F402422
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 220 | 262 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_8733_c1|nmdc:mga0yw44_8733_c1_2661_3803 |
| Length | 380 |
| Sequence | MTSRPLTDTPEEAFMTDSFIPPAKPVIGDEERAAVDRVMRSGMIAQGPEVAAFEGEFAGLMTSGRTCVAVNSGTSGLHLGLLAAGIGPGDEVIVPSFTFAATANSVALTGATPVFADIELDHFCLDAESVAAAVTERTAAIMPVHLYGHPADMDALQAVADEHGLRVFEDAAQAHLATWRGGRVGTFGDFAMFSLYPTKNMTSGEGGMVSCATDEIARMLRLLRNQGMERQYANEVVGFNARMTDIHAAIGRVQLTKVEAWTERRQANAAFLDAHLEGVVVPPVAEQATHVYHQYTIRVAEERDRIVAAMREEHQVGSGVYYPIPNHELASLTQYAPQGDLPVTQQAAREVISLPVHPSLTDADLERIVNAVNATVAAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 4 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 5 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 6 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 7 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 8 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 9 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 10 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 11 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 12 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 13 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 14 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 15 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 16 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 17 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 18 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 19 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 20 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 21 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 22 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 23 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 24 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 25 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 26 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 27 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 28 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 29 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 30 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 31 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 32 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 33 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 34 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 35 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 36 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 37 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 38 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 39 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 40 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 41 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 42 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 43 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 44 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 45 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 48 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 49 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 50 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 51 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 52 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 53 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 54 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 55 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 56 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 132 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 133 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 134 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 135 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 140 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 141 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 142 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 143 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 144 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 149 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 150 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 151 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 152 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 153 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 154 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 155 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 161 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 176 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 177 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 178 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 179 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 180 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 181 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 184 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 207 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 208 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 209 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 211 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 216 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 217 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 218 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 219 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 220 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.15 |
| Metatranscriptomes | 2.56 |
| Isolates | 16.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.15 |
| Nodule | 0 |
| Rhizoplane | 5.75 |
| Rhizosphere | 77.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10022611 | 3300001979 | Bacteria | 2161 |
| 2 | JGI24739J22299_10009936 | 3300001989 | Bacteria | 3538 |
| 3 | JGI24737J22298_10007637 | 3300001990 | Bacteria | 3643 |
| 4 | JGI24735J21928_10039757 | 3300002067 | Bacteria | 1374 |
| 5 | JGI24738J21930_10018624 | 3300002075 | Bacteria | 1451 |
| 6 | JGI25154J39366_1001041 | 3300002738 | Bacteria | 11091 |
| 7 | rootH2_10003015 | 3300003320 | Bacteria | 8405 |
| 8 | rootH2_10035357 | 3300003320 | Bacteria | 17880 |
| 9 | rootL2_10197030 | 3300003322 | Bacteria | 7444 |
| 10 | Ga0007427J51700_118629 | 3300003559 | Bacteria | 2425 |
| 11 | Ga0006780_1015195 | 3300003735 | Bacteria | 1318 |
| 12 | Ga0070658_10001107 | 3300005327 | Bacteria | 23005 |
| 13 | Ga0070658_10065831 | 3300005327 | Bacteria | 2959 |
| 14 | Ga0070682_100142946 | 3300005337 | Bacteria | 1633 |
| 15 | Ga0070682_100146851 | 3300005337 | Bacteria | 1614 |
| 16 | Ga0068868_100023015 | 3300005338 | Bacteria | 4711 |
| 17 | Ga0070660_100131674 | 3300005339 | Bacteria | 2002 |
| 18 | Ga0070661_100051982 | 3300005344 | Bacteria | 2999 |
| 19 | Ga0070659_100000652 | 3300005366 | Bacteria | 25359 |
| 20 | Ga0070667_100036868 | 3300005367 | Bacteria | 4099 |
| 21 | Ga0070667_100061268 | 3300005367 | Bacteria | 3185 |
| 22 | Ga0070708_100001442 | 3300005445 | Bacteria | 18138 |
| 23 | Ga0070706_100119810 | 3300005467 | Bacteria | 2453 |
| 24 | Ga0070706_100288229 | 3300005467 | Bacteria | 1532 |
| 25 | Ga0070707_100018862 | 3300005468 | Bacteria | 6496 |
| 26 | Ga0070707_100044384 | 3300005468 | Bacteria | 4255 |
| 27 | Ga0070698_100006422 | 3300005471 | Bacteria | 12756 |
| 28 | Ga0070698_100185987 | 3300005471 | Bacteria | 2015 |
| 29 | Ga0070698_100394953 | 3300005471 | Bacteria | 1316 |
| 30 | Ga0070684_100375958 | 3300005535 | Bacteria | 1308 |
| 31 | Ga0070697_100017215 | 3300005536 | Bacteria | 5684 |
| 32 | Ga0070697_100032886 | 3300005536 | Bacteria | 4175 |
| 33 | Ga0070697_100048431 | 3300005536 | Bacteria | 3445 |
| 34 | Ga0068853_100110295 | 3300005539 | Bacteria | 2444 |
| 35 | Ga0070665_100258761 | 3300005548 | Bacteria | 1742 |
| 36 | Ga0070704_100103310 | 3300005549 | Unclassified | 2152 |
| 37 | Ga0068855_100022065 | 3300005563 | Bacteria | 7632 |
| 38 | Ga0068855_100275445 | 3300005563 | Bacteria | 1870 |
| 39 | Ga0068854_100195364 | 3300005578 | Bacteria | 1587 |
| 40 | Ga0068856_100027759 | 3300005614 | Bacteria | 5522 |
| 41 | Ga0068856_100066334 | 3300005614 | Bacteria | 3567 |
| 42 | Ga0068863_100046753 | 3300005841 | Bacteria | 4108 |
| 43 | Ga0081455_10042600 | 3300005937 | Bacteria | 3980 |
| 44 | Ga0081540_1004634 | 3300005983 | Bacteria | 10398 |
| 45 | Ga0075365_10014164 | 3300006038 | Bacteria | 4791 |
| 46 | Ga0075365_10151472 | 3300006038 | Bacteria | 1613 |
| 47 | Ga0075364_10016880 | 3300006051 | Bacteria | 4549 |
| 48 | Ga0075432_10037216 | 3300006058 | Bacteria | 1693 |
| 49 | Ga0075367_10021184 | 3300006178 | Bacteria | 3630 |
| 50 | Ga0075434_100022327 | 3300006871 | Bacteria | 6164 |
| 51 | Ga0068865_100159748 | 3300006881 | Bacteria | 1718 |
| 52 | Ga0105244_10001603 | 3300009036 | Bacteria | 17980 |
| 53 | Ga0105244_10009885 | 3300009036 | Bacteria | 5821 |
| 54 | Ga0105240_10046127 | 3300009093 | Bacteria | 5523 |
| 55 | Ga0105240_10082780 | 3300009093 | Bacteria | 3940 |
| 56 | Ga0105240_10356278 | 3300009093 | Bacteria | 1659 |
| 57 | Ga0105245_10048110 | 3300009098 | Bacteria | 3815 |
| 58 | Ga0114129_10339706 | 3300009147 | Bacteria | 1992 |
| 59 | Ga0105243_10166899 | 3300009148 | Bacteria | 1903 |
| 60 | Ga0105241_10000396 | 3300009174 | Bacteria | 32960 |
| 61 | Ga0105248_10012812 | 3300009177 | Bacteria | 9250 |
| 62 | Ga0105237_10022761 | 3300009545 | Bacteria | 6430 |
| 63 | Ga0105237_10023034 | 3300009545 | Bacteria | 6387 |
| 64 | Ga0105239_10006280 | 3300010375 | Bacteria | 13823 |
| 65 | Ga0105239_10042701 | 3300010375 | Bacteria | 4968 |
| 66 | Ga0105246_10002120 | 3300011119 | Bacteria | 11971 |
| 67 | Ga0105246_10011353 | 3300011119 | Bacteria | 5529 |
| 68 | Ga0105246_10148985 | 3300011119 | Bacteria | 1769 |
| 69 | Ga0157370_10000756 | 3300013104 | Bacteria | 40377 |
| 70 | Ga0157370_10014768 | 3300013104 | Bacteria | 7972 |
| 71 | Ga0157370_10190228 | 3300013104 | Bacteria | 1905 |
| 72 | Ga0157369_10001226 | 3300013105 | Bacteria | 31968 |
| 73 | Ga0157369_10001903 | 3300013105 | Bacteria | 25179 |
| 74 | Ga0157369_10054755 | 3300013105 | Bacteria | 4307 |
| 75 | Ga0157369_10228594 | 3300013105 | Bacteria | 1945 |
| 76 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 77 | Ga0157372_10181281 | 3300013307 | Bacteria | 2438 |
| 78 | Ga0163163_10014604 | 3300014325 | Bacteria | 7224 |
| 79 | Ga0206350_11117376 | 3300020080 | Bacteria | 2936 |
| 80 | Ga0209646_1000134 | 3300025246 | Bacteria | 124492 |
| 81 | Ga0209148_1001104 | 3300025254 | Bacteria | 16176 |
| 82 | Ga0209051_1002713 | 3300025303 | Bacteria | 12316 |
| 83 | Ga0207697_10014399 | 3300025315 | Bacteria | 3280 |
| 84 | Ga0207655_1001640 | 3300025728 | Bacteria | 19855 |
| 85 | Ga0207647_10064188 | 3300025904 | Bacteria | 2232 |
| 86 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 87 | Ga0207705_10083864 | 3300025909 | Bacteria | 2326 |
| 88 | Ga0207684_10033891 | 3300025910 | Unclassified | 4342 |
| 89 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 90 | Ga0207695_10001462 | 3300025913 | Bacteria | 39566 |
| 91 | Ga0207671_10034005 | 3300025914 | Bacteria | 3790 |
| 92 | Ga0207671_10047714 | 3300025914 | Bacteria | 3169 |
| 93 | Ga0207657_10034611 | 3300025919 | Bacteria | 4540 |
| 94 | Ga0207657_10041723 | 3300025919 | Bacteria | 4055 |
| 95 | Ga0207657_10079253 | 3300025919 | Bacteria | 2764 |
| 96 | Ga0207649_10034768 | 3300025920 | Bacteria | 3022 |
| 97 | Ga0207646_10031680 | 3300025922 | Bacteria | 4787 |
| 98 | Ga0207646_10063627 | 3300025922 | Unclassified | 3293 |
| 99 | Ga0207646_10134956 | 3300025922 | Bacteria | 2222 |
| 100 | Ga0207650_10301896 | 3300025925 | Bacteria | 1308 |
| 101 | Ga0207687_10004467 | 3300025927 | Bacteria | 9308 |
| 102 | Ga0207700_10029681 | 3300025928 | Bacteria | 3862 |
| 103 | Ga0207690_10000219 | 3300025932 | Bacteria | 43461 |
| 104 | Ga0207690_10017118 | 3300025932 | Bacteria | 4421 |
| 105 | Ga0207704_10099308 | 3300025938 | Bacteria | 1936 |
| 106 | Ga0207665_10078195 | 3300025939 | Bacteria | 2272 |
| 107 | Ga0207691_10064716 | 3300025940 | Bacteria | 3311 |
| 108 | Ga0207711_10014744 | 3300025941 | Bacteria | 6495 |
| 109 | Ga0207667_10007873 | 3300025949 | Bacteria | 12725 |
| 110 | Ga0207667_10009220 | 3300025949 | Bacteria | 11651 |
| 111 | Ga0207667_10076636 | 3300025949 | Bacteria | 3470 |
| 112 | Ga0207668_10092174 | 3300025972 | Bacteria | 2229 |
| 113 | Ga0207658_10047146 | 3300025986 | Bacteria | 3152 |
| 114 | Ga0207677_10002301 | 3300026023 | Bacteria | 10039 |
| 115 | Ga0207702_10008122 | 3300026078 | Bacteria | 8881 |
| 116 | Ga0207702_10010865 | 3300026078 | Bacteria | 7594 |
| 117 | Ga0207702_10081855 | 3300026078 | Bacteria | 2805 |
| 118 | Ga0207641_10034528 | 3300026088 | Bacteria | 4208 |
| 119 | Ga0207674_10046079 | 3300026116 | Bacteria | 4480 |
| 120 | Ga0207428_10004536 | 3300027907 | Bacteria | 13171 |
| 121 | Ga0268266_10155666 | 3300028379 | Bacteria | 2064 |
| 122 | Ga0307515_10238682 | 3300028794 | Bacteria | 1594 |
| 123 | Ga0316181_1104238 | 3300030744 | Bacteria | 1562 |
| 124 | Ga0307513_10183434 | 3300031456 | Bacteria | 1953 |
| 125 | Ga0307408_100027416 | 3300031548 | Bacteria | 3925 |
| 126 | Ga0307408_100035983 | 3300031548 | Bacteria | 3477 |
| 127 | Ga0307408_100136750 | 3300031548 | Bacteria | 1918 |
| 128 | Ga0307405_10035101 | 3300031731 | Bacteria | 2992 |
| 129 | Ga0307405_10087727 | 3300031731 | Bacteria | 2051 |
| 130 | Ga0307405_10212820 | 3300031731 | Bacteria | 1412 |
| 131 | Ga0307413_10004490 | 3300031824 | Bacteria | 6079 |
| 132 | Ga0307410_10002984 | 3300031852 | Bacteria | 8354 |
| 133 | Ga0307410_10005107 | 3300031852 | Bacteria | 6901 |
| 134 | Ga0307410_10044903 | 3300031852 | Bacteria | 2938 |
| 135 | Ga0307410_10078313 | 3300031852 | Bacteria | 2313 |
| 136 | Ga0307410_10165664 | 3300031852 | Bacteria | 1660 |
| 137 | Ga0307406_10001795 | 3300031901 | Bacteria | 11724 |
| 138 | Ga0307406_10080566 | 3300031901 | Bacteria | 2162 |
| 139 | Ga0307406_10107450 | 3300031901 | Bacteria | 1913 |
| 140 | Ga0307412_10001029 | 3300031911 | Bacteria | 15939 |
| 141 | Ga0307412_10050069 | 3300031911 | Bacteria | 2755 |
| 142 | Ga0307412_10133882 | 3300031911 | Bacteria | 1805 |
| 143 | Ga0307409_100001261 | 3300031995 | Bacteria | 12200 |
| 144 | Ga0307409_100174299 | 3300031995 | Bacteria | 1896 |
| 145 | Ga0307409_100312580 | 3300031995 | Bacteria | 1467 |
| 146 | Ga0307416_100021479 | 3300032002 | Bacteria | 4635 |
| 147 | Ga0307416_100157405 | 3300032002 | Bacteria | 2094 |
| 148 | Ga0307414_10136623 | 3300032004 | Bacteria | 1913 |
| 149 | Ga0307411_10062640 | 3300032005 | Bacteria | 2482 |
| 150 | Ga0307411_10109694 | 3300032005 | Bacteria | 1972 |
| 151 | Ga0307411_10166513 | 3300032005 | Bacteria | 1657 |
| 152 | Ga0307415_100017682 | 3300032126 | Bacteria | 4280 |
| 153 | Ga0307415_100367613 | 3300032126 | Bacteria | 1217 |
| 154 | Ga0395899_0038604 | 3300037312 | Bacteria | 3576 |
| 155 | Ga0395900_0006202 | 3300037418 | Bacteria | 12485 |
| 156 | Ga0395900_0055505 | 3300037418 | Bacteria | 4079 |
| 157 | Ga0395898_0023403 | 3300037466 | Bacteria | 6243 |
| 158 | Ga0395898_0103311 | 3300037466 | Bacteria | 2734 |
| 159 | Ga0395901_0006576 | 3300038443 | Bacteria | 11749 |
| 160 | Ga0395901_0006746 | 3300038443 | Bacteria | 11594 |
| 161 | Ga0395901_0115719 | 3300038443 | Bacteria | 2817 |
| 162 | Ga0395901_0116982 | 3300038443 | Bacteria | 2801 |
| 163 | Ga0395901_0132298 | 3300038443 | Bacteria | 2621 |
| 164 | Ga0395901_0174716 | 3300038443 | Bacteria | 2253 |
| 165 | Ga0395901_0420206 | 3300038443 | Bacteria | 1371 |
| 166 | Ga0436363_1337632 | 3300039450 | Unclassified | 1421 |
| 167 | Ga0439436_0001880 | 3300041404 | Bacteria | 6198 |
| 168 | Ga0451843_0231315 | 3300041509 | Bacteria | 2144 |
| 169 | Ga0439433_0006511 | 3300041999 | Bacteria | 2514 |
| 170 | Ga0439442_000132 | 3300042002 | Bacteria | 18441 |
| 171 | Ga0439449_0002677 | 3300042007 | Bacteria | 6939 |
| 172 | Ga0439449_0011458 | 3300042007 | Bacteria | 3336 |
| 173 | Ga0466969_0037199 | 3300044656 | Bacteria | 2456 |
| 174 | Ga0466961_0005857 | 3300044693 | Bacteria | 7788 |
| 175 | Ga0466961_0132627 | 3300044693 | Bacteria | 1561 |
| 176 | Ga0466963_0012089 | 3300044694 | Bacteria | 5275 |
| 177 | Ga0466971_0007517 | 3300044719 | Bacteria | 4747 |
| 178 | Ga0466971_0015638 | 3300044719 | Bacteria | 3342 |
| 179 | Ga0466970_0173971 | 3300044765 | Bacteria | 1194 |
| 180 | Ga0466960_0014530 | 3300044901 | Bacteria | 3373 |
| 181 | Ga0466958_0000523 | 3300045836 | Bacteria | 16184 |
| 182 | Ga0466958_0034382 | 3300045836 | Bacteria | 3024 |
| 183 | Ga0466958_0056471 | 3300045836 | Bacteria | 2385 |
| 184 | Ga0466967_0014388 | 3300045976 | Bacteria | 6161 |
| 185 | Ga0466967_0082716 | 3300045976 | Bacteria | 2902 |
| 186 | Ga0495603_0171631 | 3300046455 | Bacteria | 1256 |
| 187 | Ga0495585_0050940 | 3300046492 | Bacteria | 2296 |
| 188 | Ga0495594_0009139 | 3300046499 | Bacteria | 5114 |
| 189 | Ga0495586_0027329 | 3300046535 | Bacteria | 3053 |
| 190 | Ga0495669_0019595 | 3300046684 | Bacteria | 2921 |
| 191 | Ga0496100_0027226 | 3300048903 | Bacteria | 3514 |
| 192 | Ga0496101_0093860 | 3300048904 | Bacteria | 2235 |
| 193 | Ga0496101_0126811 | 3300048904 | Bacteria | 1935 |
| 194 | Ga0496102_0004582 | 3300048905 | Bacteria | 11683 |
| 195 | Ga0496103_0012673 | 3300048906 | Bacteria | 5002 |
| 196 | Ga0496103_0034874 | 3300048906 | Bacteria | 3078 |
| 197 | Ga0496104_0010456 | 3300048907 | Bacteria | 8288 |
| 198 | Ga0496106_0051957 | 3300048909 | Bacteria | 3091 |
| 199 | Ga0496109_0008120 | 3300048912 | Bacteria | 8899 |
| 200 | Ga0496109_0082019 | 3300048912 | Bacteria | 2972 |
| 201 | Ga0496110_0455591 | 3300048913 | Bacteria | 1166 |
| 202 | Ga0496111_0032308 | 3300048914 | Bacteria | 3731 |
| 203 | Ga0496113_0012072 | 3300048916 | Bacteria | 5795 |
| 204 | Ga0496113_0099791 | 3300048916 | Bacteria | 2249 |
| 205 | Ga0496114_0016350 | 3300048917 | Bacteria | 5976 |
| 206 | Ga0496114_0285932 | 3300048917 | Bacteria | 1454 |
| 207 | Ga0496115_0078606 | 3300048918 | Bacteria | 2684 |
| 208 | Ga0496115_0287923 | 3300048918 | Bacteria | 1348 |
| 209 | Ga0496117_0004661 | 3300048920 | Bacteria | 14917 |
| 210 | Ga0496118_0015021 | 3300048921 | Bacteria | 7199 |
| 211 | Ga0496118_0083450 | 3300048921 | Bacteria | 2234 |
| 212 | Ga0496119_0137842 | 3300048922 | Bacteria | 1321 |
| 213 | Ga0496120_0022376 | 3300048923 | Bacteria | 3977 |
| 214 | Ga0496120_0025614 | 3300048923 | Bacteria | 3658 |
| 215 | Ga0496122_0014517 | 3300048925 | Bacteria | 7604 |
| 216 | Ga0496125_0015589 | 3300048928 | Bacteria | 7338 |
| 217 | Ga0496125_0208779 | 3300048928 | Bacteria | 1270 |
| 218 | Ga0496126_0053015 | 3300048929 | Bacteria | 3682 |
| 219 | Ga0501315_005310 | 3300049531 | Bacteria | 1390 |
| 220 | Ga0501321_000448 | 3300049537 | Bacteria | 2646 |
| 221 | Ga0501323_000263 | 3300049539 | Bacteria | 3547 |
| 222 | Ga0501325_000128 | 3300049541 | Bacteria | 2699 |
| 223 | Ga0501032_0002014 | 3300049569 | Bacteria | 16010 |
| 224 | Ga0501032_0018187 | 3300049569 | Bacteria | 4926 |
| 225 | Ga0501033_0100643 | 3300049570 | Bacteria | 2109 |
| 226 | Ga0501034_0000051 | 3300049571 | Bacteria | 210960 |
| 227 | Ga0501034_0001989 | 3300049571 | Bacteria | 25870 |
| 228 | Ga0501034_0002933 | 3300049571 | Bacteria | 19772 |
| 229 | Ga0501034_0018422 | 3300049571 | Bacteria | 7159 |
| 230 | Ga0501034_0026078 | 3300049571 | Bacteria | 5952 |
| 231 | Ga0501036_0214544 | 3300049572 | Bacteria | 1617 |
| 232 | Ga0501036_0257204 | 3300049572 | Bacteria | 1463 |
| 233 | Ga0501037_0013850 | 3300049573 | Bacteria | 5943 |
| 234 | Ga0501037_0203159 | 3300049573 | Bacteria | 1400 |
| 235 | Ga0501038_0003918 | 3300049574 | Bacteria | 13843 |
| 236 | Ga0501038_0027063 | 3300049574 | Bacteria | 5105 |
| 237 | Ga0501039_0091455 | 3300049575 | Bacteria | 2371 |
| 238 | Ga0501040_0096822 | 3300049576 | Bacteria | 2055 |
| 239 | Ga0501043_0036343 | 3300049579 | Bacteria | 3874 |
| 240 | Ga0501043_0215957 | 3300049579 | Bacteria | 1485 |
| 241 | Ga0501046_0008494 | 3300049580 | Bacteria | 8943 |
| 242 | Ga0501046_0114223 | 3300049580 | Bacteria | 2060 |
| 243 | Ga0501047_0059629 | 3300049581 | Bacteria | 3684 |
| 244 | Ga0501047_0191425 | 3300049581 | Bacteria | 1909 |
| 245 | Ga0501068_0056899 | 3300049584 | Bacteria | 2371 |
| 246 | Ga0501071_0013488 | 3300049587 | Bacteria | 5570 |
| 247 | Ga0501071_0248555 | 3300049587 | Bacteria | 1342 |
| 248 | Ga0501083_0002463 | 3300049744 | Bacteria | 12684 |
| 249 | Ga0501083_0010167 | 3300049744 | Bacteria | 6630 |
| 250 | Ga0501035_0005068 | 3300049822 | Bacteria | 12485 |
| 251 | nmdc:mga00v17_86970_c1 | 3300050491 | Bacteria | 1959 |
| 252 | nmdc:mga0yw44_10892_c1 | 3300050492 | Bacteria | 4662 |
| 253 | nmdc:mga0yw44_8733_c1 | 3300050492 | Bacteria | 5069 |
| 254 | nmdc:mga06z11_145798_c1 | 3300050494 | Bacteria | 1342 |
| 255 | nmdc:mga08x19_71160_c1 | 3300050514 | Unclassified | 2267 |
| 256 | Ga0500635_0000004 | 3300053080 | Bacteria | 210675 |
| 257 | Ga0500568_0003482 | 3300053139 | Bacteria | 8750 |
| 258 | Ga0500568_0007381 | 3300053139 | Bacteria | 5397 |
| 259 | Ga0501084_0074547 | 3300054114 | Bacteria | 2842 |
| 260 | Ga0587090_000422 | 3300059510 | Bacteria | 3468 |
| 261 | Ga0501082_0002655 | 3300060353 | Bacteria | 15637 |
| 262 | Ga0466962_0012896 | 3300061719 | Bacteria | 4020 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050491 | nmdc:mga00v17_86970_c1 | nmdc:mga00v17_86970_c1_13_948 | 308 |
| 2 | 3300046684 | Ga0495669_0019595 | Ga0495669_0019595_1765_2763 | 330 |
| 3 | 3300048923 | Ga0496120_0022376 | Ga0496120_0022376_2931_3935 | 333 |
| 4 | 3300049531 | Ga0501315_005310 | Ga0501315_005310_361_1368 | 335 |
| 5 | 3300049572 | Ga0501036_0214544 | Ga0501036_0214544_573_1589 | 335 |
| 6 | 3300049580 | Ga0501046_0114223 | Ga0501046_0114223_265_1296 | 336 |
| 7 | 3300048921 | Ga0496118_0083450 | Ga0496118_0083450_1070_2182 | 340 |
| 8 | 3300048922 | Ga0496119_0137842 | Ga0496119_0137842_171_1283 | 340 |
| 9 | 3300006871 | Ga0075434_100022327 | Ga0075434_1000223273 | 343 |
| 10 | 3300009147 | Ga0114129_10339706 | Ga0114129_103397062 | 343 |
| 11 | 3300005467 | Ga0070706_100119810 | Ga0070706_1001198102 | 345 |
| 12 | 3300005535 | Ga0070684_100375958 | Ga0070684_1003759582 | 348 |
| 13 | 3300005536 | Ga0070697_100032886 | Ga0070697_1000328862 | 348 |
| 14 | 3300025939 | Ga0207665_10078195 | Ga0207665_100781952 | 348 |
| 15 | 3300038443 | Ga0395901_0006746 | Ga0395901_0006746_7102_8190 | 348 |
| 16 | 3300049571 | Ga0501034_0002933 | Ga0501034_0002933_8559_9638 | 349 |
| 17 | 3300049573 | Ga0501037_0203159 | Ga0501037_0203159_52_1131 | 349 |
| 18 | 3300049574 | Ga0501038_0003918 | Ga0501038_0003918_2108_3187 | 349 |
| 19 | 3300049580 | Ga0501046_0008494 | Ga0501046_0008494_1931_3010 | 349 |
| 20 | 3300049744 | Ga0501083_0002463 | Ga0501083_0002463_8168_9247 | 349 |
| 21 | 3300049822 | Ga0501035_0005068 | Ga0501035_0005068_8120_9199 | 349 |
| 22 | 3300054114 | Ga0501084_0074547 | Ga0501084_0074547_1046_2125 | 349 |
| 23 | 3300060353 | Ga0501082_0002655 | Ga0501082_0002655_9170_10249 | 349 |
| 24 | 3300013105 | Ga0157369_10228594 | Ga0157369_102285942 | 350 |
| 25 | 3300038443 | Ga0395901_0174716 | Ga0395901_0174716_799_1887 | 350 |
| 26 | 3300013105 | Ga0157369_10001903 | Ga0157369_1000190313 | 352 |
| 27 | 3300031548 | Ga0307408_100136750 | Ga0307408_1001367501 | 352 |
| 28 | 3300031852 | Ga0307410_10165664 | Ga0307410_101656642 | 352 |
| 29 | 3300031901 | Ga0307406_10107450 | Ga0307406_101074502 | 352 |
| 30 | 3300031911 | Ga0307412_10133882 | Ga0307412_101338822 | 352 |
| 31 | 3300031995 | Ga0307409_100174299 | Ga0307409_1001742992 | 352 |
| 32 | 3300032005 | Ga0307411_10166513 | Ga0307411_101665132 | 352 |
| 33 | 3300038443 | Ga0395901_0115719 | Ga0395901_0115719_290_1378 | 353 |
| 34 | 3300048903 | Ga0496100_0027226 | Ga0496100_0027226_1507_2595 | 353 |
| 35 | 3300048904 | Ga0496101_0093860 | Ga0496101_0093860_1044_2132 | 353 |
| 36 | 3300048905 | Ga0496102_0004582 | Ga0496102_0004582_903_1991 | 353 |
| 37 | 3300048906 | Ga0496103_0012673 | Ga0496103_0012673_1412_2500 | 353 |
| 38 | 3300048917 | Ga0496114_0016350 | Ga0496114_0016350_4248_5336 | 353 |
| 39 | 3300048920 | Ga0496117_0004661 | Ga0496117_0004661_6555_7652 | 353 |
| 40 | 3300049576 | Ga0501040_0096822 | Ga0501040_0096822_791_1882 | 353 |
| 41 | 3300053080 | Ga0500635_0000004 | Ga0500635_0000004_129187_130284 | 353 |
| 42 | 3300003322 | rootL2_10197030 | rootL2_101970305 | 354 |
| 43 | 3300025928 | Ga0207700_10029681 | Ga0207700_100296811 | 354 |
| 44 | 3300031548 | Ga0307408_100035983 | Ga0307408_1000359833 | 354 |
| 45 | 3300031901 | Ga0307406_10080566 | Ga0307406_100805662 | 354 |
| 46 | 3300032002 | Ga0307416_100021479 | Ga0307416_1000214793 | 354 |
| 47 | 3300032004 | Ga0307414_10136623 | Ga0307414_101366232 | 354 |
| 48 | 3300044765 | Ga0466970_0173971 | Ga0466970_0173971_17_1141 | 354 |
| 49 | 3300045976 | Ga0466967_0082716 | Ga0466967_0082716_624_1739 | 354 |
| 50 | iso_pu_bacteria | 2515154155 | 2515857049 | 354 |
| 51 | iso_pu_bacteria | 2731639228 | 2731908766 | 354 |
| 52 | iso_pu_bacteria | 2799112218 | 2799184800 | 354 |
| 53 | 3300049570 | Ga0501033_0100643 | Ga0501033_0100643_771_1865 | 355 |
| 54 | 3300049579 | Ga0501043_0215957 | Ga0501043_0215957_359_1453 | 355 |
| 55 | 3300049744 | Ga0501083_0010167 | Ga0501083_0010167_994_2088 | 355 |
| 56 | 3300005536 | Ga0070697_100048431 | Ga0070697_1000484314 | 356 |
| 57 | 3300006881 | Ga0068865_100159748 | Ga0068865_1001597482 | 356 |
| 58 | 3300025938 | Ga0207704_10099308 | Ga0207704_100993083 | 356 |
| 59 | 3300039450 | Ga0436363_1337632 | Ga0436363_1337632_125_1249 | 356 |
| 60 | 3300044656 | Ga0466969_0037199 | Ga0466969_0037199_16_1104 | 356 |
| 61 | 3300044693 | Ga0466961_0132627 | Ga0466961_0132627_83_1171 | 356 |
| 62 | 3300050514 | nmdc:mga08x19_71160_c1 | nmdc:mga08x19_71160_c1_838_1935 | 356 |
| 63 | 3300005327 | Ga0070658_10001107 | Ga0070658_1000110717 | 357 |
| 64 | 3300005339 | Ga0070660_100131674 | Ga0070660_1001316742 | 357 |
| 65 | 3300005563 | Ga0068855_100022065 | Ga0068855_1000220652 | 357 |
| 66 | 3300013104 | Ga0157370_10014768 | Ga0157370_100147685 | 357 |
| 67 | 3300025909 | Ga0207705_10000001 | Ga0207705_100000011573 | 357 |
| 68 | 3300025949 | Ga0207667_10076636 | Ga0207667_100766363 | 357 |
| 69 | 3300037418 | Ga0395900_0055505 | Ga0395900_0055505_2754_3830 | 357 |
| 70 | 3300038443 | Ga0395901_0116982 | Ga0395901_0116982_264_1340 | 357 |
| 71 | 3300048928 | Ga0496125_0208779 | Ga0496125_0208779_108_1184 | 357 |
| 72 | 3300049587 | Ga0501071_0013488 | Ga0501071_0013488_1205_2281 | 357 |
| 73 | 3300053139 | Ga0500568_0003482 | Ga0500568_0003482_4623_5699 | 357 |
| 74 | 3300053139 | Ga0500568_0007381 | Ga0500568_0007381_2782_3855 | 357 |
| 75 | iso_pu_bacteria | 2643221567 | 2643852853 | 357 |
| 76 | iso_pu_bacteria | 2643221624 | 2644135362 | 357 |
| 77 | iso_pu_bacteria | 2675903058 | 2676477445 | 357 |
| 78 | iso_pu_bacteria | 2818991458 | 2819666894 | 357 |
| 79 | iso_pu_bacteria | 2827628540 | 2827634702 | 357 |
| 80 | iso_pu_bacteria | 2887443736 | 2887445923 | 357 |
| 81 | 3300005327 | Ga0070658_10065831 | Ga0070658_100658313 | 358 |
| 82 | 3300005337 | Ga0070682_100142946 | Ga0070682_1001429462 | 358 |
| 83 | 3300005338 | Ga0068868_100023015 | Ga0068868_1000230155 | 358 |
| 84 | 3300005366 | Ga0070659_100000652 | Ga0070659_10000065218 | 358 |
| 85 | 3300005367 | Ga0070667_100036868 | Ga0070667_1000368684 | 358 |
| 86 | 3300005445 | Ga0070708_100001442 | Ga0070708_1000014426 | 358 |
| 87 | 3300005468 | Ga0070707_100018862 | Ga0070707_1000188625 | 358 |
| 88 | 3300005471 | Ga0070698_100185987 | Ga0070698_1001859872 | 358 |
| 89 | 3300005471 | Ga0070698_100394953 | Ga0070698_1003949532 | 358 |
| 90 | 3300005549 | Ga0070704_100103310 | Ga0070704_1001033102 | 358 |
| 91 | 3300006038 | Ga0075365_10151472 | Ga0075365_101514722 | 358 |
| 92 | 3300009545 | Ga0105237_10023034 | Ga0105237_100230342 | 358 |
| 93 | 3300013105 | Ga0157369_10001226 | Ga0157369_1000122625 | 358 |
| 94 | 3300025909 | Ga0207705_10083864 | Ga0207705_100838642 | 358 |
| 95 | 3300025914 | Ga0207671_10034005 | Ga0207671_100340053 | 358 |
| 96 | 3300025919 | Ga0207657_10041723 | Ga0207657_100417236 | 358 |
| 97 | 3300025932 | Ga0207690_10000219 | Ga0207690_1000021934 | 358 |
| 98 | 3300025932 | Ga0207690_10017118 | Ga0207690_100171182 | 358 |
| 99 | 3300025986 | Ga0207658_10047146 | Ga0207658_100471463 | 358 |
| 100 | 3300026023 | Ga0207677_10002301 | Ga0207677_1000230110 | 358 |
| 101 | 3300048917 | Ga0496114_0285932 | Ga0496114_0285932_109_1197 | 358 |
| 102 | iso_pu_bacteria | 2643221597 | 2643996521 | 358 |
| 103 | iso_pu_bacteria | 2747842429 | 2747951956 | 358 |
| 104 | iso_pu_bacteria | 2811994882 | 2812375612 | 358 |
| 105 | iso_pu_bacteria | 2870801768 | 2870802749 | 358 |
| 106 | iso_pu_bacteria | 2897561785 | 2897564091 | 358 |
| 107 | iso_pu_bacteria | 2919395869 | 2919396771 | 358 |
| 108 | iso_pu_bacteria | 2928090899 | 2928091140 | 358 |
| 109 | iso_pu_bacteria | 2945968032 | 2945970822 | 358 |
| 110 | iso_pu_bacteria | 2945968032 | 2945971263 | 358 |
| 111 | iso_pu_bacteria | 2946033335 | 2946034321 | 358 |
| 112 | iso_pu_bacteria | 2946080515 | 2946081476 | 358 |
| 113 | iso_pu_bacteria | 8004182704 | 8004185931 | 358 |
| 114 | iso_pu_bacteria | 8004212874 | 8004213553 | 358 |
| 115 | 3300005468 | Ga0070707_100044384 | Ga0070707_1000443843 | 359 |
| 116 | 3300005471 | Ga0070698_100006422 | Ga0070698_1000064229 | 359 |
| 117 | 3300005536 | Ga0070697_100017215 | Ga0070697_1000172154 | 359 |
| 118 | 3300005563 | Ga0068855_100275445 | Ga0068855_1002754452 | 359 |
| 119 | 3300025910 | Ga0207684_10033891 | Ga0207684_100338912 | 359 |
| 120 | 3300025922 | Ga0207646_10031680 | Ga0207646_100316802 | 359 |
| 121 | 3300025922 | Ga0207646_10063627 | Ga0207646_100636272 | 359 |
| 122 | 3300025922 | Ga0207646_10134956 | Ga0207646_101349562 | 359 |
| 123 | 3300044694 | Ga0466963_0012089 | Ga0466963_0012089_2659_3747 | 359 |
| 124 | 3300044719 | Ga0466971_0015638 | Ga0466971_0015638_2187_3275 | 359 |
| 125 | 3300045836 | Ga0466958_0000523 | Ga0466958_0000523_3343_4431 | 359 |
| 126 | 3300045976 | Ga0466967_0014388 | Ga0466967_0014388_2716_3804 | 359 |
| 127 | 3300046499 | Ga0495594_0009139 | Ga0495594_0009139_2915_4024 | 359 |
| 128 | iso_pu_bacteria | 2537561592 | 2537898102 | 359 |
| 129 | iso_pu_bacteria | 2643221613 | 2644083661 | 359 |
| 130 | iso_pu_bacteria | 2643221632 | 2644180970 | 359 |
| 131 | iso_pu_bacteria | 2643221635 | 2644197069 | 359 |
| 132 | iso_pu_bacteria | 2811994874 | 2812333974 | 359 |
| 133 | iso_pu_bacteria | 2837268691 | 2837269290 | 359 |
| 134 | iso_pu_bacteria | 2839986021 | 2839987574 | 359 |
| 135 | iso_pu_bacteria | 2857740372 | 2857741355 | 359 |
| 136 | iso_pu_bacteria | 2895660088 | 2895663396 | 359 |
| 137 | iso_pu_bacteria | 2904497146 | 2904499829 | 359 |
| 138 | iso_pu_bacteria | 2904776348 | 2904776602 | 359 |
| 139 | iso_pu_bacteria | 2910809715 | 2910810684 | 359 |
| 140 | iso_pu_bacteria | 2919034639 | 2919037725 | 359 |
| 141 | iso_pu_bacteria | 2919059106 | 2919061728 | 359 |
| 142 | iso_pu_bacteria | 2919391150 | 2919391412 | 359 |
| 143 | iso_pu_bacteria | 2919538618 | 2919542135 | 359 |
| 144 | iso_pu_bacteria | 2932426870 | 2932429207 | 359 |
| 145 | iso_pu_bacteria | 2932431166 | 2932433153 | 359 |
| 146 | iso_pu_bacteria | 2933418574 | 2933420691 | 359 |
| 147 | iso_pu_bacteria | 2935890801 | 2935891548 | 359 |
| 148 | iso_pu_bacteria | 2939647034 | 2939648894 | 359 |
| 149 | iso_pu_bacteria | 2939674588 | 2939676096 | 359 |
| 150 | iso_pu_bacteria | 2945941187 | 2945942423 | 359 |
| 151 | iso_pu_bacteria | 8004021418 | 8004023430 | 359 |
| 152 | iso_pu_bacteria | 8004025490 | 8004026487 | 359 |
| 153 | 3300003320 | rootH2_10003015 | rootH2_100030155 | 360 |
| 154 | 3300005467 | Ga0070706_100288229 | Ga0070706_1002882291 | 360 |
| 155 | 3300005614 | Ga0068856_100027759 | Ga0068856_1000277592 | 360 |
| 156 | 3300009093 | Ga0105240_10046127 | Ga0105240_100461275 | 360 |
| 157 | 3300010375 | Ga0105239_10042701 | Ga0105239_100427013 | 360 |
| 158 | 3300026078 | Ga0207702_10010865 | Ga0207702_100108653 | 360 |
| 159 | iso_pu_bacteria | 2643221615 | 2644092713 | 360 |
| 160 | iso_pu_bacteria | 2643221657 | 2644322326 | 360 |
| 161 | 3300010375 | Ga0105239_10006280 | Ga0105239_100062809 | 361 |
| 162 | 3300032002 | Ga0307416_100157405 | Ga0307416_1001574052 | 361 |
| 163 | iso_pu_bacteria | 8002811521 | 8002813294 | 361 |
| 164 | 3300001979 | JGI24740J21852_10022611 | JGI24740J21852_100226113 | 362 |
| 165 | 3300001989 | JGI24739J22299_10009936 | JGI24739J22299_100099363 | 362 |
| 166 | 3300001990 | JGI24737J22298_10007637 | JGI24737J22298_100076373 | 362 |
| 167 | 3300002067 | JGI24735J21928_10039757 | JGI24735J21928_100397572 | 362 |
| 168 | 3300002075 | JGI24738J21930_10018624 | JGI24738J21930_100186241 | 362 |
| 169 | 3300002738 | JGI25154J39366_1001041 | JGI25154J39366_10010417 | 362 |
| 170 | 3300003320 | rootH2_10035357 | rootH2_100353573 | 362 |
| 171 | 3300003559 | Ga0007427J51700_118629 | Ga0007427J51700_1186292 | 362 |
| 172 | 3300003735 | Ga0006780_1015195 | Ga0006780_10151951 | 362 |
| 173 | 3300005337 | Ga0070682_100146851 | Ga0070682_1001468511 | 362 |
| 174 | 3300005344 | Ga0070661_100051982 | Ga0070661_1000519822 | 362 |
| 175 | 3300005367 | Ga0070667_100061268 | Ga0070667_1000612682 | 362 |
| 176 | 3300005539 | Ga0068853_100110295 | Ga0068853_1001102951 | 362 |
| 177 | 3300005548 | Ga0070665_100258761 | Ga0070665_1002587612 | 362 |
| 178 | 3300005578 | Ga0068854_100195364 | Ga0068854_1001953642 | 362 |
| 179 | 3300005614 | Ga0068856_100066334 | Ga0068856_1000663343 | 362 |
| 180 | 3300005841 | Ga0068863_100046753 | Ga0068863_1000467533 | 362 |
| 181 | 3300005937 | Ga0081455_10042600 | Ga0081455_100426003 | 362 |
| 182 | 3300005983 | Ga0081540_1004634 | Ga0081540_10046345 | 362 |
| 183 | 3300006038 | Ga0075365_10014164 | Ga0075365_100141643 | 362 |
| 184 | 3300006051 | Ga0075364_10016880 | Ga0075364_100168802 | 362 |
| 185 | 3300006058 | Ga0075432_10037216 | Ga0075432_100372162 | 362 |
| 186 | 3300006178 | Ga0075367_10021184 | Ga0075367_100211842 | 362 |
| 187 | 3300009036 | Ga0105244_10001603 | Ga0105244_1000160312 | 362 |
| 188 | 3300009036 | Ga0105244_10009885 | Ga0105244_100098853 | 362 |
| 189 | 3300009093 | Ga0105240_10082780 | Ga0105240_100827802 | 362 |
| 190 | 3300009093 | Ga0105240_10356278 | Ga0105240_103562782 | 362 |
| 191 | 3300009098 | Ga0105245_10048110 | Ga0105245_100481104 | 362 |
| 192 | 3300009148 | Ga0105243_10166899 | Ga0105243_101668992 | 362 |
| 193 | 3300009174 | Ga0105241_10000396 | Ga0105241_1000039625 | 362 |
| 194 | 3300009177 | Ga0105248_10012812 | Ga0105248_100128125 | 362 |
| 195 | 3300009545 | Ga0105237_10022761 | Ga0105237_100227615 | 362 |
| 196 | 3300011119 | Ga0105246_10002120 | Ga0105246_100021207 | 362 |
| 197 | 3300011119 | Ga0105246_10011353 | Ga0105246_100113532 | 362 |
| 198 | 3300011119 | Ga0105246_10148985 | Ga0105246_101489852 | 362 |
| 199 | 3300013104 | Ga0157370_10000756 | Ga0157370_100007565 | 362 |
| 200 | 3300013104 | Ga0157370_10190228 | Ga0157370_101902282 | 362 |
| 201 | 3300013105 | Ga0157369_10054755 | Ga0157369_100547554 | 362 |
| 202 | 3300013250 | Ga0171462_1001 | Ga0171462_1001337 | 362 |
| 203 | 3300013307 | Ga0157372_10181281 | Ga0157372_101812812 | 362 |
| 204 | 3300014325 | Ga0163163_10014604 | Ga0163163_100146043 | 362 |
| 205 | 3300020080 | Ga0206350_11117376 | Ga0206350_111173763 | 362 |
| 206 | 3300025246 | Ga0209646_1000134 | Ga0209646_100013413 | 362 |
| 207 | 3300025254 | Ga0209148_1001104 | Ga0209148_100110412 | 362 |
| 208 | 3300025303 | Ga0209051_1002713 | Ga0209051_10027137 | 362 |
| 209 | 3300025315 | Ga0207697_10014399 | Ga0207697_100143993 | 362 |
| 210 | 3300025728 | Ga0207655_1001640 | Ga0207655_10016403 | 362 |
| 211 | 3300025904 | Ga0207647_10064188 | Ga0207647_100641881 | 362 |
| 212 | 3300025911 | Ga0207654_10000001 | Ga0207654_100000011214 | 362 |
| 213 | 3300025913 | Ga0207695_10001462 | Ga0207695_1000146220 | 362 |
| 214 | 3300025914 | Ga0207671_10047714 | Ga0207671_100477143 | 362 |
| 215 | 3300025919 | Ga0207657_10034611 | Ga0207657_100346114 | 362 |
| 216 | 3300025919 | Ga0207657_10079253 | Ga0207657_100792533 | 362 |
| 217 | 3300025920 | Ga0207649_10034768 | Ga0207649_100347683 | 362 |
| 218 | 3300025925 | Ga0207650_10301896 | Ga0207650_103018962 | 362 |
| 219 | 3300025927 | Ga0207687_10004467 | Ga0207687_100044675 | 362 |
| 220 | 3300025940 | Ga0207691_10064716 | Ga0207691_100647162 | 362 |
| 221 | 3300025941 | Ga0207711_10014744 | Ga0207711_100147444 | 362 |
| 222 | 3300025949 | Ga0207667_10007873 | Ga0207667_100078734 | 362 |
| 223 | 3300025949 | Ga0207667_10009220 | Ga0207667_1000922010 | 362 |
| 224 | 3300025972 | Ga0207668_10092174 | Ga0207668_100921742 | 362 |
| 225 | 3300026078 | Ga0207702_10008122 | Ga0207702_100081223 | 362 |
| 226 | 3300026078 | Ga0207702_10081855 | Ga0207702_100818553 | 362 |
| 227 | 3300026088 | Ga0207641_10034528 | Ga0207641_100345283 | 362 |
| 228 | 3300026116 | Ga0207674_10046079 | Ga0207674_100460795 | 362 |
| 229 | 3300027907 | Ga0207428_10004536 | Ga0207428_100045364 | 362 |
| 230 | 3300028379 | Ga0268266_10155666 | Ga0268266_101556662 | 362 |
| 231 | 3300028794 | Ga0307515_10238682 | Ga0307515_102386822 | 362 |
| 232 | 3300030744 | Ga0316181_1104238 | Ga0316181_11042382 | 362 |
| 233 | 3300031456 | Ga0307513_10183434 | Ga0307513_101834342 | 362 |
| 234 | 3300031548 | Ga0307408_100027416 | Ga0307408_1000274163 | 362 |
| 235 | 3300031731 | Ga0307405_10035101 | Ga0307405_100351012 | 362 |
| 236 | 3300031731 | Ga0307405_10087727 | Ga0307405_100877272 | 362 |
| 237 | 3300031731 | Ga0307405_10212820 | Ga0307405_102128202 | 362 |
| 238 | 3300031824 | Ga0307413_10004490 | Ga0307413_100044904 | 362 |
| 239 | 3300031852 | Ga0307410_10002984 | Ga0307410_100029843 | 362 |
| 240 | 3300031852 | Ga0307410_10005107 | Ga0307410_100051072 | 362 |
| 241 | 3300031852 | Ga0307410_10044903 | Ga0307410_100449033 | 362 |
| 242 | 3300031852 | Ga0307410_10078313 | Ga0307410_100783132 | 362 |
| 243 | 3300031901 | Ga0307406_10001795 | Ga0307406_100017953 | 362 |
| 244 | 3300031911 | Ga0307412_10001029 | Ga0307412_100010293 | 362 |
| 245 | 3300031911 | Ga0307412_10050069 | Ga0307412_100500692 | 362 |
| 246 | 3300031995 | Ga0307409_100001261 | Ga0307409_1000012616 | 362 |
| 247 | 3300031995 | Ga0307409_100312580 | Ga0307409_1003125802 | 362 |
| 248 | 3300032005 | Ga0307411_10062640 | Ga0307411_100626403 | 362 |
| 249 | 3300032005 | Ga0307411_10109694 | Ga0307411_101096942 | 362 |
| 250 | 3300032126 | Ga0307415_100017682 | Ga0307415_1000176823 | 362 |
| 251 | 3300032126 | Ga0307415_100367613 | Ga0307415_1003676131 | 362 |
| 252 | 3300037312 | Ga0395899_0038604 | Ga0395899_0038604_2048_3139 | 362 |
| 253 | 3300037418 | Ga0395900_0006202 | Ga0395900_0006202_6269_7360 | 362 |
| 254 | 3300037466 | Ga0395898_0023403 | Ga0395898_0023403_5017_6108 | 362 |
| 255 | 3300037466 | Ga0395898_0103311 | Ga0395898_0103311_680_1771 | 362 |
| 256 | 3300038443 | Ga0395901_0006576 | Ga0395901_0006576_7045_8148 | 362 |
| 257 | 3300038443 | Ga0395901_0132298 | Ga0395901_0132298_1499_2590 | 362 |
| 258 | 3300038443 | Ga0395901_0420206 | Ga0395901_0420206_120_1208 | 362 |
| 259 | 3300041404 | Ga0439436_0001880 | Ga0439436_0001880_2961_4052 | 362 |
| 260 | 3300041509 | Ga0451843_0231315 | Ga0451843_0231315_557_1645 | 362 |
| 261 | 3300041999 | Ga0439433_0006511 | Ga0439433_0006511_1326_2417 | 362 |
| 262 | 3300042002 | Ga0439442_000132 | Ga0439442_000132_6834_7925 | 362 |
| 263 | 3300042007 | Ga0439449_0002677 | Ga0439449_0002677_3164_4255 | 362 |
| 264 | 3300042007 | Ga0439449_0011458 | Ga0439449_0011458_283_1374 | 362 |
| 265 | 3300044693 | Ga0466961_0005857 | Ga0466961_0005857_1650_2738 | 362 |
| 266 | 3300044719 | Ga0466971_0007517 | Ga0466971_0007517_3631_4731 | 362 |
| 267 | 3300044901 | Ga0466960_0014530 | Ga0466960_0014530_1916_3013 | 362 |
| 268 | 3300045836 | Ga0466958_0034382 | Ga0466958_0034382_284_1372 | 362 |
| 269 | 3300045836 | Ga0466958_0056471 | Ga0466958_0056471_109_1206 | 362 |
| 270 | 3300046455 | Ga0495603_0171631 | Ga0495603_0171631_61_1149 | 362 |
| 271 | 3300046492 | Ga0495585_0050940 | Ga0495585_0050940_786_1874 | 362 |
| 272 | 3300046535 | Ga0495586_0027329 | Ga0495586_0027329_310_1401 | 362 |
| 273 | 3300048904 | Ga0496101_0126811 | Ga0496101_0126811_470_1561 | 362 |
| 274 | 3300048906 | Ga0496103_0034874 | Ga0496103_0034874_1887_2978 | 362 |
| 275 | 3300048907 | Ga0496104_0010456 | Ga0496104_0010456_53_1150 | 362 |
| 276 | 3300048909 | Ga0496106_0051957 | Ga0496106_0051957_1642_2733 | 362 |
| 277 | 3300048912 | Ga0496109_0008120 | Ga0496109_0008120_1361_2458 | 362 |
| 278 | 3300048912 | Ga0496109_0082019 | Ga0496109_0082019_528_1616 | 362 |
| 279 | 3300048913 | Ga0496110_0455591 | Ga0496110_0455591_32_1123 | 362 |
| 280 | 3300048914 | Ga0496111_0032308 | Ga0496111_0032308_2479_3576 | 362 |
| 281 | 3300048916 | Ga0496113_0012072 | Ga0496113_0012072_1081_2178 | 362 |
| 282 | 3300048916 | Ga0496113_0099791 | Ga0496113_0099791_315_1403 | 362 |
| 283 | 3300048918 | Ga0496115_0078606 | Ga0496115_0078606_400_1497 | 362 |
| 284 | 3300048918 | Ga0496115_0287923 | Ga0496115_0287923_142_1230 | 362 |
| 285 | 3300048921 | Ga0496118_0015021 | Ga0496118_0015021_2137_3234 | 362 |
| 286 | 3300048923 | Ga0496120_0025614 | Ga0496120_0025614_231_1328 | 362 |
| 287 | 3300048925 | Ga0496122_0014517 | Ga0496122_0014517_3228_4325 | 362 |
| 288 | 3300048928 | Ga0496125_0015589 | Ga0496125_0015589_1338_2435 | 362 |
| 289 | 3300048929 | Ga0496126_0053015 | Ga0496126_0053015_1041_2141 | 362 |
| 290 | 3300049537 | Ga0501321_000448 | Ga0501321_000448_910_2001 | 362 |
| 291 | 3300049539 | Ga0501323_000263 | Ga0501323_000263_570_1661 | 362 |
| 292 | 3300049541 | Ga0501325_000128 | Ga0501325_000128_57_1148 | 362 |
| 293 | 3300049569 | Ga0501032_0002014 | Ga0501032_0002014_8437_9528 | 362 |
| 294 | 3300049569 | Ga0501032_0018187 | Ga0501032_0018187_2507_3604 | 362 |
| 295 | 3300049571 | Ga0501034_0000051 | Ga0501034_0000051_147193_148284 | 362 |
| 296 | 3300049571 | Ga0501034_0001989 | Ga0501034_0001989_23286_24383 | 362 |
| 297 | 3300049571 | Ga0501034_0018422 | Ga0501034_0018422_2300_3397 | 362 |
| 298 | 3300049571 | Ga0501034_0026078 | Ga0501034_0026078_3603_4700 | 362 |
| 299 | 3300049572 | Ga0501036_0257204 | Ga0501036_0257204_35_1138 | 362 |
| 300 | 3300049573 | Ga0501037_0013850 | Ga0501037_0013850_739_1830 | 362 |
| 301 | 3300049574 | Ga0501038_0027063 | Ga0501038_0027063_2483_3580 | 362 |
| 302 | 3300049575 | Ga0501039_0091455 | Ga0501039_0091455_169_1272 | 362 |
| 303 | 3300049579 | Ga0501043_0036343 | Ga0501043_0036343_234_1325 | 362 |
| 304 | 3300049581 | Ga0501047_0059629 | Ga0501047_0059629_1055_2152 | 362 |
| 305 | 3300049581 | Ga0501047_0191425 | Ga0501047_0191425_109_1206 | 362 |
| 306 | 3300049584 | Ga0501068_0056899 | Ga0501068_0056899_706_1800 | 362 |
| 307 | 3300049587 | Ga0501071_0248555 | Ga0501071_0248555_213_1316 | 362 |
| 308 | 3300050492 | nmdc:mga0yw44_10892_c1 | nmdc:mga0yw44_10892_c1_1517_2605 | 362 |
| 309 | 3300050492 | nmdc:mga0yw44_8733_c1 | nmdc:mga0yw44_8733_c1_2661_3803 | 362 |
| 310 | 3300050494 | nmdc:mga06z11_145798_c1 | nmdc:mga06z11_145798_c1_143_1243 | 362 |
| 311 | 3300059510 | Ga0587090_000422 | Ga0587090_000422_492_1583 | 362 |
| 312 | 3300061719 | Ga0466962_0012896 | Ga0466962_0012896_1918_3018 | 362 |
| 313 | iso_pu_bacteria | 2919446982 | 2919447670 | 362 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7b0d-assembly1.cif.gz_B | sugar transaminase from archaeoglobus veneficus | 0.9682 | 14 | 362 |
| 3nys-assembly1.cif.gz_A | x-ray structure of the k185a mutant of wbpe (wlbe) from pseudomonas aeruginosa in complex with plp at 1.45 angstrom resolution | 0.9649 | 15 | 355 |
| 3nu7-assembly1.cif.gz_A | wbpe, an aminotransferase from pseudomonas aeruginosa involved in o-antigen assembly in complex with the cofactor pmp | 0.9635 | 15 | 354 |
| 8su6-assembly1.cif.gz_B | crystal structure of arnb transferase from klebsiella aerogenes (lattice translocation disorder, p1 form2) | 0.9605 | 3 | 357 |
| 3frk-assembly1.cif.gz_B | x-ray structure of qdtb from t. thermosaccharolyticum in complex with a plp:tdp-3-aminoquinovose aldimine | 0.9602 | 15 | 356 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58466_2_255_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9744 | 5 | 242 | 3.40.640.10 |
| 4lc3B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9635 | 5 | 241 | 3.40.640.10 |
| 1mdxA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9576 | 5 | 242 | 3.40.640.10 |
| 3bn1B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9575 | 2 | 241 | 3.40.640.10 |
| 2ogeD01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9542 | 15 | 241 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8Q735-F1-model_v4 | Aminotransferase DegT | 0.9905 | 14 | 150 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A520K955-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9867 | 5 | 233 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A3D4E1S7-F1-model_v4 | deleted | 0.9867 | 71 | 184 |
|
| AF-A0A496QY83-F1-model_v4 | DegT/DnrJ/EryC1/StrS family aminotransferase | 0.9864 | 10 | 181 |
GO:0000271
GO:0008483 GO:0030170 |
| AF-A0A6J6D7U7-F1-model_v4 | Unannotated protein | 0.9853 | 56 | 360 |
GO:0000271
GO:0008483 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar