F402681

General Info

Members Datasets Scaffolds Average Seq Length
314 232 237 268

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10169293|Ga0157369_101692932
Length 290
Sequence VPEGHTLHRLAHAVDARFGGRTVRVSSPQGRFAEAAALLDRTRLVDSQSYGKHLFVGFEQERLVHIHLGLYGKLHIADGPPPAPVGQVRLRLVSTDARPSYADLRGATACDLVTAAERDLILERLGPDPLRPDADWSRAWDRVRGSRAPIGALLMDQTVLAGVGNVYRAEVLFRHRLHPLRPGRTLRRSQFQAVWEDLVTLMAYGVRTGRIDTVRDAHTPEAMGRPPRVDDHGGEVYVYRRDGQPCHVCGGRIRTEVLAGRNLFWCPRCQPVFRSRARGVQDERGATARA

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
7 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
8 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
9 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
10 2643221647 Streptomyces sp. Root369 Isolate Unclassified
11 2643221670 Streptomyces sp. Root431 Isolate Unclassified
12 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
13 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
14 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
15 2687453737 Frankia sp. BMG5.36 Isolate Nodule
16 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
17 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
18 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
19 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
20 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
21 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
22 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
23 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
24 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
25 2808606448 Streptomyces sp. 193411 Isolate Unclassified
26 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
27 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
28 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
29 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
30 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
31 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
32 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
33 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
34 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
35 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
36 2862574272 Streptomyces sp. AcE210 Isolate Nodule
37 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
38 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
39 2867475112 Streptomyces sp. TM32 Isolate Unclassified
40 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
41 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
42 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
43 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
44 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
45 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
46 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
47 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
48 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
49 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
50 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
51 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
52 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
53 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
54 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
55 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
56 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
57 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
58 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
59 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
60 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
83 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
117 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
143 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 8002784119 Frankia sp. AgB1.9 Isolate Nodule
216 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
217 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
218 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
219 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
220 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
221 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
222 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
223 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
224 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
225 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
226 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
227 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
228 8054920844 Frankia tisae Agncl-8 Isolate Nodule
229 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
230 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
231 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
232 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.52
Metatranscriptomes 0.96
Isolates 24.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.87
Nodule 1.91
Rhizoplane 1.59
Rhizosphere 80.57
Stem 0
Stem Tuber 0
Unclassified 13.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10008180 3300001990 Bacteria 3512
2 Ga0070701_10076199 3300005438 Bacteria 1805
3 Ga0070698_100011005 3300005471 Bacteria 9624
4 Ga0070679_100220088 3300005530 Bacteria 1860
5 Ga0068859_100000014 3300005617 Bacteria 280955
6 Ga0068862_100000026 3300005844 Bacteria 194499
7 Ga0081455_10064031 3300005937 Bacteria 3081
8 Ga0075365_10148645 3300006038 Bacteria 1629
9 Ga0075368_10003220 3300006042 Bacteria 5429
10 Ga0075367_10004802 3300006178 Bacteria 6652
11 Ga0097620_100000014 3300006931 Bacteria 280955
12 Ga0105251_10012488 3300009011 Bacteria 4803
13 Ga0105242_10626734 3300009176 Bacteria 1043
14 Ga0105249_10124332 3300009553 Bacteria 2455
15 Ga0105246_10021803 3300011119 Bacteria 4126
16 Ga0157369_10169293 3300013105 Bacteria 2302
17 Ga0157369_10238225 3300013105 Bacteria 1901
18 Ga0157372_10181506 3300013307 Bacteria 2436
19 Ga0163163_10003733 3300014325 Bacteria 12967
20 Ga0157380_10064582 3300014326 Bacteria 2939
21 Ga0182008_10004862 3300014497 Bacteria 7764
22 Ga0182006_1042073 3300015261 Bacteria 1791
23 Ga0182007_10017762 3300015262 Bacteria 2590
24 Ga0183367_1006 3300015688 Bacteria 648044
25 Ga0206354_10689030 3300020081 Bacteria 1752
26 Ga0206354_11262219 3300020081 Bacteria 1253
27 Ga0206353_10400300 3300020082 Bacteria 2660
28 Ga0207426_1011888 3300025302 Bacteria 3294
29 Ga0207426_1017091 3300025302 Bacteria 2587
30 Ga0207713_1074864 3300025735 Bacteria 1237
31 Ga0207647_10015896 3300025904 Bacteria 5148
32 Ga0207652_10183636 3300025921 Bacteria 1880
33 Ga0207664_10029805 3300025929 Bacteria 4161
34 Ga0207667_10144163 3300025949 Bacteria 2452
35 Ga0207712_10018592 3300025961 Bacteria 4529
36 Ga0207708_10022724 3300026075 Bacteria 4736
37 Ga0207674_10334318 3300026116 Bacteria 1465
38 Ga0209371_1019054 3300027312 Bacteria 1723
39 Ga0209813_10027151 3300027866 Bacteria 1660
40 Ga0268265_10001183 3300028380 Bacteria 22847
41 Ga0307515_10042393 3300028794 Bacteria 7120
42 Ga0307512_10004012 3300030522 Bacteria 16446
43 Ga0307509_10015152 3300031507 Bacteria 9019
44 Ga0307508_10039343 3300031616 Bacteria 4248
45 Ga0307508_10134798 3300031616 Bacteria 2072
46 Ga0307413_10005044 3300031824 Bacteria 5834
47 Ga0307413_10167167 3300031824 Bacteria 1552
48 Ga0307414_10174982 3300032004 Bacteria 1720
49 Ga0307411_10042102 3300032005 Bacteria 2911
50 Ga0307507_10045251 3300033179 Bacteria 4333
51 Ga0395899_0097826 3300037312 Bacteria 2121
52 Ga0395900_0263762 3300037418 Bacteria 1719
53 Ga0395898_0002956 3300037466 Bacteria 19318
54 Ga0395898_0007126 3300037466 Bacteria 11871
55 Ga0395898_0123604 3300037466 Bacteria 2480
56 Ga0395901_0017720 3300038443 Bacteria 7271
57 Ga0439436_0003853 3300041404 Bacteria 4594
58 Ga0439439_0072740 3300041406 Bacteria 922
59 Ga0451837_0414425 3300041494 Bacteria 4192
60 Ga0451853_0881640 3300041512 Bacteria 2212
61 Ga0451853_3613421 3300041512 Bacteria 1466
62 Ga0439442_015499 3300042002 Bacteria 1571
63 Ga0439449_0001026 3300042007 Bacteria 10997
64 Ga0439449_0014464 3300042007 Bacteria 2967
65 Ga0439450_016737 3300042008 Bacteria 1520
66 Ga0439457_006963 3300042014 Bacteria 2734
67 Ga0450903_000082 3300042138 Bacteria 19506
68 Ga0466969_0148588 3300044656 Bacteria 1080
69 Ga0466972_0001201 3300044658 Bacteria 12458
70 Ga0466972_0023142 3300044658 Bacteria 3091
71 Ga0466965_0035582 3300044683 Bacteria 2440
72 Ga0466966_0002187 3300044684 Bacteria 12691
73 Ga0466966_0006304 3300044684 Bacteria 7848
74 Ga0466963_0000826 3300044694 Bacteria 15507
75 Ga0466963_0023271 3300044694 Bacteria 3931
76 Ga0466963_0088966 3300044694 Bacteria 2100
77 Ga0466964_0004043 3300044706 Bacteria 5393
78 Ga0466971_0000710 3300044719 Bacteria 13318
79 Ga0466968_0035086 3300044735 Bacteria 2097
80 Ga0466970_0036077 3300044765 Bacteria 2618
81 Ga0466970_0039654 3300044765 Bacteria 2500
82 Ga0466970_0197520 3300044765 Bacteria 1118
83 Ga0466957_0000835 3300044842 Bacteria 15739
84 Ga0466957_0284767 3300044842 Bacteria 1107
85 Ga0466960_0001092 3300044901 Bacteria 9749
86 Ga0466959_0002801 3300045049 Bacteria 11227
87 Ga0466959_0167429 3300045049 Bacteria 1542
88 Ga0466958_0000131 3300045836 Bacteria 24937
89 Ga0466967_0042293 3300045976 Bacteria 3936
90 Ga0466967_0146571 3300045976 Bacteria 2202
91 Ga0466967_0182323 3300045976 Bacteria 1981
92 Ga0495603_0002410 3300046455 Bacteria 10995
93 Ga0495603_0005677 3300046455 Bacteria 7455
94 Ga0495603_0011907 3300046455 Bacteria 5263
95 Ga0495590_0083885 3300046457 Bacteria 1123
96 Ga0495629_0017959 3300046459 Bacteria 5071
97 Ga0495629_0064829 3300046459 Bacteria 2550
98 Ga0495629_0201389 3300046459 Bacteria 1376
99 Ga0495662_0014805 3300046476 Bacteria 3790
100 Ga0495662_0023317 3300046476 Bacteria 2988
101 Ga0495585_0007532 3300046492 Bacteria 6658
102 Ga0495585_0101526 3300046492 Bacteria 1538
103 Ga0495594_0010108 3300046499 Bacteria 4890
104 Ga0495594_0040807 3300046499 Bacteria 2541
105 Ga0495607_0072594 3300046501 Bacteria 1915
106 Ga0495607_0178085 3300046501 Bacteria 1068
107 Ga0495606_0012769 3300046507 Bacteria 6696
108 Ga0495616_0024623 3300046513 Bacteria 3226
109 Ga0495628_0029371 3300046516 Bacteria 4458
110 Ga0495631_0010353 3300046518 Bacteria 4615
111 Ga0495632_0104020 3300046519 Bacteria 1337
112 Ga0495643_0008442 3300046522 Bacteria 6517
113 Ga0495666_0095557 3300046526 Bacteria 1401
114 Ga0495640_0014341 3300046533 Bacteria 6000
115 Ga0495587_0184578 3300046536 Bacteria 1182
116 Ga0495633_0103412 3300046558 Bacteria 1322
117 Ga0495668_0013399 3300046616 Bacteria 4836
118 Ga0495625_0046473 3300046660 Bacteria 3133
119 Ga0495625_0111797 3300046660 Bacteria 1866
120 Ga0495625_0359867 3300046660 Bacteria 918
121 Ga0495635_0055959 3300046663 Bacteria 2717
122 Ga0495661_0043129 3300046665 Bacteria 2775
123 Ga0495588_0009916 3300046674 Bacteria 4414
124 Ga0495588_0011624 3300046674 Bacteria 4137
125 Ga0495657_0001829 3300046675 Bacteria 18182
126 Ga0495646_0127047 3300046680 Bacteria 1438
127 Ga0495613_0074041 3300046689 Bacteria 2480
128 Ga0495613_0126021 3300046689 Bacteria 1836
129 Ga0495624_0046459 3300046690 Bacteria 2760
130 Ga0495670_0068776 3300046691 Bacteria 1790
131 Ga0495649_0022229 3300046694 Bacteria 3549
132 Ga0495589_0041926 3300046794 Bacteria 2282
133 Ga0495589_0135778 3300046794 Bacteria 1179
134 Ga0495589_0161918 3300046794 Bacteria 1065
135 Ga0495604_0006701 3300047317 Bacteria 9131
136 Ga0495636_0000782 3300047318 Bacteria 11714
137 Ga0495636_0121822 3300047318 Bacteria 1154
138 Ga0495676_0016651 3300047321 Bacteria 6513
139 Ga0495680_0391832 3300047322 Bacteria 960
140 Ga0495687_024179 3300047443 Bacteria 2891
141 Ga0495687_061742 3300047443 Bacteria 1540
142 Ga0495687_082669 3300047443 Bacteria 1253
143 Ga0495675_0022281 3300047444 Bacteria 4037
144 Ga0495685_029044 3300047447 Bacteria 1902
145 Ga0495686_0088166 3300047472 Bacteria 1887
146 Ga0495686_0127329 3300047472 Bacteria 1513
147 Ga0495593_0068224 3300047673 Bacteria 1850
148 Ga0495614_0033987 3300048089 Bacteria 2192
149 Ga0496104_0260008 3300048907 Bacteria 1649
150 Ga0496108_0053272 3300048911 Bacteria 3393
151 Ga0496109_0122315 3300048912 Bacteria 2425
152 Ga0496113_0415916 3300048916 Bacteria 1080
153 Ga0496116_0006741 3300048919 Bacteria 10342
154 Ga0496117_0012536 3300048920 Bacteria 7464
155 Ga0496118_0034457 3300048921 Bacteria 4130
156 Ga0496119_0015573 3300048922 Bacteria 5841
157 Ga0501031_0011192 3300049568 Bacteria 5846
158 Ga0501031_0051787 3300049568 Bacteria 2674
159 Ga0501032_0003050 3300049569 Bacteria 12975
160 Ga0501032_0027322 3300049569 Bacteria 3922
161 Ga0501032_0115272 3300049569 Bacteria 1777
162 Ga0501033_0009749 3300049570 Bacteria 7377
163 Ga0501033_0012479 3300049570 Bacteria 6484
164 Ga0501033_0022267 3300049570 Bacteria 4781
165 Ga0501033_0036471 3300049570 Bacteria 3684
166 Ga0501034_0028508 3300049571 Bacteria 5682
167 Ga0501034_0108689 3300049571 Bacteria 2764
168 Ga0501034_0152354 3300049571 Bacteria 2287
169 Ga0501034_0443539 3300049571 Bacteria 1216
170 Ga0501036_0004155 3300049572 Bacteria 11652
171 Ga0501036_0025455 3300049572 Bacteria 4991
172 Ga0501037_0000644 3300049573 Bacteria 26982
173 Ga0501037_0027274 3300049573 Bacteria 4219
174 Ga0501037_0249031 3300049573 Bacteria 1244
175 Ga0501038_0001482 3300049574 Bacteria 21611
176 Ga0501038_0026403 3300049574 Bacteria 5172
177 Ga0501038_0072712 3300049574 Bacteria 2914
178 Ga0501038_0090053 3300049574 Bacteria 2572
179 Ga0501039_0026796 3300049575 Bacteria 4429
180 Ga0501039_0076005 3300049575 Bacteria 2611
181 Ga0501039_0150948 3300049575 Bacteria 1825
182 Ga0501040_0025890 3300049576 Bacteria 3946
183 Ga0501041_0003388 3300049577 Bacteria 9172
184 Ga0501042_0034772 3300049578 Bacteria 3574
185 Ga0501042_0036871 3300049578 Bacteria 3469
186 Ga0501042_0047470 3300049578 Bacteria 3062
187 Ga0501043_0017130 3300049579 Bacteria 5682
188 Ga0501043_0018811 3300049579 Bacteria 5422
189 Ga0501043_0030321 3300049579 Bacteria 4249
190 Ga0501046_0036136 3300049580 Bacteria 3977
191 Ga0501046_0037593 3300049580 Bacteria 3890
192 Ga0501046_0188525 3300049580 Bacteria 1539
193 Ga0501046_0313706 3300049580 Bacteria 1143
194 Ga0501047_0000025 3300049581 Bacteria 225560
195 Ga0501047_0001101 3300049581 Bacteria 26872
196 Ga0501047_0063831 3300049581 Bacteria 3552
197 Ga0501047_0075142 3300049581 Bacteria 3252
198 Ga0501047_0138539 3300049581 Bacteria 2312
199 Ga0501047_0200982 3300049581 Bacteria 1854
200 Ga0501048_0019385 3300049582 Bacteria 4991
201 Ga0501048_0027314 3300049582 Bacteria 4149
202 Ga0501067_0006058 3300049583 Bacteria 6704
203 Ga0501068_0009848 3300049584 Bacteria 5353
204 Ga0501069_0000008 3300049585 Bacteria 182652
205 Ga0501069_0008664 3300049585 Bacteria 5356
206 Ga0501069_0061134 3300049585 Bacteria 2103
207 Ga0501070_0000042 3300049586 Bacteria 109349
208 Ga0501070_0003688 3300049586 Bacteria 13237
209 Ga0501070_0058067 3300049586 Bacteria 3207
210 Ga0501071_0000759 3300049587 Bacteria 17111
211 Ga0501073_0044192 3300049589 Bacteria 3139
212 Ga0501074_0002291 3300049590 Bacteria 13309
213 Ga0501074_0066303 3300049590 Bacteria 2596
214 Ga0501076_0009593 3300049592 Bacteria 7148
215 Ga0501077_0013524 3300049593 Bacteria 5119
216 Ga0501079_0206454 3300049741 Bacteria 1534
217 Ga0501080_0003239 3300049742 Bacteria 14359
218 Ga0501080_0030534 3300049742 Bacteria 5021
219 Ga0501080_0226478 3300049742 Bacteria 1709
220 Ga0501083_0014645 3300049744 Bacteria 5482
221 Ga0501035_0007013 3300049822 Bacteria 10527
222 Ga0501035_0040956 3300049822 Bacteria 4183
223 Ga0501035_0080509 3300049822 Bacteria 2876
224 Ga0501035_0135929 3300049822 Bacteria 2140
225 Ga0501044_0052883 3300049823 Bacteria 4181
226 Ga0501044_0062712 3300049823 Bacteria 3799
227 Ga0501044_0113122 3300049823 Bacteria 2721
228 Ga0501044_0123678 3300049823 Bacteria 2585
229 Ga0501044_0505193 3300049823 Bacteria 1110
230 Ga0501045_0027825 3300049824 Bacteria 4076
231 nmdc:mga04h51_32266_c1 3300050495 Bacteria 1660
232 Ga0500641_0043644 3300053096 Bacteria 1821
233 Ga0500560_069708 3300053107 Bacteria 1157
234 Ga0501084_0012357 3300054114 Bacteria 7073
235 Ga0501082_0005799 3300060353 Bacteria 10720
236 Ga0466962_0004456 3300061719 Bacteria 6710
237 Ga0466962_0086870 3300061719 Bacteria 1498

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0182323 Ga0466967_0182323_148_927 246
2 3300037466 Ga0395898_0123604 Ga0395898_0123604_1202_2011 252
3 3300025302 Ga0207426_1011888 Ga0207426_10118883 254
4 3300027312 Ga0209371_1019054 Ga0209371_10190541 255
5 3300042138 Ga0450903_000082 Ga0450903_000082_11888_12697 255
6 3300044656 Ga0466969_0148588 Ga0466969_0148588_45_857 255
7 3300044658 Ga0466972_0001201 Ga0466972_0001201_2588_3400 255
8 3300044658 Ga0466972_0023142 Ga0466972_0023142_2167_2976 255
9 3300044684 Ga0466966_0002187 Ga0466966_0002187_11796_12608 255
10 3300044694 Ga0466963_0000826 Ga0466963_0000826_2903_3715 255
11 3300044706 Ga0466964_0004043 Ga0466964_0004043_4280_5092 255
12 3300044719 Ga0466971_0000710 Ga0466971_0000710_4053_4865 255
13 3300044765 Ga0466970_0039654 Ga0466970_0039654_675_1484 255
14 3300044765 Ga0466970_0197520 Ga0466970_0197520_90_902 255
15 3300044842 Ga0466957_0000835 Ga0466957_0000835_11797_12609 255
16 3300044842 Ga0466957_0284767 Ga0466957_0284767_86_895 255
17 3300044901 Ga0466960_0001092 Ga0466960_0001092_6838_7647 255
18 3300045049 Ga0466959_0167429 Ga0466959_0167429_61_873 255
19 3300045836 Ga0466958_0000131 Ga0466958_0000131_11793_12605 255
20 3300045976 Ga0466967_0042293 Ga0466967_0042293_2903_3715 255
21 3300061719 Ga0466962_0004456 Ga0466962_0004456_3173_3985 255
22 3300015688 Ga0183367_1006 Ga0183367_1006457 257
23 3300041512 Ga0451853_3613421 Ga0451853_3613421_441_1250 257
24 3300046457 Ga0495590_0083885 Ga0495590_0083885_215_1024 257
25 3300046501 Ga0495607_0072594 Ga0495607_0072594_509_1318 257
26 3300046507 Ga0495606_0012769 Ga0495606_0012769_690_1499 257
27 3300046513 Ga0495616_0024623 Ga0495616_0024623_2380_3189 257
28 3300046516 Ga0495628_0029371 Ga0495628_0029371_85_894 257
29 3300046518 Ga0495631_0010353 Ga0495631_0010353_512_1321 257
30 3300046519 Ga0495632_0104020 Ga0495632_0104020_342_1151 257
31 3300046522 Ga0495643_0008442 Ga0495643_0008442_3755_4564 257
32 3300046526 Ga0495666_0095557 Ga0495666_0095557_236_1045 257
33 3300046616 Ga0495668_0013399 Ga0495668_0013399_508_1317 257
34 3300046660 Ga0495625_0111797 Ga0495625_0111797_972_1781 257
35 3300046665 Ga0495661_0043129 Ga0495661_0043129_79_888 257
36 3300046680 Ga0495646_0127047 Ga0495646_0127047_114_923 257
37 3300046689 Ga0495613_0126021 Ga0495613_0126021_172_981 257
38 3300046690 Ga0495624_0046459 Ga0495624_0046459_627_1436 257
39 3300046794 Ga0495589_0135778 Ga0495589_0135778_242_1051 257
40 3300047318 Ga0495636_0121822 Ga0495636_0121822_102_911 257
41 3300047321 Ga0495676_0016651 Ga0495676_0016651_824_1633 257
42 3300047322 Ga0495680_0391832 Ga0495680_0391832_71_880 257
43 3300047443 Ga0495687_061742 Ga0495687_061742_363_1172 257
44 3300047472 Ga0495686_0127329 Ga0495686_0127329_432_1241 257
45 3300047673 Ga0495593_0068224 Ga0495593_0068224_203_1012 257
46 3300048089 Ga0495614_0033987 Ga0495614_0033987_1362_2171 257
47 iso_pu_bacteria 8054920844 8054925038 259
48 3300049569 Ga0501032_0115272 Ga0501032_0115272_956_1756 260
49 3300006042 Ga0075368_10003220 Ga0075368_100032203 261
50 3300006178 Ga0075367_10004802 Ga0075367_100048023 261
51 3300014497 Ga0182008_10004862 Ga0182008_100048628 261
52 3300015261 Ga0182006_1042073 Ga0182006_10420733 261
53 3300015262 Ga0182007_10017762 Ga0182007_100177623 261
54 3300027866 Ga0209813_10027151 Ga0209813_100271512 261
55 3300050495 nmdc:mga04h51_32266_c1 nmdc:mga04h51_32266_c1_277_1086 261
56 iso_pu_bacteria 2862290372 2862291915 261
57 3300025949 Ga0207667_10144163 Ga0207667_101441631 262
58 3300046476 Ga0495662_0014805 Ga0495662_0014805_1377_2186 262
59 3300046663 Ga0495635_0055959 Ga0495635_0055959_82_891 262
60 3300046675 Ga0495657_0001829 Ga0495657_0001829_5272_6081 262
61 3300046689 Ga0495613_0074041 Ga0495613_0074041_1504_2313 262
62 iso_pu_bacteria 2818991472 2819739073 263
63 3300042002 Ga0439442_015499 Ga0439442_015499_31_840 264
64 iso_pu_bacteria 2616644941 2616899909 264
65 iso_pu_bacteria 2643221678 2644436413 264
66 iso_pu_bacteria 2808606359 2808841297 264
67 iso_pu_bacteria 2873151551 2873156532 264
68 iso_pu_bacteria 2919468124 2919468696 264
69 iso_pu_bacteria 2946072368 2946075242 264
70 iso_pu_bacteria 3006321560 3006321808 264
71 3300049578 Ga0501042_0036871 Ga0501042_0036871_1985_2848 265
72 3300049581 Ga0501047_0000025 Ga0501047_0000025_65902_66765 265
73 3300049823 Ga0501044_0052883 Ga0501044_0052883_1587_2450 265
74 iso_pu_bacteria 2508501039 2508672117 265
75 iso_pu_bacteria 2547132111 2547406861 265
76 iso_pu_bacteria 2582581313 2585304797 265
77 iso_pu_bacteria 2582581314 2585319475 265
78 iso_pu_bacteria 2616644814 2616700761 265
79 iso_pu_bacteria 2643221587 2643944659 265
80 iso_pu_bacteria 2643221601 2644019133 265
81 iso_pu_bacteria 2643221631 2644174034 265
82 iso_pu_bacteria 2643221647 2644269281 265
83 iso_pu_bacteria 2643221670 2644385418 265
84 iso_pu_bacteria 2643221677 2644431557 265
85 iso_pu_bacteria 2684623035 2686539434 265
86 iso_pu_bacteria 2687453737 2689964139 265
87 iso_pu_bacteria 2767802112 2768646021 265
88 iso_pu_bacteria 2775506925 2776373665 265
89 iso_pu_bacteria 2784132148 2784587888 265
90 iso_pu_bacteria 2784746763 2785344257 265
91 iso_pu_bacteria 2786546132 2786669717 265
92 iso_pu_bacteria 2791355406 2793976123 265
93 iso_pu_bacteria 2802429296 2804844903 265
94 iso_pu_bacteria 2808606375 2808919818 265
95 iso_pu_bacteria 2808606448 2809231475 265
96 iso_pu_bacteria 2808606982 2811848299 265
97 iso_pu_bacteria 2811994879 2812358959 265
98 iso_pu_bacteria 2811994917 2812481209 265
99 iso_pu_bacteria 2818991463 2819693649 265
100 iso_pu_bacteria 2852635781 2852642198 265
101 iso_pu_bacteria 2861520306 2861527334 265
102 iso_pu_bacteria 2862281513 2862288118 265
103 iso_pu_bacteria 2862507626 2862509520 265
104 iso_pu_bacteria 2862574272 2862579974 265
105 iso_pu_bacteria 2862705112 2862711040 265
106 iso_pu_bacteria 2863067949 2863068566 265
107 iso_pu_bacteria 2867475112 2867479692 265
108 iso_pu_bacteria 2912715099 2912720873 265
109 iso_pu_bacteria 2912723979 2912724989 265
110 iso_pu_bacteria 2918501144 2918503845 265
111 iso_pu_bacteria 2935390628 2935392305 265
112 iso_pu_bacteria 2946064051 2946066918 265
113 iso_pu_bacteria 2954380949 2954387038 265
114 iso_pu_bacteria 2954673503 2954676142 265
115 iso_pu_bacteria 2954682443 2954688025 265
116 iso_pu_bacteria 2954691527 2954697875 265
117 iso_pu_bacteria 2954701450 2954704341 265
118 iso_pu_bacteria 2966598605 2966603261 265
119 iso_pu_bacteria 2990059506 2990061857 265
120 iso_pu_bacteria 2997451912 2997456571 265
121 iso_pu_bacteria 2997600082 2997608143 265
122 iso_pu_bacteria 3006425503 3006429037 265
123 iso_pu_bacteria 3006493962 3006501795 265
124 iso_pu_bacteria 8002784119 8002786037 265
125 iso_pu_bacteria 8008485437 8008488813 265
126 iso_pu_bacteria 8008558824 8008559563 265
127 iso_pu_bacteria 8023623736 8023629293 265
128 iso_pu_bacteria 8025413630 8025419341 265
129 iso_pu_bacteria 8025478263 8025485390 265
130 iso_pu_bacteria 8025524527 8025528296 265
131 iso_pu_bacteria 8047893842 8047898924 265
132 iso_pu_bacteria 8048127548 8048127714 265
133 iso_pu_bacteria 8048356638 8048359995 265
134 iso_pu_bacteria 8048369669 8048375882 265
135 iso_pu_bacteria 8048379754 8048382325 265
136 iso_pu_bacteria 8048406513 8048407152 265
137 iso_pu_bacteria 8056447290 8056452367 265
138 iso_pu_bacteria 8056667051 8056667507 265
139 iso_pu_bacteria 8056829672 8056833930 265
140 iso_pu_bacteria 8057568493 8057569496 265
141 3300046694 Ga0495649_0022229 Ga0495649_0022229_1347_2159 267
142 3300047443 Ga0495687_082669 Ga0495687_082669_76_888 267
143 3300005438 Ga0070701_10076199 Ga0070701_100761992 268
144 3300005530 Ga0070679_100220088 Ga0070679_1002200882 268
145 3300013105 Ga0157369_10238225 Ga0157369_102382252 268
146 3300014326 Ga0157380_10064582 Ga0157380_100645823 268
147 3300020081 Ga0206354_11262219 Ga0206354_112622192 268
148 3300025921 Ga0207652_10183636 Ga0207652_101836362 268
149 3300026075 Ga0207708_10022724 Ga0207708_100227244 268
150 3300026116 Ga0207674_10334318 Ga0207674_103343182 268
151 3300031824 Ga0307413_10167167 Ga0307413_101671673 268
152 3300032004 Ga0307414_10174982 Ga0307414_101749822 268
153 3300032005 Ga0307411_10042102 Ga0307411_100421022 268
154 3300044684 Ga0466966_0006304 Ga0466966_0006304_1979_2785 268
155 3300044694 Ga0466963_0023271 Ga0466963_0023271_3097_3906 268
156 3300045049 Ga0466959_0002801 Ga0466959_0002801_7326_8132 268
157 3300049568 Ga0501031_0011192 Ga0501031_0011192_4484_5290 268
158 3300049568 Ga0501031_0051787 Ga0501031_0051787_1772_2593 268
159 3300049569 Ga0501032_0003050 Ga0501032_0003050_661_1467 268
160 3300049569 Ga0501032_0027322 Ga0501032_0027322_155_976 268
161 3300049570 Ga0501033_0022267 Ga0501033_0022267_301_1107 268
162 3300049570 Ga0501033_0036471 Ga0501033_0036471_2836_3657 268
163 3300049571 Ga0501034_0028508 Ga0501034_0028508_4320_5126 268
164 3300049571 Ga0501034_0443539 Ga0501034_0443539_106_927 268
165 3300049572 Ga0501036_0025455 Ga0501036_0025455_3629_4435 268
166 3300049573 Ga0501037_0000644 Ga0501037_0000644_25516_26322 268
167 3300049573 Ga0501037_0027274 Ga0501037_0027274_217_1038 268
168 3300049574 Ga0501038_0026403 Ga0501038_0026403_4320_5126 268
169 3300049574 Ga0501038_0090053 Ga0501038_0090053_1563_2384 268
170 3300049575 Ga0501039_0026796 Ga0501039_0026796_2963_3769 268
171 3300049575 Ga0501039_0076005 Ga0501039_0076005_53_874 268
172 3300049576 Ga0501040_0025890 Ga0501040_0025890_2963_3769 268
173 3300049577 Ga0501041_0003388 Ga0501041_0003388_899_1705 268
174 3300049578 Ga0501042_0034772 Ga0501042_0034772_84_905 268
175 3300049578 Ga0501042_0047470 Ga0501042_0047470_17_823 268
176 3300049579 Ga0501043_0017130 Ga0501043_0017130_4320_5126 268
177 3300049579 Ga0501043_0030321 Ga0501043_0030321_3321_4142 268
178 3300049580 Ga0501046_0036136 Ga0501046_0036136_212_1033 268
179 3300049580 Ga0501046_0037593 Ga0501046_0037593_557_1363 268
180 3300049580 Ga0501046_0188525 Ga0501046_0188525_617_1423 268
181 3300049580 Ga0501046_0313706 Ga0501046_0313706_309_1121 268
182 3300049581 Ga0501047_0001101 Ga0501047_0001101_25510_26316 268
183 3300049581 Ga0501047_0063831 Ga0501047_0063831_2580_3401 268
184 3300049581 Ga0501047_0075142 Ga0501047_0075142_673_1479 268
185 3300049582 Ga0501048_0019385 Ga0501048_0019385_3629_4435 268
186 3300049582 Ga0501048_0027314 Ga0501048_0027314_116_937 268
187 3300049583 Ga0501067_0006058 Ga0501067_0006058_2396_3202 268
188 3300049584 Ga0501068_0009848 Ga0501068_0009848_3868_4674 268
189 3300049585 Ga0501069_0000008 Ga0501069_0000008_102370_103179 268
190 3300049585 Ga0501069_0008664 Ga0501069_0008664_256_1062 268
191 3300049586 Ga0501070_0000042 Ga0501070_0000042_85119_85928 268
192 3300049586 Ga0501070_0058067 Ga0501070_0058067_173_979 268
193 3300049587 Ga0501071_0000759 Ga0501071_0000759_10389_11195 268
194 3300049589 Ga0501073_0044192 Ga0501073_0044192_1307_2113 268
195 3300049590 Ga0501074_0066303 Ga0501074_0066303_1111_1917 268
196 3300049592 Ga0501076_0009593 Ga0501076_0009593_1725_2531 268
197 3300049593 Ga0501077_0013524 Ga0501077_0013524_4182_4988 268
198 3300049741 Ga0501079_0206454 Ga0501079_0206454_301_1107 268
199 3300049742 Ga0501080_0003239 Ga0501080_0003239_9091_9900 268
200 3300049742 Ga0501080_0226478 Ga0501080_0226478_476_1282 268
201 3300049744 Ga0501083_0014645 Ga0501083_0014645_4032_4838 268
202 3300049822 Ga0501035_0080509 Ga0501035_0080509_1514_2320 268
203 3300049822 Ga0501035_0135929 Ga0501035_0135929_88_909 268
204 3300049823 Ga0501044_0062712 Ga0501044_0062712_2437_3243 268
205 3300049823 Ga0501044_0113122 Ga0501044_0113122_1874_2680 268
206 3300049824 Ga0501045_0027825 Ga0501045_0027825_47_853 268
207 3300054114 Ga0501084_0012357 Ga0501084_0012357_5792_6598 268
208 3300060353 Ga0501082_0005799 Ga0501082_0005799_3860_4666 268
209 3300001990 JGI24737J22298_10008180 JGI24737J22298_100081802 269
210 3300005471 Ga0070698_100011005 Ga0070698_1000110052 269
211 3300005617 Ga0068859_100000014 Ga0068859_100000014183 269
212 3300005844 Ga0068862_100000026 Ga0068862_100000026105 269
213 3300005937 Ga0081455_10064031 Ga0081455_100640312 269
214 3300006038 Ga0075365_10148645 Ga0075365_101486452 269
215 3300006931 Ga0097620_100000014 Ga0097620_100000014183 269
216 3300009011 Ga0105251_10012488 Ga0105251_100124882 269
217 3300009176 Ga0105242_10626734 Ga0105242_106267341 269
218 3300009553 Ga0105249_10124332 Ga0105249_101243323 269
219 3300011119 Ga0105246_10021803 Ga0105246_100218035 269
220 3300013105 Ga0157369_10169293 Ga0157369_101692932 269
221 3300013307 Ga0157372_10181506 Ga0157372_101815063 269
222 3300014325 Ga0163163_10003733 Ga0163163_1000373310 269
223 3300020081 Ga0206354_10689030 Ga0206354_106890303 269
224 3300020082 Ga0206353_10400300 Ga0206353_104003004 269
225 3300025302 Ga0207426_1017091 Ga0207426_10170912 269
226 3300025735 Ga0207713_1074864 Ga0207713_10748642 269
227 3300025904 Ga0207647_10015896 Ga0207647_100158964 269
228 3300025929 Ga0207664_10029805 Ga0207664_100298052 269
229 3300025961 Ga0207712_10018592 Ga0207712_100185925 269
230 3300028380 Ga0268265_10001183 Ga0268265_1000118314 269
231 3300028794 Ga0307515_10042393 Ga0307515_100423932 269
232 3300030522 Ga0307512_10004012 Ga0307512_100040124 269
233 3300031507 Ga0307509_10015152 Ga0307509_100151524 269
234 3300031616 Ga0307508_10039343 Ga0307508_100393432 269
235 3300031616 Ga0307508_10134798 Ga0307508_101347982 269
236 3300031824 Ga0307413_10005044 Ga0307413_100050446 269
237 3300033179 Ga0307507_10045251 Ga0307507_100452511 269
238 3300037312 Ga0395899_0097826 Ga0395899_0097826_788_1597 269
239 3300037418 Ga0395900_0263762 Ga0395900_0263762_349_1158 269
240 3300037466 Ga0395898_0002956 Ga0395898_0002956_11667_12476 269
241 3300037466 Ga0395898_0007126 Ga0395898_0007126_9164_9973 269
242 3300038443 Ga0395901_0017720 Ga0395901_0017720_5398_6207 269
243 3300041404 Ga0439436_0003853 Ga0439436_0003853_3630_4439 269
244 3300041406 Ga0439439_0072740 Ga0439439_0072740_37_846 269
245 3300041494 Ga0451837_0414425 Ga0451837_0414425_59_868 269
246 3300041512 Ga0451853_0881640 Ga0451853_0881640_1140_1949 269
247 3300042007 Ga0439449_0001026 Ga0439449_0001026_7483_8310 269
248 3300042007 Ga0439449_0014464 Ga0439449_0014464_842_1651 269
249 3300042008 Ga0439450_016737 Ga0439450_016737_152_961 269
250 3300042014 Ga0439457_006963 Ga0439457_006963_365_1174 269
251 3300044683 Ga0466965_0035582 Ga0466965_0035582_117_926 269
252 3300044694 Ga0466963_0088966 Ga0466963_0088966_704_1657 269
253 3300044735 Ga0466968_0035086 Ga0466968_0035086_58_867 269
254 3300044765 Ga0466970_0036077 Ga0466970_0036077_1423_2265 269
255 3300045976 Ga0466967_0146571 Ga0466967_0146571_1259_2089 269
256 3300046455 Ga0495603_0002410 Ga0495603_0002410_38_847 269
257 3300046455 Ga0495603_0005677 Ga0495603_0005677_923_1732 269
258 3300046455 Ga0495603_0011907 Ga0495603_0011907_3811_4623 269
259 3300046459 Ga0495629_0017959 Ga0495629_0017959_147_956 269
260 3300046459 Ga0495629_0064829 Ga0495629_0064829_878_1687 269
261 3300046459 Ga0495629_0201389 Ga0495629_0201389_135_944 269
262 3300046476 Ga0495662_0023317 Ga0495662_0023317_177_986 269
263 3300046492 Ga0495585_0007532 Ga0495585_0007532_813_1640 269
264 3300046492 Ga0495585_0101526 Ga0495585_0101526_694_1506 269
265 3300046499 Ga0495594_0010108 Ga0495594_0010108_2396_3205 269
266 3300046499 Ga0495594_0040807 Ga0495594_0040807_894_1706 269
267 3300046501 Ga0495607_0178085 Ga0495607_0178085_225_1037 269
268 3300046533 Ga0495640_0014341 Ga0495640_0014341_2658_3476 269
269 3300046536 Ga0495587_0184578 Ga0495587_0184578_91_900 269
270 3300046558 Ga0495633_0103412 Ga0495633_0103412_352_1164 269
271 3300046660 Ga0495625_0046473 Ga0495625_0046473_712_1521 269
272 3300046660 Ga0495625_0359867 Ga0495625_0359867_40_852 269
273 3300046674 Ga0495588_0009916 Ga0495588_0009916_1106_1915 269
274 3300046674 Ga0495588_0011624 Ga0495588_0011624_3225_4034 269
275 3300046691 Ga0495670_0068776 Ga0495670_0068776_62_874 269
276 3300046794 Ga0495589_0041926 Ga0495589_0041926_83_892 269
277 3300046794 Ga0495589_0161918 Ga0495589_0161918_178_990 269
278 3300047317 Ga0495604_0006701 Ga0495604_0006701_5267_6085 269
279 3300047318 Ga0495636_0000782 Ga0495636_0000782_4612_5421 269
280 3300047443 Ga0495687_024179 Ga0495687_024179_1120_1929 269
281 3300047444 Ga0495675_0022281 Ga0495675_0022281_828_1637 269
282 3300047447 Ga0495685_029044 Ga0495685_029044_123_932 269
283 3300047472 Ga0495686_0088166 Ga0495686_0088166_342_1151 269
284 3300048907 Ga0496104_0260008 Ga0496104_0260008_131_940 269
285 3300048911 Ga0496108_0053272 Ga0496108_0053272_711_1520 269
286 3300048912 Ga0496109_0122315 Ga0496109_0122315_309_1118 269
287 3300048916 Ga0496113_0415916 Ga0496113_0415916_242_1051 269
288 3300048919 Ga0496116_0006741 Ga0496116_0006741_825_1637 269
289 3300048920 Ga0496117_0012536 Ga0496117_0012536_2635_3447 269
290 3300048921 Ga0496118_0034457 Ga0496118_0034457_929_1741 269
291 3300048922 Ga0496119_0015573 Ga0496119_0015573_4706_5518 269
292 3300049570 Ga0501033_0009749 Ga0501033_0009749_3806_4615 269
293 3300049570 Ga0501033_0012479 Ga0501033_0012479_5411_6226 269
294 3300049571 Ga0501034_0108689 Ga0501034_0108689_1842_2651 269
295 3300049571 Ga0501034_0152354 Ga0501034_0152354_376_1185 269
296 3300049572 Ga0501036_0004155 Ga0501036_0004155_2905_3714 269
297 3300049573 Ga0501037_0249031 Ga0501037_0249031_16_825 269
298 3300049574 Ga0501038_0001482 Ga0501038_0001482_13759_14568 269
299 3300049574 Ga0501038_0072712 Ga0501038_0072712_1586_2395 269
300 3300049575 Ga0501039_0150948 Ga0501039_0150948_236_1045 269
301 3300049579 Ga0501043_0018811 Ga0501043_0018811_2531_3340 269
302 3300049581 Ga0501047_0138539 Ga0501047_0138539_1407_2216 269
303 3300049581 Ga0501047_0200982 Ga0501047_0200982_497_1324 269
304 3300049585 Ga0501069_0061134 Ga0501069_0061134_797_1633 269
305 3300049586 Ga0501070_0003688 Ga0501070_0003688_4664_5473 269
306 3300049590 Ga0501074_0002291 Ga0501074_0002291_10418_11227 269
307 3300049742 Ga0501080_0030534 Ga0501080_0030534_1307_2116 269
308 3300049822 Ga0501035_0007013 Ga0501035_0007013_7350_8159 269
309 3300049822 Ga0501035_0040956 Ga0501035_0040956_1769_2584 269
310 3300049823 Ga0501044_0123678 Ga0501044_0123678_1422_2231 269
311 3300049823 Ga0501044_0505193 Ga0501044_0505193_227_1036 269
312 3300053096 Ga0500641_0043644 Ga0500641_0043644_964_1773 269
313 3300053107 Ga0500560_069708 Ga0500560_069708_59_895 269
314 3300061719 Ga0466962_0086870 Ga0466962_0086870_185_1027 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

243

272

0.98

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

125

216

0.96

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

110

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n2u-assembly1.cif.gz_SM elongating 70s ribosome complex in a hybrid-h1 pre-translocation (pre-h1) conformation 0.8909 146 197
3twl-assembly1.cif.gz_A crystal structure of arabidopsis thaliana fpg 0.8565 2 206
6fyy-assembly1.cif.gz_S structure of a partial yeast 48s preinitiation complex with eif5 n-terminal domain (model c2) 0.8559 144 192
6c4i-assembly1.cif.gz_m conformation of methylated ggq in the peptidyl transferase center during translation termination 0.8528 160 197
2opf-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate 0.8508 2 267
ID Description Score Start End Superfamily
af_P9WNB9_2_120_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9724 2 115 3.20.190.10
af_P9WNB9_128_268_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9404 124 267 1.10.8.50
af_P9WNB9_128_268_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9276 124 267 1.10.8.50
af_P9WNB9_2_120_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9245 2 115 3.20.190.10
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8946 144 197 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A6B3H099-F1-model_v4 Fpg/Nei family DNA glycosylase 0.9859 20 116 GO:0000703
GO:0003906
GO:0006284
GO:0008270
AF-A0A2V1NUB4-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9801 1 267 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A4S2UND9-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9787 1 269 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078
AF-A0A7Y6FNN5-F1-model_v4 deleted 0.9772 1 177
AF-A0A428WXD5-F1-model_v4 DNA-(apurinic or apyrimidinic site) lyase (EC 4.2.99.18) 0.9769 1 267 GO:0000703
GO:0003684
GO:0006284
GO:0008270
GO:0140078

Feature Viewer

pLDDT pTM Quality
90.09 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map