F402219

General Info

Members Datasets Scaffolds Average Seq Length
313 186 626 308

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10049987|Ga0207667_100499873
Length 341
Sequence MPSISREPSGRAYKRSPVKHQKKKDEHDISLKEKVIMNTGFDQPLYILPFDQRESFQTKMFGWEGALSAAQTAEIAAAKQVIYDGFQAAIAGGAPKKHAAILVDEQFGASILRDATRQGYMTACPAEKSGQKEFDFEYGEEFARHIEAFNPTFCKVLVRYNPEGDAGLNRRQVSRLKRLSDYLHDNGRLLMVELYVDAEPAQIKQLHGEKKTYDLDLRPTLTVQTLHELQRAGIEPDVWKVEGLDRREDCLNLVAAARREGRERVGCIVLGGGQDEQRVREWLTTAASVPGFIGFAIGRTTFWDALVDWGANQITRAAAVAKIARRYQEWVDIFQKPAGSK

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
184 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0.32
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 2.24
Rhizosphere 92.01
Stem 0
Stem Tuber 0
Unclassified 10.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10049987 3300025949 Bacteria 4412
2 rootH2_10056579 3300003320 Bacteria 8260
3 Ga0070670_100000762 3300005331 Bacteria 25031
4 Ga0070670_100013276 3300005331 Bacteria 7056
5 Ga0070670_100043153 3300005331 Bacteria 3877
6 Ga0068869_100004020 3300005334 Bacteria 9097
7 Ga0070666_10121882 3300005335 Bacteria 1808
8 Ga0070680_100330655 3300005336 Bacteria 1294
9 Ga0068868_100026088 3300005338 Bacteria 4450
10 Ga0070692_10102890 3300005345 Bacteria 1568
11 Ga0070668_100095996 3300005347 Bacteria 2342
12 Ga0070669_100119778 3300005353 Bacteria 2006
13 Ga0070675_100025589 3300005354 Bacteria 4731
14 Ga0070675_100116764 3300005354 Unclassified 2264
15 Ga0070673_100164581 3300005364 Bacteria 1889
16 Ga0070673_100266375 3300005364 Bacteria 1498
17 Ga0070659_100097224 3300005366 Bacteria 2366
18 Ga0070659_100129454 3300005366 Bacteria 2049
19 Ga0070667_100000619 3300005367 Bacteria 34660
20 Ga0070667_100532578 3300005367 Unclassified 1079
21 Ga0070709_10003827 3300005434 Bacteria 8096
22 Ga0070714_100441711 3300005435 Bacteria 1235
23 Ga0070705_100314408 3300005440 Bacteria 1128
24 Ga0070694_100042244 3300005444 Bacteria 3045
25 Ga0070694_100166702 3300005444 Bacteria 1620
26 Ga0070708_100020618 3300005445 Bacteria 5563
27 Ga0070708_100032967 3300005445 Bacteria 4497
28 Ga0070678_100344729 3300005456 Bacteria 1279
29 Ga0070681_10021455 3300005458 Bacteria 6475
30 Ga0070681_10036220 3300005458 Bacteria 4955
31 Ga0070681_10064392 3300005458 Bacteria 3636
32 Ga0070681_10211407 3300005458 Bacteria 1856
33 Ga0070681_10279747 3300005458 Bacteria 1579
34 Ga0070681_10333401 3300005458 Bacteria 1426
35 Ga0070681_10523418 3300005458 Bacteria 1099
36 Ga0070706_100107817 3300005467 Bacteria 2591
37 Ga0070706_100114397 3300005467 Bacteria 2512
38 Ga0070706_100455148 3300005467 Bacteria 1191
39 Ga0070707_100021828 3300005468 Bacteria 6052
40 Ga0070707_100044701 3300005468 Bacteria 4240
41 Ga0070707_100057823 3300005468 Bacteria 3720
42 Ga0070698_100010569 3300005471 Bacteria 9839
43 Ga0070698_100023011 3300005471 Bacteria 6514
44 Ga0070698_100086973 3300005471 Bacteria 3112
45 Ga0070698_100372206 3300005471 Bacteria 1361
46 Ga0070699_100051469 3300005518 Bacteria 3565
47 Ga0070699_100267920 3300005518 Bacteria 1528
48 Ga0070679_100013890 3300005530 Bacteria 7715
49 Ga0070679_100074356 3300005530 Unclassified 3389
50 Ga0070684_100020545 3300005535 Bacteria 5478
51 Ga0070697_100005575 3300005536 Bacteria 9705
52 Ga0070697_100073150 3300005536 Bacteria 2813
53 Ga0070697_100112081 3300005536 Bacteria 2274
54 Ga0068853_100158285 3300005539 Bacteria 2042
55 Ga0070672_100047759 3300005543 Unclassified 3323
56 Ga0070672_100259688 3300005543 Bacteria 1465
57 Ga0070695_100117931 3300005545 Bacteria 1812
58 Ga0070696_100009841 3300005546 Bacteria 6393
59 Ga0070696_100036919 3300005546 Bacteria 3371
60 Ga0070696_100152727 3300005546 Bacteria 1696
61 Ga0070693_100019890 3300005547 Bacteria 3531
62 Ga0070693_100358768 3300005547 Unclassified 1000
63 Ga0070704_100483043 3300005549 Bacteria 1072
64 Ga0068855_100094706 3300005563 Bacteria 3443
65 Ga0070664_100010475 3300005564 Bacteria 7515
66 Ga0070664_100029599 3300005564 Bacteria 4566
67 Ga0068857_100002212 3300005577 Bacteria 15833
68 Ga0068857_100054110 3300005577 Bacteria 3561
69 Ga0068857_100088916 3300005577 Unclassified 2763
70 Ga0068857_100233652 3300005577 Bacteria 1682
71 Ga0068856_100251602 3300005614 Unclassified 1782
72 Ga0068856_100492091 3300005614 Bacteria 1247
73 Ga0068859_100004312 3300005617 Bacteria 14504
74 Ga0068864_100005814 3300005618 Bacteria 10113
75 Ga0068870_10003390 3300005840 Bacteria 6751
76 Ga0068870_10030157 3300005840 Unclassified 2740
77 Ga0068863_100042505 3300005841 Bacteria 4318
78 Ga0068863_100210739 3300005841 Bacteria 1871
79 Ga0068858_100038727 3300005842 Bacteria 4422
80 Ga0068858_100307655 3300005842 Bacteria 1513
81 Ga0068860_100037621 3300005843 Bacteria 4632
82 Ga0068862_100010993 3300005844 Bacteria 7476
83 Ga0068862_100509698 3300005844 Bacteria 1143
84 Ga0081455_10002762 3300005937 Bacteria 20717
85 Ga0081455_10225413 3300005937 Bacteria 1387
86 Ga0081540_1037533 3300005983 Bacteria 2566
87 Ga0081539_10116623 3300005985 Bacteria 1333
88 Ga0070717_10000970 3300006028 Bacteria 19160
89 Ga0070717_10093925 3300006028 Bacteria 2537
90 Ga0070717_10146713 3300006028 Bacteria 2038
91 Ga0070715_10074310 3300006163 Bacteria 1527
92 Ga0070715_10085017 3300006163 Bacteria 1444
93 Ga0070716_100027447 3300006173 Bacteria 3059
94 Ga0070716_100213571 3300006173 Bacteria 1291
95 Ga0070716_100409915 3300006173 Unclassified 977
96 Ga0070712_100002428 3300006175 Bacteria 11484
97 Ga0070712_100321651 3300006175 Bacteria 1258
98 Ga0075428_100090102 3300006844 Bacteria 3345
99 Ga0075428_100106745 3300006844 Bacteria 3052
100 Ga0075428_100137013 3300006844 Bacteria 2661
101 Ga0075430_100335833 3300006846 Bacteria 1248
102 Ga0075431_100038906 3300006847 Bacteria 4899
103 Ga0075431_100209587 3300006847 Bacteria 1991
104 Ga0075431_100233690 3300006847 Bacteria 1872
105 Ga0075433_10002164 3300006852 Bacteria 14878
106 Ga0075433_10006116 3300006852 Bacteria 9482
107 Ga0075433_10012234 3300006852 Bacteria 6920
108 Ga0075433_10022954 3300006852 Bacteria 5245
109 Ga0075433_10028492 3300006852 Bacteria 4748
110 Ga0075433_10211397 3300006852 Bacteria 1724
111 Ga0075434_100000014 3300006871 Bacteria 80310
112 Ga0075434_100007458 3300006871 Bacteria 10118
113 Ga0075434_100065579 3300006871 Bacteria 3617
114 Ga0075434_100127505 3300006871 Bacteria 2562
115 Ga0075434_100140104 3300006871 Bacteria 2438
116 Ga0075429_100014240 3300006880 Bacteria 6895
117 Ga0075436_100019930 3300006914 Bacteria 4600
118 Ga0075436_100263691 3300006914 Bacteria 1229
119 Ga0097620_100004312 3300006931 Bacteria 14504
120 Ga0075435_100190884 3300007076 Bacteria 1734
121 Ga0099794_10000049 3300007265 Bacteria 47722
122 Ga0099795_10003520 3300007788 Bacteria 3890
123 Ga0105240_10429836 3300009093 Bacteria 1482
124 Ga0111539_10036039 3300009094 Bacteria 5985
125 Ga0111539_10060314 3300009094 Bacteria 4496
126 Ga0111539_10063707 3300009094 Bacteria 4362
127 Ga0111539_10080667 3300009094 Bacteria 3827
128 Ga0114129_10000975 3300009147 Bacteria 37455
129 Ga0114129_10043712 3300009147 Bacteria 6303
130 Ga0114129_10111218 3300009147 Bacteria 3780
131 Ga0114129_10257516 3300009147 Unclassified 2340
132 Ga0114129_10555730 3300009147 Bacteria 1492
133 Ga0105241_10219180 3300009174 Unclassified 1598
134 Ga0105248_10091003 3300009177 Bacteria 3436
135 Ga0105248_10240876 3300009177 Bacteria 2036
136 Ga0105237_10241525 3300009545 Unclassified 1807
137 Ga0105238_10065078 3300009551 Bacteria 3646
138 Ga0105249_10329539 3300009553 Bacteria 1540
139 Ga0099796_10045135 3300010159 Bacteria 1509
140 Ga0105239_10019715 3300010375 Bacteria 7443
141 Ga0157370_10193489 3300013104 Bacteria 1888
142 Ga0157369_10010458 3300013105 Bacteria 10569
143 Ga0157378_10148644 3300013297 Bacteria 2181
144 Ga0163162_10307778 3300013306 Bacteria 1717
145 Ga0157375_10107143 3300013308 Bacteria 2888
146 Ga0163163_10088369 3300014325 Bacteria 3110
147 Ga0163163_10161357 3300014325 Bacteria 2287
148 Ga0163163_10501192 3300014325 Bacteria 1276
149 Ga0157380_10192348 3300014326 Bacteria 1803
150 Ga0157377_10185244 3300014745 Bacteria 1312
151 Ga0157379_10006712 3300014968 Bacteria 9942
152 Ga0213875_10001110 3300021388 Bacteria 18675
153 Ga0213875_10059853 3300021388 Bacteria 1782
154 Ga0207685_10023270 3300025905 Bacteria 2107
155 Ga0207699_10002154 3300025906 Bacteria 9300
156 Ga0207699_10059644 3300025906 Bacteria 2288
157 Ga0207684_10088450 3300025910 Bacteria 2639
158 Ga0207684_10307476 3300025910 Bacteria 1366
159 Ga0207707_10009879 3300025912 Bacteria 8274
160 Ga0207707_10112138 3300025912 Unclassified 2384
161 Ga0207707_10135233 3300025912 Bacteria 2155
162 Ga0207707_10238673 3300025912 Bacteria 1581
163 Ga0207707_10389127 3300025912 Unclassified 1198
164 Ga0207695_10232704 3300025913 Bacteria 1746
165 Ga0207693_10007056 3300025915 Bacteria 9272
166 Ga0207693_10007899 3300025915 Bacteria 8739
167 Ga0207649_10103371 3300025920 Unclassified 1890
168 Ga0207646_10035084 3300025922 Bacteria 4532
169 Ga0207646_10069940 3300025922 Bacteria 3135
170 Ga0207681_10013802 3300025923 Bacteria 5005
171 Ga0207694_10039904 3300025924 Bacteria 3614
172 Ga0207650_10056994 3300025925 Bacteria 2905
173 Ga0207650_10168496 3300025925 Bacteria 1739
174 Ga0207659_10031563 3300025926 Bacteria 3628
175 Ga0207700_10193793 3300025928 Bacteria 1709
176 Ga0207665_10037420 3300025939 Bacteria 3229
177 Ga0207691_10287716 3300025940 Bacteria 1413
178 Ga0207711_10038019 3300025941 Bacteria 4092
179 Ga0207711_10200718 3300025941 Unclassified 1820
180 Ga0207689_10000557 3300025942 Bacteria 35594
181 Ga0207689_10199141 3300025942 Unclassified 1653
182 Ga0207661_10135274 3300025944 Bacteria 2116
183 Ga0207661_10296148 3300025944 Bacteria 1449
184 Ga0207679_10001978 3300025945 Bacteria 12711
185 Ga0207667_10086923 3300025949 Bacteria 3235
186 Ga0207651_10099660 3300025960 Bacteria 2152
187 Ga0207668_10083590 3300025972 Bacteria 2323
188 Ga0207658_10049145 3300025986 Bacteria 3097
189 Ga0207677_10014759 3300026023 Bacteria 4573
190 Ga0207703_10000906 3300026035 Bacteria 28987
191 Ga0207641_10007925 3300026088 Bacteria 8809
192 Ga0207641_10215361 3300026088 Bacteria 1778
193 Ga0207648_10092473 3300026089 Bacteria 2645
194 Ga0207676_10037040 3300026095 Bacteria 3714
195 Ga0207676_10381301 3300026095 Unclassified 1312
196 Ga0207674_10004918 3300026116 Bacteria 15976
197 Ga0207674_10057621 3300026116 Bacteria 3938
198 Ga0207674_10070827 3300026116 Bacteria 3505
199 Ga0207675_100001548 3300026118 Bacteria 23038
200 Ga0207683_10099031 3300026121 Bacteria 2602
201 Ga0209588_1000015 3300027671 Bacteria 129625
202 Ga0209974_10005815 3300027876 Bacteria 4325
203 Ga0207428_10007613 3300027907 Bacteria 9862
204 Ga0207428_10010928 3300027907 Bacteria 8080
205 Ga0207428_10207208 3300027907 Unclassified 1474
206 Ga0265356_1002905 3300028017 Unclassified 2213
207 Ga0268265_10034238 3300028380 Bacteria 3700
208 Ga0268265_10446279 3300028380 Bacteria 1207
209 Ga0268264_10041837 3300028381 Bacteria 3791
210 Ga0265760_10026038 3300031090 Bacteria 1710
211 Ga0265330_10000236 3300031235 Bacteria 41666
212 Ga0265325_10000521 3300031241 Bacteria 27711
213 Ga0265339_10020436 3300031249 Unclassified 3868
214 Ga0265339_10080567 3300031249 Unclassified 1722
215 Ga0265331_10082847 3300031250 Bacteria 1488
216 Ga0265327_10000487 3300031251 Bacteria 69944
217 Ga0265327_10012834 3300031251 Bacteria 5615
218 Ga0265316_10023102 3300031344 Bacteria 5228
219 Ga0265313_10016388 3300031595 Unclassified 4261
220 Ga0265314_10028959 3300031711 Bacteria 4122
221 Ga0265342_10000637 3300031712 Bacteria 36764
222 Ga0307406_10028874 3300031901 Bacteria 3354
223 Ga0307406_10331503 3300031901 Bacteria 1181
224 Ga0307411_10059794 3300032005 Unclassified 2528
225 Ga0316215_1006189 3300033544 Bacteria 1159
226 Ga0373927_0184764 3300035695 Bacteria 1368
227 Ga0373937_0031367 3300036401 Bacteria 4816
228 Ga0373937_0379416 3300036401 Bacteria 1341
229 Ga0395905_0137828 3300037471 Unclassified 2296
230 Ga0395905_0325898 3300037471 Bacteria 1426
231 Ga0395905_0388540 3300037471 Unclassified 1290
232 Ga0436364_0117519 3300037853 Bacteria 8201
233 Ga0436364_0342296 3300037853 Bacteria 1247
234 Ga0436364_0737333 3300037853 Bacteria 47273
235 Ga0436364_0741927 3300037853 Bacteria 1281
236 Ga0436364_0806141 3300037853 Bacteria 5283
237 Ga0436364_1333206 3300037853 Bacteria 2236
238 Ga0436365_0517414 3300039437 Bacteria 1514
239 Ga0436360_0709157 3300039438 Bacteria 2155
240 Ga0436360_1223455 3300039438 Bacteria 2274
241 Ga0436361_0805476 3300039447 Bacteria 2345
242 Ga0436361_1171019 3300039447 Bacteria 2556
243 Ga0436363_0894474 3300039450 Bacteria 4001
244 Ga0436363_1002948 3300039450 Bacteria 15044
245 Ga0436363_1233560 3300039450 Bacteria 1424
246 Ga0451577_0114016 3300042876 Bacteria 2420
247 Ga0453684_0072984 3300044712 Bacteria 4329
248 Ga0451576_0020097 3300045051 Bacteria 7278
249 Ga0451576_0243093 3300045051 Bacteria 1880
250 Ga0495603_0034658 3300046455 Bacteria 3034
251 Ga0495580_0122686 3300046472 Bacteria 1804
252 Ga0495628_0103667 3300046516 Bacteria 2193
253 Ga0495645_0001966 3300046543 Bacteria 13967
254 Ga0495645_0058823 3300046543 Bacteria 2788
255 Ga0495635_0251128 3300046663 Bacteria 1192
256 Ga0495659_0132373 3300046664 Unclassified 990
257 Ga0495669_0066150 3300046684 Bacteria 1642
258 Ga0495674_0066734 3300047319 Bacteria 3120
259 Ga0495672_0017648 3300047320 Bacteria 4767
260 Ga0495676_0392270 3300047321 Unclassified 922
261 Ga0495673_0056590 3300047469 Bacteria 1696
262 Ga0495684_0216750 3300047471 Bacteria 1405
263 Ga0496102_0249970 3300048905 Bacteria 1672
264 Ga0496106_0074977 3300048909 Bacteria 2591
265 Ga0496106_0103279 3300048909 Bacteria 2212
266 Ga0496108_0194679 3300048911 Bacteria 1758
267 Ga0496109_0000444 3300048912 Bacteria 35601
268 Ga0496109_0037274 3300048912 Bacteria 4393
269 Ga0496112_0338947 3300048915 Unclassified 1447
270 Ga0496121_0350319 3300048924 Bacteria 984
271 Ga0501039_0233764 3300049575 Bacteria 1445
272 Ga0501043_0003367 3300049579 Bacteria 13157
273 Ga0501043_0156412 3300049579 Unclassified 1783
274 Ga0501046_0067020 3300049580 Bacteria 2796
275 Ga0501048_0062476 3300049582 Unclassified 2636
276 Ga0501048_0148624 3300049582 Bacteria 1657
277 Ga0501070_0001153 3300049586 Bacteria 23676
278 Ga0501072_0084086 3300049588 Bacteria 2523
279 Ga0501072_0168474 3300049588 Bacteria 1748
280 Ga0501077_0284199 3300049593 Unclassified 1053
281 Ga0501079_0111614 3300049741 Bacteria 2125
282 Ga0501080_0072964 3300049742 Bacteria 3193
283 Ga0501035_0090013 3300049822 Bacteria 2702
284 Ga0501035_0396323 3300049822 Unclassified 1149
285 Ga0501044_0041432 3300049823 Bacteria 4794
286 Ga0501045_0108786 3300049824 Bacteria 2055
287 nmdc:mga05p37_101534_c1 3300050507 Bacteria 3542
288 nmdc:mga05p37_47997_c1 3300050507 Bacteria 5251
289 nmdc:mga05p37_565765_c1 3300050507 Bacteria 1291
290 nmdc:mga05p37_76368_c1 3300050507 Bacteria 4125
291 nmdc:mga09592_239729_c1 3300050508 Bacteria 1571
292 nmdc:mga09592_46584_c1 3300050508 Bacteria 3653
293 nmdc:mga0qj67_87772_c1 3300050509 Bacteria 2497
294 nmdc:mga06r32_335961_c1 3300050510 Bacteria 1496
295 nmdc:mga06r32_54603_c1 3300050510 Bacteria 3831
296 nmdc:mga08y16_19083_c1 3300050511 Bacteria 7224
297 nmdc:mga08y16_60220_c1 3300050511 Bacteria 3966
298 nmdc:mga0n895_112759_c1 3300050512 Bacteria 2736
299 nmdc:mga0n895_150337_c1 3300050512 Bacteria 2359
300 nmdc:mga0n895_264281_c1 3300050512 Bacteria 1746
301 nmdc:mga0n895_51853_c1 3300050512 Bacteria 4026
302 nmdc:mga0rr50_499917_c1 3300050513 Bacteria 1034
303 nmdc:mga08x19_13407_c1 3300050514 Bacteria 4955
304 nmdc:mga08x19_28278_c1 3300050514 Bacteria 3511
305 nmdc:mga0a205_138501_c1 3300050515 Bacteria 2334
306 nmdc:mga0a205_6342_c1 3300050515 Bacteria 10679
307 nmdc:mga0a205_72101_c1 3300050515 Bacteria 3336
308 nmdc:mga0a205_73568_c1 3300050515 Bacteria 3301
309 nmdc:mga0a205_86097_c1 3300050515 Bacteria 3035
310 Ga0500641_0070243 3300053096 Bacteria 1473
311 Ga0500590_002586 3300053148 Bacteria 8096
312 Ga0501084_0026111 3300054114 Bacteria 4873
313 2881416356 2881412998 Bacteria 6492157
314 Ga0207667_10049987
315 rootH2_10056579
316 Ga0070670_100000762
317 Ga0070670_100013276
318 Ga0070670_100043153
319 Ga0068869_100004020
320 Ga0070666_10121882
321 Ga0070680_100330655
322 Ga0068868_100026088
323 Ga0070692_10102890
324 Ga0070668_100095996
325 Ga0070669_100119778
326 Ga0070675_100025589
327 Ga0070675_100116764
328 Ga0070673_100164581
329 Ga0070673_100266375
330 Ga0070659_100097224
331 Ga0070659_100129454
332 Ga0070667_100000619
333 Ga0070667_100532578
334 Ga0070709_10003827
335 Ga0070714_100441711
336 Ga0070705_100314408
337 Ga0070694_100042244
338 Ga0070694_100166702
339 Ga0070708_100020618
340 Ga0070708_100032967
341 Ga0070678_100344729
342 Ga0070681_10021455
343 Ga0070681_10036220
344 Ga0070681_10064392
345 Ga0070681_10211407
346 Ga0070681_10279747
347 Ga0070681_10333401
348 Ga0070681_10523418
349 Ga0070706_100107817
350 Ga0070706_100114397
351 Ga0070706_100455148
352 Ga0070707_100021828
353 Ga0070707_100044701
354 Ga0070707_100057823
355 Ga0070698_100010569
356 Ga0070698_100023011
357 Ga0070698_100086973
358 Ga0070698_100372206
359 Ga0070699_100051469
360 Ga0070699_100267920
361 Ga0070679_100013890
362 Ga0070679_100074356
363 Ga0070684_100020545
364 Ga0070697_100005575
365 Ga0070697_100073150
366 Ga0070697_100112081
367 Ga0068853_100158285
368 Ga0070672_100047759
369 Ga0070672_100259688
370 Ga0070695_100117931
371 Ga0070696_100009841
372 Ga0070696_100036919
373 Ga0070696_100152727
374 Ga0070693_100019890
375 Ga0070693_100358768
376 Ga0070704_100483043
377 Ga0068855_100094706
378 Ga0070664_100010475
379 Ga0070664_100029599
380 Ga0068857_100002212
381 Ga0068857_100054110
382 Ga0068857_100088916
383 Ga0068857_100233652
384 Ga0068856_100251602
385 Ga0068856_100492091
386 Ga0068859_100004312
387 Ga0068864_100005814
388 Ga0068870_10003390
389 Ga0068870_10030157
390 Ga0068863_100042505
391 Ga0068863_100210739
392 Ga0068858_100038727
393 Ga0068858_100307655
394 Ga0068860_100037621
395 Ga0068862_100010993
396 Ga0068862_100509698
397 Ga0081455_10002762
398 Ga0081455_10225413
399 Ga0081540_1037533
400 Ga0081539_10116623
401 Ga0070717_10000970
402 Ga0070717_10093925
403 Ga0070717_10146713
404 Ga0070715_10074310
405 Ga0070715_10085017
406 Ga0070716_100027447
407 Ga0070716_100213571
408 Ga0070716_100409915
409 Ga0070712_100002428
410 Ga0070712_100321651
411 Ga0075428_100090102
412 Ga0075428_100106745
413 Ga0075428_100137013
414 Ga0075430_100335833
415 Ga0075431_100038906
416 Ga0075431_100209587
417 Ga0075431_100233690
418 Ga0075433_10002164
419 Ga0075433_10006116
420 Ga0075433_10012234
421 Ga0075433_10022954
422 Ga0075433_10028492
423 Ga0075433_10211397
424 Ga0075434_100000014
425 Ga0075434_100007458
426 Ga0075434_100065579
427 Ga0075434_100127505
428 Ga0075434_100140104
429 Ga0075429_100014240
430 Ga0075436_100019930
431 Ga0075436_100263691
432 Ga0097620_100004312
433 Ga0075435_100190884
434 Ga0099794_10000049
435 Ga0099795_10003520
436 Ga0105240_10429836
437 Ga0111539_10036039
438 Ga0111539_10060314
439 Ga0111539_10063707
440 Ga0111539_10080667
441 Ga0114129_10000975
442 Ga0114129_10043712
443 Ga0114129_10111218
444 Ga0114129_10257516
445 Ga0114129_10555730
446 Ga0105241_10219180
447 Ga0105248_10091003
448 Ga0105248_10240876
449 Ga0105237_10241525
450 Ga0105238_10065078
451 Ga0105249_10329539
452 Ga0099796_10045135
453 Ga0105239_10019715
454 Ga0157370_10193489
455 Ga0157369_10010458
456 Ga0157378_10148644
457 Ga0163162_10307778
458 Ga0157375_10107143
459 Ga0163163_10088369
460 Ga0163163_10161357
461 Ga0163163_10501192
462 Ga0157380_10192348
463 Ga0157377_10185244
464 Ga0157379_10006712
465 Ga0213875_10001110
466 Ga0213875_10059853
467 Ga0207685_10023270
468 Ga0207699_10002154
469 Ga0207699_10059644
470 Ga0207684_10088450
471 Ga0207684_10307476
472 Ga0207707_10009879
473 Ga0207707_10112138
474 Ga0207707_10135233
475 Ga0207707_10238673
476 Ga0207707_10389127
477 Ga0207695_10232704
478 Ga0207693_10007056
479 Ga0207693_10007899
480 Ga0207649_10103371
481 Ga0207646_10035084
482 Ga0207646_10069940
483 Ga0207681_10013802
484 Ga0207694_10039904
485 Ga0207650_10056994
486 Ga0207650_10168496
487 Ga0207659_10031563
488 Ga0207700_10193793
489 Ga0207665_10037420
490 Ga0207691_10287716
491 Ga0207711_10038019
492 Ga0207711_10200718
493 Ga0207689_10000557
494 Ga0207689_10199141
495 Ga0207661_10135274
496 Ga0207661_10296148
497 Ga0207679_10001978
498 Ga0207667_10086923
499 Ga0207651_10099660
500 Ga0207668_10083590
501 Ga0207658_10049145
502 Ga0207677_10014759
503 Ga0207703_10000906
504 Ga0207641_10007925
505 Ga0207641_10215361
506 Ga0207648_10092473
507 Ga0207676_10037040
508 Ga0207676_10381301
509 Ga0207674_10004918
510 Ga0207674_10057621
511 Ga0207674_10070827
512 Ga0207675_100001548
513 Ga0207683_10099031
514 Ga0209588_1000015
515 Ga0209974_10005815
516 Ga0207428_10007613
517 Ga0207428_10010928
518 Ga0207428_10207208
519 Ga0265356_1002905
520 Ga0268265_10034238
521 Ga0268265_10446279
522 Ga0268264_10041837
523 Ga0265760_10026038
524 Ga0265330_10000236
525 Ga0265325_10000521
526 Ga0265339_10020436
527 Ga0265339_10080567
528 Ga0265331_10082847
529 Ga0265327_10000487
530 Ga0265327_10012834
531 Ga0265316_10023102
532 Ga0265313_10016388
533 Ga0265314_10028959
534 Ga0265342_10000637
535 Ga0307406_10028874
536 Ga0307406_10331503
537 Ga0307411_10059794
538 Ga0316215_1006189
539 Ga0373927_0184764
540 Ga0373937_0031367
541 Ga0373937_0379416
542 Ga0395905_0137828
543 Ga0395905_0325898
544 Ga0395905_0388540
545 Ga0436364_0117519
546 Ga0436364_0342296
547 Ga0436364_0737333
548 Ga0436364_0741927
549 Ga0436364_0806141
550 Ga0436364_1333206
551 Ga0436365_0517414
552 Ga0436360_0709157
553 Ga0436360_1223455
554 Ga0436361_0805476
555 Ga0436361_1171019
556 Ga0436363_0894474
557 Ga0436363_1002948
558 Ga0436363_1233560
559 Ga0451577_0114016
560 Ga0453684_0072984
561 Ga0451576_0020097
562 Ga0451576_0243093
563 Ga0495603_0034658
564 Ga0495580_0122686
565 Ga0495628_0103667
566 Ga0495645_0001966
567 Ga0495645_0058823
568 Ga0495635_0251128
569 Ga0495659_0132373
570 Ga0495669_0066150
571 Ga0495674_0066734
572 Ga0495672_0017648
573 Ga0495676_0392270
574 Ga0495673_0056590
575 Ga0495684_0216750
576 Ga0496102_0249970
577 Ga0496106_0074977
578 Ga0496106_0103279
579 Ga0496108_0194679
580 Ga0496109_0000444
581 Ga0496109_0037274
582 Ga0496112_0338947
583 Ga0496121_0350319
584 Ga0501039_0233764
585 Ga0501043_0003367
586 Ga0501043_0156412
587 Ga0501046_0067020
588 Ga0501048_0062476
589 Ga0501048_0148624
590 Ga0501070_0001153
591 Ga0501072_0084086
592 Ga0501072_0168474
593 Ga0501077_0284199
594 Ga0501079_0111614
595 Ga0501080_0072964
596 Ga0501035_0090013
597 Ga0501035_0396323
598 Ga0501044_0041432
599 Ga0501045_0108786
600 nmdc:mga05p37_101534_c1
601 nmdc:mga05p37_47997_c1
602 nmdc:mga05p37_565765_c1
603 nmdc:mga05p37_76368_c1
604 nmdc:mga09592_239729_c1
605 nmdc:mga09592_46584_c1
606 nmdc:mga0qj67_87772_c1
607 nmdc:mga06r32_335961_c1
608 nmdc:mga06r32_54603_c1
609 nmdc:mga08y16_19083_c1
610 nmdc:mga08y16_60220_c1
611 nmdc:mga0n895_112759_c1
612 nmdc:mga0n895_150337_c1
613 nmdc:mga0n895_264281_c1
614 nmdc:mga0n895_51853_c1
615 nmdc:mga0rr50_499917_c1
616 nmdc:mga08x19_13407_c1
617 nmdc:mga08x19_28278_c1
618 nmdc:mga0a205_138501_c1
619 nmdc:mga0a205_6342_c1
620 nmdc:mga0a205_72101_c1
621 nmdc:mga0a205_73568_c1
622 nmdc:mga0a205_86097_c1
623 Ga0500641_0070243
624 Ga0500590_002586
625 Ga0501084_0026111
626 2881416356

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09863

DUF2090

Uncharacterized protein conserved in bacteria (DUF2090)

12

338

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myp-assembly2.cif.gz_B crystal structure of tagatose-1,6-bisphosphate aldolase from staphylococcus aureus 0.7981 7 303
3iv3-assembly1.cif.gz_A-2 the structure of a putative tagatose 1,6-aldolase from streptococcus mutans 0.7892 7 303
3myp-assembly2.cif.gz_B crystal structure of tagatose-1,6-bisphosphate aldolase from staphylococcus aureus 0.7737 7 303
3iv3-assembly1.cif.gz_A-2 the structure of a putative tagatose 1,6-aldolase from streptococcus mutans 0.7652 7 303
5hjl-assembly1.cif.gz_B crystal structure of class i tagatose 1,6-bisphosphate aldolase lacd from streptococcus porcinus 0.7607 5 306
ID Description Score Start End Superfamily
3kaoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7862 7 303 3.20.20.70
3kaoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7532 7 303 3.20.20.70
af_P32141_1_292_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7305 9 305 3.20.20.70
1xdlX00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7068 10 299 3.20.20.70
3mbdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6957 12 305 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A402AZD5-F1-model_v4 DUF2090 domain-containing protein 0.9977 183 305
AF-A0A2H0BRJ1-F1-model_v4 DUF2090 domain-containing protein 0.9969 232 305
AF-A0A850BJ59-F1-model_v4 DUF2090 domain-containing protein 0.9945 1 304
AF-A0A1Q6Y2T4-F1-model_v4 IolC myo-catabolism protein 0.9936 97 306
AF-A0A7Y5LAZ6-F1-model_v4 DUF2090 domain-containing protein 0.9933 234 304

Map