F402422

General Info

Members Datasets Scaffolds Average Seq Length
313 220 262 361

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_8733_c1|nmdc:mga0yw44_8733_c1_2661_3803
Length 380
Sequence MTSRPLTDTPEEAFMTDSFIPPAKPVIGDEERAAVDRVMRSGMIAQGPEVAAFEGEFAGLMTSGRTCVAVNSGTSGLHLGLLAAGIGPGDEVIVPSFTFAATANSVALTGATPVFADIELDHFCLDAESVAAAVTERTAAIMPVHLYGHPADMDALQAVADEHGLRVFEDAAQAHLATWRGGRVGTFGDFAMFSLYPTKNMTSGEGGMVSCATDEIARMLRLLRNQGMERQYANEVVGFNARMTDIHAAIGRVQLTKVEAWTERRQANAAFLDAHLEGVVVPPVAEQATHVYHQYTIRVAEERDRIVAAMREEHQVGSGVYYPIPNHELASLTQYAPQGDLPVTQQAAREVISLPVHPSLTDADLERIVNAVNATVAAGA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
4 2643221597 Microbacterium sp. Root180 Isolate Unclassified
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221615 Nocardioides sp. Root224 Isolate Unclassified
7 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
8 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
9 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
10 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
11 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
14 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
15 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
16 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
17 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
18 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
19 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
20 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
21 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
22 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
23 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
24 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
25 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
26 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
27 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
28 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
29 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
30 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
31 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
32 2919395869 Microbacterium resistens 2980 Isolate Unclassified
33 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
34 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
35 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
36 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
37 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
38 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
39 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
40 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
41 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
42 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
43 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
44 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
45 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
50 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
53 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
54 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
56 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
151 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
152 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
153 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
154 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
217 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
218 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
219 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
220 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.15
Metatranscriptomes 2.56
Isolates 16.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 5.75
Rhizosphere 77.64
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10022611 3300001979 Bacteria 2161
2 JGI24739J22299_10009936 3300001989 Bacteria 3538
3 JGI24737J22298_10007637 3300001990 Bacteria 3643
4 JGI24735J21928_10039757 3300002067 Bacteria 1374
5 JGI24738J21930_10018624 3300002075 Bacteria 1451
6 JGI25154J39366_1001041 3300002738 Bacteria 11091
7 rootH2_10003015 3300003320 Bacteria 8405
8 rootH2_10035357 3300003320 Bacteria 17880
9 rootL2_10197030 3300003322 Bacteria 7444
10 Ga0007427J51700_118629 3300003559 Bacteria 2425
11 Ga0006780_1015195 3300003735 Bacteria 1318
12 Ga0070658_10001107 3300005327 Bacteria 23005
13 Ga0070658_10065831 3300005327 Bacteria 2959
14 Ga0070682_100142946 3300005337 Bacteria 1633
15 Ga0070682_100146851 3300005337 Bacteria 1614
16 Ga0068868_100023015 3300005338 Bacteria 4711
17 Ga0070660_100131674 3300005339 Bacteria 2002
18 Ga0070661_100051982 3300005344 Bacteria 2999
19 Ga0070659_100000652 3300005366 Bacteria 25359
20 Ga0070667_100036868 3300005367 Bacteria 4099
21 Ga0070667_100061268 3300005367 Bacteria 3185
22 Ga0070708_100001442 3300005445 Bacteria 18138
23 Ga0070706_100119810 3300005467 Bacteria 2453
24 Ga0070706_100288229 3300005467 Bacteria 1532
25 Ga0070707_100018862 3300005468 Bacteria 6496
26 Ga0070707_100044384 3300005468 Bacteria 4255
27 Ga0070698_100006422 3300005471 Bacteria 12756
28 Ga0070698_100185987 3300005471 Bacteria 2015
29 Ga0070698_100394953 3300005471 Bacteria 1316
30 Ga0070684_100375958 3300005535 Bacteria 1308
31 Ga0070697_100017215 3300005536 Bacteria 5684
32 Ga0070697_100032886 3300005536 Bacteria 4175
33 Ga0070697_100048431 3300005536 Bacteria 3445
34 Ga0068853_100110295 3300005539 Bacteria 2444
35 Ga0070665_100258761 3300005548 Bacteria 1742
36 Ga0070704_100103310 3300005549 Unclassified 2152
37 Ga0068855_100022065 3300005563 Bacteria 7632
38 Ga0068855_100275445 3300005563 Bacteria 1870
39 Ga0068854_100195364 3300005578 Bacteria 1587
40 Ga0068856_100027759 3300005614 Bacteria 5522
41 Ga0068856_100066334 3300005614 Bacteria 3567
42 Ga0068863_100046753 3300005841 Bacteria 4108
43 Ga0081455_10042600 3300005937 Bacteria 3980
44 Ga0081540_1004634 3300005983 Bacteria 10398
45 Ga0075365_10014164 3300006038 Bacteria 4791
46 Ga0075365_10151472 3300006038 Bacteria 1613
47 Ga0075364_10016880 3300006051 Bacteria 4549
48 Ga0075432_10037216 3300006058 Bacteria 1693
49 Ga0075367_10021184 3300006178 Bacteria 3630
50 Ga0075434_100022327 3300006871 Bacteria 6164
51 Ga0068865_100159748 3300006881 Bacteria 1718
52 Ga0105244_10001603 3300009036 Bacteria 17980
53 Ga0105244_10009885 3300009036 Bacteria 5821
54 Ga0105240_10046127 3300009093 Bacteria 5523
55 Ga0105240_10082780 3300009093 Bacteria 3940
56 Ga0105240_10356278 3300009093 Bacteria 1659
57 Ga0105245_10048110 3300009098 Bacteria 3815
58 Ga0114129_10339706 3300009147 Bacteria 1992
59 Ga0105243_10166899 3300009148 Bacteria 1903
60 Ga0105241_10000396 3300009174 Bacteria 32960
61 Ga0105248_10012812 3300009177 Bacteria 9250
62 Ga0105237_10022761 3300009545 Bacteria 6430
63 Ga0105237_10023034 3300009545 Bacteria 6387
64 Ga0105239_10006280 3300010375 Bacteria 13823
65 Ga0105239_10042701 3300010375 Bacteria 4968
66 Ga0105246_10002120 3300011119 Bacteria 11971
67 Ga0105246_10011353 3300011119 Bacteria 5529
68 Ga0105246_10148985 3300011119 Bacteria 1769
69 Ga0157370_10000756 3300013104 Bacteria 40377
70 Ga0157370_10014768 3300013104 Bacteria 7972
71 Ga0157370_10190228 3300013104 Bacteria 1905
72 Ga0157369_10001226 3300013105 Bacteria 31968
73 Ga0157369_10001903 3300013105 Bacteria 25179
74 Ga0157369_10054755 3300013105 Bacteria 4307
75 Ga0157369_10228594 3300013105 Bacteria 1945
76 Ga0171462_1001 3300013250 Bacteria 1135406
77 Ga0157372_10181281 3300013307 Bacteria 2438
78 Ga0163163_10014604 3300014325 Bacteria 7224
79 Ga0206350_11117376 3300020080 Bacteria 2936
80 Ga0209646_1000134 3300025246 Bacteria 124492
81 Ga0209148_1001104 3300025254 Bacteria 16176
82 Ga0209051_1002713 3300025303 Bacteria 12316
83 Ga0207697_10014399 3300025315 Bacteria 3280
84 Ga0207655_1001640 3300025728 Bacteria 19855
85 Ga0207647_10064188 3300025904 Bacteria 2232
86 Ga0207705_10000001 3300025909 Bacteria 2061880
87 Ga0207705_10083864 3300025909 Bacteria 2326
88 Ga0207684_10033891 3300025910 Unclassified 4342
89 Ga0207654_10000001 3300025911 Bacteria 1816198
90 Ga0207695_10001462 3300025913 Bacteria 39566
91 Ga0207671_10034005 3300025914 Bacteria 3790
92 Ga0207671_10047714 3300025914 Bacteria 3169
93 Ga0207657_10034611 3300025919 Bacteria 4540
94 Ga0207657_10041723 3300025919 Bacteria 4055
95 Ga0207657_10079253 3300025919 Bacteria 2764
96 Ga0207649_10034768 3300025920 Bacteria 3022
97 Ga0207646_10031680 3300025922 Bacteria 4787
98 Ga0207646_10063627 3300025922 Unclassified 3293
99 Ga0207646_10134956 3300025922 Bacteria 2222
100 Ga0207650_10301896 3300025925 Bacteria 1308
101 Ga0207687_10004467 3300025927 Bacteria 9308
102 Ga0207700_10029681 3300025928 Bacteria 3862
103 Ga0207690_10000219 3300025932 Bacteria 43461
104 Ga0207690_10017118 3300025932 Bacteria 4421
105 Ga0207704_10099308 3300025938 Bacteria 1936
106 Ga0207665_10078195 3300025939 Bacteria 2272
107 Ga0207691_10064716 3300025940 Bacteria 3311
108 Ga0207711_10014744 3300025941 Bacteria 6495
109 Ga0207667_10007873 3300025949 Bacteria 12725
110 Ga0207667_10009220 3300025949 Bacteria 11651
111 Ga0207667_10076636 3300025949 Bacteria 3470
112 Ga0207668_10092174 3300025972 Bacteria 2229
113 Ga0207658_10047146 3300025986 Bacteria 3152
114 Ga0207677_10002301 3300026023 Bacteria 10039
115 Ga0207702_10008122 3300026078 Bacteria 8881
116 Ga0207702_10010865 3300026078 Bacteria 7594
117 Ga0207702_10081855 3300026078 Bacteria 2805
118 Ga0207641_10034528 3300026088 Bacteria 4208
119 Ga0207674_10046079 3300026116 Bacteria 4480
120 Ga0207428_10004536 3300027907 Bacteria 13171
121 Ga0268266_10155666 3300028379 Bacteria 2064
122 Ga0307515_10238682 3300028794 Bacteria 1594
123 Ga0316181_1104238 3300030744 Bacteria 1562
124 Ga0307513_10183434 3300031456 Bacteria 1953
125 Ga0307408_100027416 3300031548 Bacteria 3925
126 Ga0307408_100035983 3300031548 Bacteria 3477
127 Ga0307408_100136750 3300031548 Bacteria 1918
128 Ga0307405_10035101 3300031731 Bacteria 2992
129 Ga0307405_10087727 3300031731 Bacteria 2051
130 Ga0307405_10212820 3300031731 Bacteria 1412
131 Ga0307413_10004490 3300031824 Bacteria 6079
132 Ga0307410_10002984 3300031852 Bacteria 8354
133 Ga0307410_10005107 3300031852 Bacteria 6901
134 Ga0307410_10044903 3300031852 Bacteria 2938
135 Ga0307410_10078313 3300031852 Bacteria 2313
136 Ga0307410_10165664 3300031852 Bacteria 1660
137 Ga0307406_10001795 3300031901 Bacteria 11724
138 Ga0307406_10080566 3300031901 Bacteria 2162
139 Ga0307406_10107450 3300031901 Bacteria 1913
140 Ga0307412_10001029 3300031911 Bacteria 15939
141 Ga0307412_10050069 3300031911 Bacteria 2755
142 Ga0307412_10133882 3300031911 Bacteria 1805
143 Ga0307409_100001261 3300031995 Bacteria 12200
144 Ga0307409_100174299 3300031995 Bacteria 1896
145 Ga0307409_100312580 3300031995 Bacteria 1467
146 Ga0307416_100021479 3300032002 Bacteria 4635
147 Ga0307416_100157405 3300032002 Bacteria 2094
148 Ga0307414_10136623 3300032004 Bacteria 1913
149 Ga0307411_10062640 3300032005 Bacteria 2482
150 Ga0307411_10109694 3300032005 Bacteria 1972
151 Ga0307411_10166513 3300032005 Bacteria 1657
152 Ga0307415_100017682 3300032126 Bacteria 4280
153 Ga0307415_100367613 3300032126 Bacteria 1217
154 Ga0395899_0038604 3300037312 Bacteria 3576
155 Ga0395900_0006202 3300037418 Bacteria 12485
156 Ga0395900_0055505 3300037418 Bacteria 4079
157 Ga0395898_0023403 3300037466 Bacteria 6243
158 Ga0395898_0103311 3300037466 Bacteria 2734
159 Ga0395901_0006576 3300038443 Bacteria 11749
160 Ga0395901_0006746 3300038443 Bacteria 11594
161 Ga0395901_0115719 3300038443 Bacteria 2817
162 Ga0395901_0116982 3300038443 Bacteria 2801
163 Ga0395901_0132298 3300038443 Bacteria 2621
164 Ga0395901_0174716 3300038443 Bacteria 2253
165 Ga0395901_0420206 3300038443 Bacteria 1371
166 Ga0436363_1337632 3300039450 Unclassified 1421
167 Ga0439436_0001880 3300041404 Bacteria 6198
168 Ga0451843_0231315 3300041509 Bacteria 2144
169 Ga0439433_0006511 3300041999 Bacteria 2514
170 Ga0439442_000132 3300042002 Bacteria 18441
171 Ga0439449_0002677 3300042007 Bacteria 6939
172 Ga0439449_0011458 3300042007 Bacteria 3336
173 Ga0466969_0037199 3300044656 Bacteria 2456
174 Ga0466961_0005857 3300044693 Bacteria 7788
175 Ga0466961_0132627 3300044693 Bacteria 1561
176 Ga0466963_0012089 3300044694 Bacteria 5275
177 Ga0466971_0007517 3300044719 Bacteria 4747
178 Ga0466971_0015638 3300044719 Bacteria 3342
179 Ga0466970_0173971 3300044765 Bacteria 1194
180 Ga0466960_0014530 3300044901 Bacteria 3373
181 Ga0466958_0000523 3300045836 Bacteria 16184
182 Ga0466958_0034382 3300045836 Bacteria 3024
183 Ga0466958_0056471 3300045836 Bacteria 2385
184 Ga0466967_0014388 3300045976 Bacteria 6161
185 Ga0466967_0082716 3300045976 Bacteria 2902
186 Ga0495603_0171631 3300046455 Bacteria 1256
187 Ga0495585_0050940 3300046492 Bacteria 2296
188 Ga0495594_0009139 3300046499 Bacteria 5114
189 Ga0495586_0027329 3300046535 Bacteria 3053
190 Ga0495669_0019595 3300046684 Bacteria 2921
191 Ga0496100_0027226 3300048903 Bacteria 3514
192 Ga0496101_0093860 3300048904 Bacteria 2235
193 Ga0496101_0126811 3300048904 Bacteria 1935
194 Ga0496102_0004582 3300048905 Bacteria 11683
195 Ga0496103_0012673 3300048906 Bacteria 5002
196 Ga0496103_0034874 3300048906 Bacteria 3078
197 Ga0496104_0010456 3300048907 Bacteria 8288
198 Ga0496106_0051957 3300048909 Bacteria 3091
199 Ga0496109_0008120 3300048912 Bacteria 8899
200 Ga0496109_0082019 3300048912 Bacteria 2972
201 Ga0496110_0455591 3300048913 Bacteria 1166
202 Ga0496111_0032308 3300048914 Bacteria 3731
203 Ga0496113_0012072 3300048916 Bacteria 5795
204 Ga0496113_0099791 3300048916 Bacteria 2249
205 Ga0496114_0016350 3300048917 Bacteria 5976
206 Ga0496114_0285932 3300048917 Bacteria 1454
207 Ga0496115_0078606 3300048918 Bacteria 2684
208 Ga0496115_0287923 3300048918 Bacteria 1348
209 Ga0496117_0004661 3300048920 Bacteria 14917
210 Ga0496118_0015021 3300048921 Bacteria 7199
211 Ga0496118_0083450 3300048921 Bacteria 2234
212 Ga0496119_0137842 3300048922 Bacteria 1321
213 Ga0496120_0022376 3300048923 Bacteria 3977
214 Ga0496120_0025614 3300048923 Bacteria 3658
215 Ga0496122_0014517 3300048925 Bacteria 7604
216 Ga0496125_0015589 3300048928 Bacteria 7338
217 Ga0496125_0208779 3300048928 Bacteria 1270
218 Ga0496126_0053015 3300048929 Bacteria 3682
219 Ga0501315_005310 3300049531 Bacteria 1390
220 Ga0501321_000448 3300049537 Bacteria 2646
221 Ga0501323_000263 3300049539 Bacteria 3547
222 Ga0501325_000128 3300049541 Bacteria 2699
223 Ga0501032_0002014 3300049569 Bacteria 16010
224 Ga0501032_0018187 3300049569 Bacteria 4926
225 Ga0501033_0100643 3300049570 Bacteria 2109
226 Ga0501034_0000051 3300049571 Bacteria 210960
227 Ga0501034_0001989 3300049571 Bacteria 25870
228 Ga0501034_0002933 3300049571 Bacteria 19772
229 Ga0501034_0018422 3300049571 Bacteria 7159
230 Ga0501034_0026078 3300049571 Bacteria 5952
231 Ga0501036_0214544 3300049572 Bacteria 1617
232 Ga0501036_0257204 3300049572 Bacteria 1463
233 Ga0501037_0013850 3300049573 Bacteria 5943
234 Ga0501037_0203159 3300049573 Bacteria 1400
235 Ga0501038_0003918 3300049574 Bacteria 13843
236 Ga0501038_0027063 3300049574 Bacteria 5105
237 Ga0501039_0091455 3300049575 Bacteria 2371
238 Ga0501040_0096822 3300049576 Bacteria 2055
239 Ga0501043_0036343 3300049579 Bacteria 3874
240 Ga0501043_0215957 3300049579 Bacteria 1485
241 Ga0501046_0008494 3300049580 Bacteria 8943
242 Ga0501046_0114223 3300049580 Bacteria 2060
243 Ga0501047_0059629 3300049581 Bacteria 3684
244 Ga0501047_0191425 3300049581 Bacteria 1909
245 Ga0501068_0056899 3300049584 Bacteria 2371
246 Ga0501071_0013488 3300049587 Bacteria 5570
247 Ga0501071_0248555 3300049587 Bacteria 1342
248 Ga0501083_0002463 3300049744 Bacteria 12684
249 Ga0501083_0010167 3300049744 Bacteria 6630
250 Ga0501035_0005068 3300049822 Bacteria 12485
251 nmdc:mga00v17_86970_c1 3300050491 Bacteria 1959
252 nmdc:mga0yw44_10892_c1 3300050492 Bacteria 4662
253 nmdc:mga0yw44_8733_c1 3300050492 Bacteria 5069
254 nmdc:mga06z11_145798_c1 3300050494 Bacteria 1342
255 nmdc:mga08x19_71160_c1 3300050514 Unclassified 2267
256 Ga0500635_0000004 3300053080 Bacteria 210675
257 Ga0500568_0003482 3300053139 Bacteria 8750
258 Ga0500568_0007381 3300053139 Bacteria 5397
259 Ga0501084_0074547 3300054114 Bacteria 2842
260 Ga0587090_000422 3300059510 Bacteria 3468
261 Ga0501082_0002655 3300060353 Bacteria 15637
262 Ga0466962_0012896 3300061719 Bacteria 4020

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_86970_c1 nmdc:mga00v17_86970_c1_13_948 308
2 3300046684 Ga0495669_0019595 Ga0495669_0019595_1765_2763 330
3 3300048923 Ga0496120_0022376 Ga0496120_0022376_2931_3935 333
4 3300049531 Ga0501315_005310 Ga0501315_005310_361_1368 335
5 3300049572 Ga0501036_0214544 Ga0501036_0214544_573_1589 335
6 3300049580 Ga0501046_0114223 Ga0501046_0114223_265_1296 336
7 3300048921 Ga0496118_0083450 Ga0496118_0083450_1070_2182 340
8 3300048922 Ga0496119_0137842 Ga0496119_0137842_171_1283 340
9 3300006871 Ga0075434_100022327 Ga0075434_1000223273 343
10 3300009147 Ga0114129_10339706 Ga0114129_103397062 343
11 3300005467 Ga0070706_100119810 Ga0070706_1001198102 345
12 3300005535 Ga0070684_100375958 Ga0070684_1003759582 348
13 3300005536 Ga0070697_100032886 Ga0070697_1000328862 348
14 3300025939 Ga0207665_10078195 Ga0207665_100781952 348
15 3300038443 Ga0395901_0006746 Ga0395901_0006746_7102_8190 348
16 3300049571 Ga0501034_0002933 Ga0501034_0002933_8559_9638 349
17 3300049573 Ga0501037_0203159 Ga0501037_0203159_52_1131 349
18 3300049574 Ga0501038_0003918 Ga0501038_0003918_2108_3187 349
19 3300049580 Ga0501046_0008494 Ga0501046_0008494_1931_3010 349
20 3300049744 Ga0501083_0002463 Ga0501083_0002463_8168_9247 349
21 3300049822 Ga0501035_0005068 Ga0501035_0005068_8120_9199 349
22 3300054114 Ga0501084_0074547 Ga0501084_0074547_1046_2125 349
23 3300060353 Ga0501082_0002655 Ga0501082_0002655_9170_10249 349
24 3300013105 Ga0157369_10228594 Ga0157369_102285942 350
25 3300038443 Ga0395901_0174716 Ga0395901_0174716_799_1887 350
26 3300013105 Ga0157369_10001903 Ga0157369_1000190313 352
27 3300031548 Ga0307408_100136750 Ga0307408_1001367501 352
28 3300031852 Ga0307410_10165664 Ga0307410_101656642 352
29 3300031901 Ga0307406_10107450 Ga0307406_101074502 352
30 3300031911 Ga0307412_10133882 Ga0307412_101338822 352
31 3300031995 Ga0307409_100174299 Ga0307409_1001742992 352
32 3300032005 Ga0307411_10166513 Ga0307411_101665132 352
33 3300038443 Ga0395901_0115719 Ga0395901_0115719_290_1378 353
34 3300048903 Ga0496100_0027226 Ga0496100_0027226_1507_2595 353
35 3300048904 Ga0496101_0093860 Ga0496101_0093860_1044_2132 353
36 3300048905 Ga0496102_0004582 Ga0496102_0004582_903_1991 353
37 3300048906 Ga0496103_0012673 Ga0496103_0012673_1412_2500 353
38 3300048917 Ga0496114_0016350 Ga0496114_0016350_4248_5336 353
39 3300048920 Ga0496117_0004661 Ga0496117_0004661_6555_7652 353
40 3300049576 Ga0501040_0096822 Ga0501040_0096822_791_1882 353
41 3300053080 Ga0500635_0000004 Ga0500635_0000004_129187_130284 353
42 3300003322 rootL2_10197030 rootL2_101970305 354
43 3300025928 Ga0207700_10029681 Ga0207700_100296811 354
44 3300031548 Ga0307408_100035983 Ga0307408_1000359833 354
45 3300031901 Ga0307406_10080566 Ga0307406_100805662 354
46 3300032002 Ga0307416_100021479 Ga0307416_1000214793 354
47 3300032004 Ga0307414_10136623 Ga0307414_101366232 354
48 3300044765 Ga0466970_0173971 Ga0466970_0173971_17_1141 354
49 3300045976 Ga0466967_0082716 Ga0466967_0082716_624_1739 354
50 iso_pu_bacteria 2515154155 2515857049 354
51 iso_pu_bacteria 2731639228 2731908766 354
52 iso_pu_bacteria 2799112218 2799184800 354
53 3300049570 Ga0501033_0100643 Ga0501033_0100643_771_1865 355
54 3300049579 Ga0501043_0215957 Ga0501043_0215957_359_1453 355
55 3300049744 Ga0501083_0010167 Ga0501083_0010167_994_2088 355
56 3300005536 Ga0070697_100048431 Ga0070697_1000484314 356
57 3300006881 Ga0068865_100159748 Ga0068865_1001597482 356
58 3300025938 Ga0207704_10099308 Ga0207704_100993083 356
59 3300039450 Ga0436363_1337632 Ga0436363_1337632_125_1249 356
60 3300044656 Ga0466969_0037199 Ga0466969_0037199_16_1104 356
61 3300044693 Ga0466961_0132627 Ga0466961_0132627_83_1171 356
62 3300050514 nmdc:mga08x19_71160_c1 nmdc:mga08x19_71160_c1_838_1935 356
63 3300005327 Ga0070658_10001107 Ga0070658_1000110717 357
64 3300005339 Ga0070660_100131674 Ga0070660_1001316742 357
65 3300005563 Ga0068855_100022065 Ga0068855_1000220652 357
66 3300013104 Ga0157370_10014768 Ga0157370_100147685 357
67 3300025909 Ga0207705_10000001 Ga0207705_100000011573 357
68 3300025949 Ga0207667_10076636 Ga0207667_100766363 357
69 3300037418 Ga0395900_0055505 Ga0395900_0055505_2754_3830 357
70 3300038443 Ga0395901_0116982 Ga0395901_0116982_264_1340 357
71 3300048928 Ga0496125_0208779 Ga0496125_0208779_108_1184 357
72 3300049587 Ga0501071_0013488 Ga0501071_0013488_1205_2281 357
73 3300053139 Ga0500568_0003482 Ga0500568_0003482_4623_5699 357
74 3300053139 Ga0500568_0007381 Ga0500568_0007381_2782_3855 357
75 iso_pu_bacteria 2643221567 2643852853 357
76 iso_pu_bacteria 2643221624 2644135362 357
77 iso_pu_bacteria 2675903058 2676477445 357
78 iso_pu_bacteria 2818991458 2819666894 357
79 iso_pu_bacteria 2827628540 2827634702 357
80 iso_pu_bacteria 2887443736 2887445923 357
81 3300005327 Ga0070658_10065831 Ga0070658_100658313 358
82 3300005337 Ga0070682_100142946 Ga0070682_1001429462 358
83 3300005338 Ga0068868_100023015 Ga0068868_1000230155 358
84 3300005366 Ga0070659_100000652 Ga0070659_10000065218 358
85 3300005367 Ga0070667_100036868 Ga0070667_1000368684 358
86 3300005445 Ga0070708_100001442 Ga0070708_1000014426 358
87 3300005468 Ga0070707_100018862 Ga0070707_1000188625 358
88 3300005471 Ga0070698_100185987 Ga0070698_1001859872 358
89 3300005471 Ga0070698_100394953 Ga0070698_1003949532 358
90 3300005549 Ga0070704_100103310 Ga0070704_1001033102 358
91 3300006038 Ga0075365_10151472 Ga0075365_101514722 358
92 3300009545 Ga0105237_10023034 Ga0105237_100230342 358
93 3300013105 Ga0157369_10001226 Ga0157369_1000122625 358
94 3300025909 Ga0207705_10083864 Ga0207705_100838642 358
95 3300025914 Ga0207671_10034005 Ga0207671_100340053 358
96 3300025919 Ga0207657_10041723 Ga0207657_100417236 358
97 3300025932 Ga0207690_10000219 Ga0207690_1000021934 358
98 3300025932 Ga0207690_10017118 Ga0207690_100171182 358
99 3300025986 Ga0207658_10047146 Ga0207658_100471463 358
100 3300026023 Ga0207677_10002301 Ga0207677_1000230110 358
101 3300048917 Ga0496114_0285932 Ga0496114_0285932_109_1197 358
102 iso_pu_bacteria 2643221597 2643996521 358
103 iso_pu_bacteria 2747842429 2747951956 358
104 iso_pu_bacteria 2811994882 2812375612 358
105 iso_pu_bacteria 2870801768 2870802749 358
106 iso_pu_bacteria 2897561785 2897564091 358
107 iso_pu_bacteria 2919395869 2919396771 358
108 iso_pu_bacteria 2928090899 2928091140 358
109 iso_pu_bacteria 2945968032 2945970822 358
110 iso_pu_bacteria 2945968032 2945971263 358
111 iso_pu_bacteria 2946033335 2946034321 358
112 iso_pu_bacteria 2946080515 2946081476 358
113 iso_pu_bacteria 8004182704 8004185931 358
114 iso_pu_bacteria 8004212874 8004213553 358
115 3300005468 Ga0070707_100044384 Ga0070707_1000443843 359
116 3300005471 Ga0070698_100006422 Ga0070698_1000064229 359
117 3300005536 Ga0070697_100017215 Ga0070697_1000172154 359
118 3300005563 Ga0068855_100275445 Ga0068855_1002754452 359
119 3300025910 Ga0207684_10033891 Ga0207684_100338912 359
120 3300025922 Ga0207646_10031680 Ga0207646_100316802 359
121 3300025922 Ga0207646_10063627 Ga0207646_100636272 359
122 3300025922 Ga0207646_10134956 Ga0207646_101349562 359
123 3300044694 Ga0466963_0012089 Ga0466963_0012089_2659_3747 359
124 3300044719 Ga0466971_0015638 Ga0466971_0015638_2187_3275 359
125 3300045836 Ga0466958_0000523 Ga0466958_0000523_3343_4431 359
126 3300045976 Ga0466967_0014388 Ga0466967_0014388_2716_3804 359
127 3300046499 Ga0495594_0009139 Ga0495594_0009139_2915_4024 359
128 iso_pu_bacteria 2537561592 2537898102 359
129 iso_pu_bacteria 2643221613 2644083661 359
130 iso_pu_bacteria 2643221632 2644180970 359
131 iso_pu_bacteria 2643221635 2644197069 359
132 iso_pu_bacteria 2811994874 2812333974 359
133 iso_pu_bacteria 2837268691 2837269290 359
134 iso_pu_bacteria 2839986021 2839987574 359
135 iso_pu_bacteria 2857740372 2857741355 359
136 iso_pu_bacteria 2895660088 2895663396 359
137 iso_pu_bacteria 2904497146 2904499829 359
138 iso_pu_bacteria 2904776348 2904776602 359
139 iso_pu_bacteria 2910809715 2910810684 359
140 iso_pu_bacteria 2919034639 2919037725 359
141 iso_pu_bacteria 2919059106 2919061728 359
142 iso_pu_bacteria 2919391150 2919391412 359
143 iso_pu_bacteria 2919538618 2919542135 359
144 iso_pu_bacteria 2932426870 2932429207 359
145 iso_pu_bacteria 2932431166 2932433153 359
146 iso_pu_bacteria 2933418574 2933420691 359
147 iso_pu_bacteria 2935890801 2935891548 359
148 iso_pu_bacteria 2939647034 2939648894 359
149 iso_pu_bacteria 2939674588 2939676096 359
150 iso_pu_bacteria 2945941187 2945942423 359
151 iso_pu_bacteria 8004021418 8004023430 359
152 iso_pu_bacteria 8004025490 8004026487 359
153 3300003320 rootH2_10003015 rootH2_100030155 360
154 3300005467 Ga0070706_100288229 Ga0070706_1002882291 360
155 3300005614 Ga0068856_100027759 Ga0068856_1000277592 360
156 3300009093 Ga0105240_10046127 Ga0105240_100461275 360
157 3300010375 Ga0105239_10042701 Ga0105239_100427013 360
158 3300026078 Ga0207702_10010865 Ga0207702_100108653 360
159 iso_pu_bacteria 2643221615 2644092713 360
160 iso_pu_bacteria 2643221657 2644322326 360
161 3300010375 Ga0105239_10006280 Ga0105239_100062809 361
162 3300032002 Ga0307416_100157405 Ga0307416_1001574052 361
163 iso_pu_bacteria 8002811521 8002813294 361
164 3300001979 JGI24740J21852_10022611 JGI24740J21852_100226113 362
165 3300001989 JGI24739J22299_10009936 JGI24739J22299_100099363 362
166 3300001990 JGI24737J22298_10007637 JGI24737J22298_100076373 362
167 3300002067 JGI24735J21928_10039757 JGI24735J21928_100397572 362
168 3300002075 JGI24738J21930_10018624 JGI24738J21930_100186241 362
169 3300002738 JGI25154J39366_1001041 JGI25154J39366_10010417 362
170 3300003320 rootH2_10035357 rootH2_100353573 362
171 3300003559 Ga0007427J51700_118629 Ga0007427J51700_1186292 362
172 3300003735 Ga0006780_1015195 Ga0006780_10151951 362
173 3300005337 Ga0070682_100146851 Ga0070682_1001468511 362
174 3300005344 Ga0070661_100051982 Ga0070661_1000519822 362
175 3300005367 Ga0070667_100061268 Ga0070667_1000612682 362
176 3300005539 Ga0068853_100110295 Ga0068853_1001102951 362
177 3300005548 Ga0070665_100258761 Ga0070665_1002587612 362
178 3300005578 Ga0068854_100195364 Ga0068854_1001953642 362
179 3300005614 Ga0068856_100066334 Ga0068856_1000663343 362
180 3300005841 Ga0068863_100046753 Ga0068863_1000467533 362
181 3300005937 Ga0081455_10042600 Ga0081455_100426003 362
182 3300005983 Ga0081540_1004634 Ga0081540_10046345 362
183 3300006038 Ga0075365_10014164 Ga0075365_100141643 362
184 3300006051 Ga0075364_10016880 Ga0075364_100168802 362
185 3300006058 Ga0075432_10037216 Ga0075432_100372162 362
186 3300006178 Ga0075367_10021184 Ga0075367_100211842 362
187 3300009036 Ga0105244_10001603 Ga0105244_1000160312 362
188 3300009036 Ga0105244_10009885 Ga0105244_100098853 362
189 3300009093 Ga0105240_10082780 Ga0105240_100827802 362
190 3300009093 Ga0105240_10356278 Ga0105240_103562782 362
191 3300009098 Ga0105245_10048110 Ga0105245_100481104 362
192 3300009148 Ga0105243_10166899 Ga0105243_101668992 362
193 3300009174 Ga0105241_10000396 Ga0105241_1000039625 362
194 3300009177 Ga0105248_10012812 Ga0105248_100128125 362
195 3300009545 Ga0105237_10022761 Ga0105237_100227615 362
196 3300011119 Ga0105246_10002120 Ga0105246_100021207 362
197 3300011119 Ga0105246_10011353 Ga0105246_100113532 362
198 3300011119 Ga0105246_10148985 Ga0105246_101489852 362
199 3300013104 Ga0157370_10000756 Ga0157370_100007565 362
200 3300013104 Ga0157370_10190228 Ga0157370_101902282 362
201 3300013105 Ga0157369_10054755 Ga0157369_100547554 362
202 3300013250 Ga0171462_1001 Ga0171462_1001337 362
203 3300013307 Ga0157372_10181281 Ga0157372_101812812 362
204 3300014325 Ga0163163_10014604 Ga0163163_100146043 362
205 3300020080 Ga0206350_11117376 Ga0206350_111173763 362
206 3300025246 Ga0209646_1000134 Ga0209646_100013413 362
207 3300025254 Ga0209148_1001104 Ga0209148_100110412 362
208 3300025303 Ga0209051_1002713 Ga0209051_10027137 362
209 3300025315 Ga0207697_10014399 Ga0207697_100143993 362
210 3300025728 Ga0207655_1001640 Ga0207655_10016403 362
211 3300025904 Ga0207647_10064188 Ga0207647_100641881 362
212 3300025911 Ga0207654_10000001 Ga0207654_100000011214 362
213 3300025913 Ga0207695_10001462 Ga0207695_1000146220 362
214 3300025914 Ga0207671_10047714 Ga0207671_100477143 362
215 3300025919 Ga0207657_10034611 Ga0207657_100346114 362
216 3300025919 Ga0207657_10079253 Ga0207657_100792533 362
217 3300025920 Ga0207649_10034768 Ga0207649_100347683 362
218 3300025925 Ga0207650_10301896 Ga0207650_103018962 362
219 3300025927 Ga0207687_10004467 Ga0207687_100044675 362
220 3300025940 Ga0207691_10064716 Ga0207691_100647162 362
221 3300025941 Ga0207711_10014744 Ga0207711_100147444 362
222 3300025949 Ga0207667_10007873 Ga0207667_100078734 362
223 3300025949 Ga0207667_10009220 Ga0207667_1000922010 362
224 3300025972 Ga0207668_10092174 Ga0207668_100921742 362
225 3300026078 Ga0207702_10008122 Ga0207702_100081223 362
226 3300026078 Ga0207702_10081855 Ga0207702_100818553 362
227 3300026088 Ga0207641_10034528 Ga0207641_100345283 362
228 3300026116 Ga0207674_10046079 Ga0207674_100460795 362
229 3300027907 Ga0207428_10004536 Ga0207428_100045364 362
230 3300028379 Ga0268266_10155666 Ga0268266_101556662 362
231 3300028794 Ga0307515_10238682 Ga0307515_102386822 362
232 3300030744 Ga0316181_1104238 Ga0316181_11042382 362
233 3300031456 Ga0307513_10183434 Ga0307513_101834342 362
234 3300031548 Ga0307408_100027416 Ga0307408_1000274163 362
235 3300031731 Ga0307405_10035101 Ga0307405_100351012 362
236 3300031731 Ga0307405_10087727 Ga0307405_100877272 362
237 3300031731 Ga0307405_10212820 Ga0307405_102128202 362
238 3300031824 Ga0307413_10004490 Ga0307413_100044904 362
239 3300031852 Ga0307410_10002984 Ga0307410_100029843 362
240 3300031852 Ga0307410_10005107 Ga0307410_100051072 362
241 3300031852 Ga0307410_10044903 Ga0307410_100449033 362
242 3300031852 Ga0307410_10078313 Ga0307410_100783132 362
243 3300031901 Ga0307406_10001795 Ga0307406_100017953 362
244 3300031911 Ga0307412_10001029 Ga0307412_100010293 362
245 3300031911 Ga0307412_10050069 Ga0307412_100500692 362
246 3300031995 Ga0307409_100001261 Ga0307409_1000012616 362
247 3300031995 Ga0307409_100312580 Ga0307409_1003125802 362
248 3300032005 Ga0307411_10062640 Ga0307411_100626403 362
249 3300032005 Ga0307411_10109694 Ga0307411_101096942 362
250 3300032126 Ga0307415_100017682 Ga0307415_1000176823 362
251 3300032126 Ga0307415_100367613 Ga0307415_1003676131 362
252 3300037312 Ga0395899_0038604 Ga0395899_0038604_2048_3139 362
253 3300037418 Ga0395900_0006202 Ga0395900_0006202_6269_7360 362
254 3300037466 Ga0395898_0023403 Ga0395898_0023403_5017_6108 362
255 3300037466 Ga0395898_0103311 Ga0395898_0103311_680_1771 362
256 3300038443 Ga0395901_0006576 Ga0395901_0006576_7045_8148 362
257 3300038443 Ga0395901_0132298 Ga0395901_0132298_1499_2590 362
258 3300038443 Ga0395901_0420206 Ga0395901_0420206_120_1208 362
259 3300041404 Ga0439436_0001880 Ga0439436_0001880_2961_4052 362
260 3300041509 Ga0451843_0231315 Ga0451843_0231315_557_1645 362
261 3300041999 Ga0439433_0006511 Ga0439433_0006511_1326_2417 362
262 3300042002 Ga0439442_000132 Ga0439442_000132_6834_7925 362
263 3300042007 Ga0439449_0002677 Ga0439449_0002677_3164_4255 362
264 3300042007 Ga0439449_0011458 Ga0439449_0011458_283_1374 362
265 3300044693 Ga0466961_0005857 Ga0466961_0005857_1650_2738 362
266 3300044719 Ga0466971_0007517 Ga0466971_0007517_3631_4731 362
267 3300044901 Ga0466960_0014530 Ga0466960_0014530_1916_3013 362
268 3300045836 Ga0466958_0034382 Ga0466958_0034382_284_1372 362
269 3300045836 Ga0466958_0056471 Ga0466958_0056471_109_1206 362
270 3300046455 Ga0495603_0171631 Ga0495603_0171631_61_1149 362
271 3300046492 Ga0495585_0050940 Ga0495585_0050940_786_1874 362
272 3300046535 Ga0495586_0027329 Ga0495586_0027329_310_1401 362
273 3300048904 Ga0496101_0126811 Ga0496101_0126811_470_1561 362
274 3300048906 Ga0496103_0034874 Ga0496103_0034874_1887_2978 362
275 3300048907 Ga0496104_0010456 Ga0496104_0010456_53_1150 362
276 3300048909 Ga0496106_0051957 Ga0496106_0051957_1642_2733 362
277 3300048912 Ga0496109_0008120 Ga0496109_0008120_1361_2458 362
278 3300048912 Ga0496109_0082019 Ga0496109_0082019_528_1616 362
279 3300048913 Ga0496110_0455591 Ga0496110_0455591_32_1123 362
280 3300048914 Ga0496111_0032308 Ga0496111_0032308_2479_3576 362
281 3300048916 Ga0496113_0012072 Ga0496113_0012072_1081_2178 362
282 3300048916 Ga0496113_0099791 Ga0496113_0099791_315_1403 362
283 3300048918 Ga0496115_0078606 Ga0496115_0078606_400_1497 362
284 3300048918 Ga0496115_0287923 Ga0496115_0287923_142_1230 362
285 3300048921 Ga0496118_0015021 Ga0496118_0015021_2137_3234 362
286 3300048923 Ga0496120_0025614 Ga0496120_0025614_231_1328 362
287 3300048925 Ga0496122_0014517 Ga0496122_0014517_3228_4325 362
288 3300048928 Ga0496125_0015589 Ga0496125_0015589_1338_2435 362
289 3300048929 Ga0496126_0053015 Ga0496126_0053015_1041_2141 362
290 3300049537 Ga0501321_000448 Ga0501321_000448_910_2001 362
291 3300049539 Ga0501323_000263 Ga0501323_000263_570_1661 362
292 3300049541 Ga0501325_000128 Ga0501325_000128_57_1148 362
293 3300049569 Ga0501032_0002014 Ga0501032_0002014_8437_9528 362
294 3300049569 Ga0501032_0018187 Ga0501032_0018187_2507_3604 362
295 3300049571 Ga0501034_0000051 Ga0501034_0000051_147193_148284 362
296 3300049571 Ga0501034_0001989 Ga0501034_0001989_23286_24383 362
297 3300049571 Ga0501034_0018422 Ga0501034_0018422_2300_3397 362
298 3300049571 Ga0501034_0026078 Ga0501034_0026078_3603_4700 362
299 3300049572 Ga0501036_0257204 Ga0501036_0257204_35_1138 362
300 3300049573 Ga0501037_0013850 Ga0501037_0013850_739_1830 362
301 3300049574 Ga0501038_0027063 Ga0501038_0027063_2483_3580 362
302 3300049575 Ga0501039_0091455 Ga0501039_0091455_169_1272 362
303 3300049579 Ga0501043_0036343 Ga0501043_0036343_234_1325 362
304 3300049581 Ga0501047_0059629 Ga0501047_0059629_1055_2152 362
305 3300049581 Ga0501047_0191425 Ga0501047_0191425_109_1206 362
306 3300049584 Ga0501068_0056899 Ga0501068_0056899_706_1800 362
307 3300049587 Ga0501071_0248555 Ga0501071_0248555_213_1316 362
308 3300050492 nmdc:mga0yw44_10892_c1 nmdc:mga0yw44_10892_c1_1517_2605 362
309 3300050492 nmdc:mga0yw44_8733_c1 nmdc:mga0yw44_8733_c1_2661_3803 362
310 3300050494 nmdc:mga06z11_145798_c1 nmdc:mga06z11_145798_c1_143_1243 362
311 3300059510 Ga0587090_000422 Ga0587090_000422_492_1583 362
312 3300061719 Ga0466962_0012896 Ga0466962_0012896_1918_3018 362
313 iso_pu_bacteria 2919446982 2919447670 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

25

373

0.97

PF00155

Aminotran_1_2

Aminotransferase class I and II

40

317

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b0d-assembly1.cif.gz_B sugar transaminase from archaeoglobus veneficus 0.9682 14 362
3nys-assembly1.cif.gz_A x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution 0.9649 15 355
3nu7-assembly1.cif.gz_A wbpe, an aminotransferase from pseudomonas aeruginosa involved in o-antigen assembly in complex with the cofactor pmp 0.9635 15 354
8su6-assembly1.cif.gz_B crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) 0.9605 3 357
3frk-assembly1.cif.gz_B x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine 0.9602 15 356
ID Description Score Start End Superfamily
af_Q58466_2_255_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9744 5 242 3.40.640.10
4lc3B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9635 5 241 3.40.640.10
1mdxA01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9576 5 242 3.40.640.10
3bn1B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9575 2 241 3.40.640.10
2ogeD01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9542 15 241 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A2M8Q735-F1-model_v4 Aminotransferase DegT 0.9905 14 150 GO:0000271
GO:0008483
GO:0030170
AF-A0A520K955-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9867 5 233 GO:0000271
GO:0008483
GO:0030170
AF-A0A3D4E1S7-F1-model_v4 deleted 0.9867 71 184
AF-A0A496QY83-F1-model_v4 DegT/DnrJ/EryC1/StrS family aminotransferase 0.9864 10 181 GO:0000271
GO:0008483
GO:0030170
AF-A0A6J6D7U7-F1-model_v4 Unannotated protein 0.9853 56 360 GO:0000271
GO:0008483
GO:0030170

Feature Viewer

pLDDT pTM Quality
96.85 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map