10029348
365 Ga0070717_10000589
366 Ga0070717_10001367
367 Ga0070717_10095527
368 Ga0075365_10001543
369 Ga0075365_10013609
370 Ga0075363_100057202
371 Ga0075364_10003026
372 Ga0075364_10036351
373 Ga0075364_10071016
374 Ga0070716_100331578
375 Ga0075362_10051256
376 Ga0075367_10076356
377 Ga0075369_10001209
378 Ga0075369_10001363
379 Ga0075369_10122975
380 Ga0075366_10314555
381 Ga0097621_100216902
382 Ga0075370_10018885
383 Ga0075370_10038145
384 Ga0075370_10046951
385 Ga0075428_100003675
386 Ga0075428_100164110
387 Ga0075428_100216546
388 Ga0075430_100000153
389 Ga0075430_100001881
390 Ga0075430_100123698
391 Ga0075430_100440675
392 Ga0075431_100387218
393 Ga0097620_100715543
394 Ga0105244_10092765
395 Ga0111539_10759264
396 Ga0105247_10395554
397 Ga0114129_10163397
398 Ga0114129_10819808
399 Ga0105248_10374130
400 Ga0105238_10823131
401 Ga0105249_10040897
402 Ga0105249_10345206
403 Ga0105239_10756460
404 Ga0157378_10181379
405 Ga0163162_10673657
406 Ga0157372_10291186
407 Ga0157375_10409945
408 Ga0157375_10446890
409 Ga0163163_10036468
410 Ga0163163_10356497
411 Ga0157380_10022726
412 Ga0157377_10060890
413 Ga0157376_10148836
414 Ga0157376_10336249
415 Ga0157376_10588304
416 Ga0163161_10067275
417 Ga0213875_10003876
418 Ga0207696_1041198
419 Ga0207692_10048074
420 Ga0207692_10367233
421 Ga0207710_10032221
422 Ga0207688_10003926
423 Ga0207647_10022139
424 Ga0207685_10038593
425 Ga0207684_10015083
426 Ga0207660_10239584
427 Ga0207646_10066537
428 Ga0207687_10015740
429 Ga0207687_10309864
430 Ga0207700_10625968
431 Ga0207664_10000010
432 Ga0207664_10348159
433 Ga0207664_10558312
434 Ga0207644_10034935
435 Ga0207706_10281486
436 Ga0207686_10059845
437 Ga0207670_10064182
438 Ga0207669_10226055
439 Ga0207704_10338751
440 Ga0207665_10002698
441 Ga0207691_10055890
442 Ga0207689_10031623
443 Ga0207661_10502054
444 Ga0207679_10663308
445 Ga0207712_10424844
446 Ga0207658_10046039
447 Ga0207658_10174735
448 Ga0207677_10161531
449 Ga0207677_10459039
450 Ga0207677_10632793
451 Ga0207703_10353553
452 Ga0207678_10033916
453 Ga0207708_10010880
454 Ga0207702_10341025
455 Ga0207641_10004062
456 Ga0207641_10329571
457 Ga0207648_10039066
458 Ga0207674_10079970
459 Ga0207674_10172097
460 Ga0207675_100046021
461 Ga0207675_100171070
462 Ga0207683_10029822
463 Ga0207683_10062971
464 Ga0207683_10079128
465 Ga0209813_10089601
466 Ga0268266_10077534
467 Ga0268265_10719633
468 Ga0307515_10041066
469 Ga0307515_10258175
470 Ga0307512_10005997
471 Ga0307512_10006662
472 Ga0307513_10000509
473 Ga0307513_10005007
474 Ga0307513_10008538
475 Ga0307508_10077647
476 Ga0307508_10098490
477 Ga0307516_10019531
478 Ga0307405_10531924
479 Ga0307413_10002459
480 Ga0307406_10010253
481 Ga0307406_10243170
482 Ga0307406_10486372
483 Ga0307407_10006346
484 Ga0307407_10297641
485 Ga0307412_10096132
486 Ga0307412_10170043
487 Ga0307409_100001940
488 Ga0307409_100288948
489 Ga0307409_100353122
490 Ga0307409_100367732
491 Ga0307409_100485395
492 Ga0307416_100005024
493 Ga0307416_100019669
494 Ga0307414_10036856
495 Ga0307411_10000830
496 Ga0307415_100008996
497 Ga0307415_100015600
498 Ga0307415_100055243
499 Ga0373936_0343512
500 Ga0373953_0234905
501 Ga0373960_0079857
502 Ga0373946_0232224
503 Ga0373955_0236028
504 Ga0373935_0016550
505 Ga0373927_0391025
506 Ga0373925_0060204
507 Ga0395898_0195742
508 Ga0395905_0105593
509 Ga0436364_0135217
510 Ga0439461_0008947
511 Ga0439466_0003851
512 Ga0439466_0012262
513 Ga0439465_0000181
514 Ga0439465_0002487
515 Ga0451787_792975
516 Ga0451793_0042953
517 Ga0451797_0487905
518 Ga0451795_0938911
519 Ga0451795_1561928
520 Ga0451833_1023836
521 Ga0451849_1147222
522 Ga0451843_0308893
523 Ga0451843_1014394
524 Ga0451853_1019714
525 Ga0451853_1369251
526 Ga0439431_0010174
527 Ga0439445_0034957
528 Ga0439448_0012756
529 Ga0439448_0081347
530 Ga0439455_0072161
531 Ga0439463_002772
532 Ga0450908_036288
533 Ga0439440_0002923
534 Ga0439440_0018804
535 Ga0466969_0025055
536 Ga0466972_0035259
537 Ga0466966_0014559
538 Ga0466966_0102912
539 Ga0466961_0024491
540 Ga0466961_0025095
541 Ga0466961_0343470
542 Ga0466964_0243364
543 Ga0466968_0003411
544 Ga0466968_0045630
545 Ga0466970_0017819
546 Ga0466959_0000637
547 Ga0466959_0028469
548 Ga0466959_0064853
549 Ga0466959_0330807
550 Ga0466958_0020309
551 Ga0466967_0085430
552 Ga0495603_0202012
553 Ga0495638_0120099
554 Ga0495582_0296749
555 Ga0495664_0527573
556 Ga0495594_0278539
557 Ga0495608_0099367
558 Ga0495632_0129575
559 Ga0495586_0173655
560 Ga0495624_0132230
561 Ga0495600_0112898
562 Ga0495600_0422467
563 Ga0495676_0112692
564 Ga0496100_0115598
565 Ga0496100_0129925
566 Ga0496101_0222815
567 Ga0496102_0052858
568 Ga0496102_0297113
569 Ga0496102_0322035
570 Ga0496103_0070024
571 Ga0496104_0002751
572 Ga0496104_0042864
573 Ga0496104_0468887
574 Ga0496105_0006007
575 Ga0496105_0011760
576 Ga0496105_0045278
577 Ga0496106_0163998
578 Ga0496108_0002331
579 Ga0496108_0041189
580 Ga0496108_0560511
581 Ga0496109_0004710
582 Ga0496109_0050152
583 Ga0496109_0054402
584 Ga0496110_0008625
585 Ga0496111_0205511
586 Ga0496111_0559826
587 Ga0496112_0696064
588 Ga0496114_0058773
589 Ga0496114_0072046
590 Ga0496114_0098512
591 Ga0496114_0111934
592 Ga0496115_0102728
593 Ga0496115_0396111
594 Ga0496115_0635711
595 Ga0496119_0267250
596 nmdc:mga03n38_2011_c1
597 nmdc:mga00v17_12081_c1
598 nmdc:mga00v17_524672_c1
599 nmdc:mga00v17_6853_c1
600 nmdc:mga06z11_202535_c1
601 nmdc:mga04h51_143217_c1
602 nmdc:mga07m45_43206_c1
603 nmdc:mga05p37_161737_c1
604 nmdc:mga05p37_356306_c1
605 nmdc:mga0qj67_168009_c1
606 nmdc:mga0qj67_82454_c1
607 nmdc:mga0qj67_8720_c1
608 nmdc:mga06r32_468878_c1
609 nmdc:mga08x19_301563_c1
610 nmdc:mga0sz30_1075_c3
611 nmdc:mga0sz30_26659_c1
612 nmdc:mga0sz30_8602_c1
613 Ga0495619_0090485
614 Ga0500644_0029751
615 Ga0500641_0093701
616 Ga0500569_033474
617 Ga0500652_007213
618 Ga0500600_0117527
619 Ga0500616_0002196
620 Ga0590071_003564
621 Ga0590074_003123
622 Ga0466962_0058012
623 Ga0466962_0146274
624 2676484322
625 2739329216
626 2891398847
627 2902800293
628 8001782765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06197

DUF998

Protein of unknown function (DUF998)

54

245

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.6032 62 174
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5651 62 174
4tvq-assembly1.cif.gz_B ccm3 in complex with ccm2 ld-like motif 0.5099 60 211
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.4539 87 218
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.4457 87 218
ID Description Score Start End Superfamily
af_A6NC51_4_206_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7419 17 211 1.20.1070.10
af_Q9Y7U1_22_240_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7298 18 218 1.20.1070.10
af_A6NC51_4_206_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7127 17 211 1.20.1070.10
af_Q559G4_11_218_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7012 15 211 1.20.1070.10
af_Q93319_9_241_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6944 17 219 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A6A7MP94-F1-model_v4 deleted 0.9893 11 214
AF-A0A5A7YM26-F1-model_v4 deleted 0.9873 1 216
AF-A0A536PPZ3-F1-model_v4 DUF998 domain-containing protein 0.9856 12 218 GO:0016020
AF-A0A535JUS0-F1-model_v4 DUF998 domain-containing protein 0.9807 13 212 GO:0016020
AF-A0A7Z0W9W5-F1-model_v4 deleted 0.9796 1 216

Map