F402214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 230 | 273 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300025921|Ga0207652_10205460|Ga0207652_102054603 |
| Length | 343 |
| Sequence | MTIENPPASEPMLPAASHDLSVGPALVTSTPGAEPTSGRLTRSDVDRLLSPAGDRPILVATSGRRRLMDRAATVAMAVAFVLALVPLVWILATVVSKGGHLLVESGWWSETQRGITSRRVGGGALHAIVGTLLQAAVTAAISLPIGVLAAVYLVEYPRTKVSRAVSFMVDILTGVPSIVAALFVYALWVTTLGFQRVAFAVSLSLVLLMVPVVVRSTEEMLRLVPADLREASAALGVPTWRTVVSVVLPTAMSGIITGALLGLARVMGETAPLLILGPYTKQLATGLFGGPMATLPTMINQDRTEALAPAVDRVWAAALTLVLLVLLLNVLGRLVGRRHRVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 5 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 6 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 7 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 8 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 9 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 10 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 11 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 12 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 13 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 14 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 15 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 16 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 17 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 18 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 19 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 20 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 21 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 22 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 23 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 24 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 25 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 26 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 27 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 28 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 29 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 30 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 31 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 32 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 33 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 34 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 35 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 36 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 37 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 38 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 39 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 40 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 41 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 42 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 43 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 121 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 139 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 146 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 149 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 150 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 151 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 152 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 188 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 213 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 215 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 216 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 226 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 229 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 230 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.26 |
| Metatranscriptomes | 0.96 |
| Isolates | 12.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 0.32 |
| Rhizoplane | 4.79 |
| Rhizosphere | 81.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10008599 | 3300001979 | Bacteria | 4054 |
| 2 | JGI24740J21852_10050723 | 3300001979 | Bacteria | 1192 |
| 3 | JGI24739J22299_10027058 | 3300001989 | Bacteria | 2007 |
| 4 | JGI24739J22299_10082106 | 3300001989 | Bacteria | 989 |
| 5 | JGI24737J22298_10002043 | 3300001990 | Bacteria | 7223 |
| 6 | JGI24735J21928_10019708 | 3300002067 | Bacteria | 2072 |
| 7 | JGI25407J50210_10003138 | 3300003373 | Bacteria | 3935 |
| 8 | Ga0055540_1000071 | 3300003792 | Bacteria | 117607 |
| 9 | Ga0070658_10432198 | 3300005327 | Bacteria | 1133 |
| 10 | Ga0070683_100111758 | 3300005329 | Bacteria | 2578 |
| 11 | Ga0070683_100285082 | 3300005329 | Bacteria | 1571 |
| 12 | Ga0070670_100432611 | 3300005331 | Bacteria | 1164 |
| 13 | Ga0068869_100062765 | 3300005334 | Bacteria | 2728 |
| 14 | Ga0068868_100370663 | 3300005338 | Bacteria | 1230 |
| 15 | Ga0070668_100210392 | 3300005347 | Bacteria | 1600 |
| 16 | Ga0070674_100267452 | 3300005356 | Bacteria | 1350 |
| 17 | Ga0070714_100117922 | 3300005435 | Bacteria | 2358 |
| 18 | Ga0070705_100048426 | 3300005440 | Bacteria | 2462 |
| 19 | Ga0070705_100066525 | 3300005440 | Bacteria | 2161 |
| 20 | Ga0070663_100425532 | 3300005455 | Bacteria | 1090 |
| 21 | Ga0070662_100021016 | 3300005457 | Bacteria | 4452 |
| 22 | Ga0070679_100365018 | 3300005530 | Bacteria | 1391 |
| 23 | Ga0068853_100187905 | 3300005539 | Bacteria | 1876 |
| 24 | Ga0068857_100113525 | 3300005577 | Bacteria | 2436 |
| 25 | Ga0068856_100096775 | 3300005614 | Bacteria | 2940 |
| 26 | Ga0070702_100007000 | 3300005615 | Bacteria | 5375 |
| 27 | Ga0068852_100374232 | 3300005616 | Bacteria | 1396 |
| 28 | Ga0068852_100413543 | 3300005616 | Bacteria | 1329 |
| 29 | Ga0068866_10005390 | 3300005718 | Bacteria | 5278 |
| 30 | Ga0068863_100292875 | 3300005841 | Bacteria | 1578 |
| 31 | Ga0081455_10009008 | 3300005937 | Bacteria | 10304 |
| 32 | Ga0081455_10028270 | 3300005937 | Bacteria | 5125 |
| 33 | Ga0081455_10029816 | 3300005937 | Bacteria | 4969 |
| 34 | Ga0081455_10099706 | 3300005937 | Bacteria | 2336 |
| 35 | Ga0081455_10127409 | 3300005937 | Bacteria | 1995 |
| 36 | Ga0081455_10175151 | 3300005937 | Bacteria | 1630 |
| 37 | Ga0081538_10000380 | 3300005981 | Bacteria | 50675 |
| 38 | Ga0081540_1003138 | 3300005983 | Bacteria | 13214 |
| 39 | Ga0081539_10008851 | 3300005985 | Bacteria | 8606 |
| 40 | Ga0081539_10014214 | 3300005985 | Bacteria | 5910 |
| 41 | Ga0075363_100041619 | 3300006048 | Bacteria | 2424 |
| 42 | Ga0075363_100047226 | 3300006048 | Bacteria | 2286 |
| 43 | Ga0075364_10014506 | 3300006051 | Bacteria | 4871 |
| 44 | Ga0075364_10037825 | 3300006051 | Bacteria | 3127 |
| 45 | Ga0075432_10000008 | 3300006058 | Bacteria | 38971 |
| 46 | Ga0075432_10000239 | 3300006058 | Bacteria | 14797 |
| 47 | Ga0075369_10029523 | 3300006186 | Bacteria | 2304 |
| 48 | Ga0075370_10012472 | 3300006353 | Bacteria | 4492 |
| 49 | Ga0075370_10071030 | 3300006353 | Bacteria | 1992 |
| 50 | Ga0075370_10162439 | 3300006353 | Bacteria | 1311 |
| 51 | Ga0075428_100004182 | 3300006844 | Bacteria | 15891 |
| 52 | Ga0075428_100142575 | 3300006844 | Bacteria | 2605 |
| 53 | Ga0075431_100023469 | 3300006847 | Bacteria | 6311 |
| 54 | Ga0075433_10000294 | 3300006852 | Bacteria | 29844 |
| 55 | Ga0075433_10004230 | 3300006852 | Bacteria | 11147 |
| 56 | Ga0075434_100000444 | 3300006871 | Bacteria | 30784 |
| 57 | Ga0075434_100007845 | 3300006871 | Bacteria | 9890 |
| 58 | Ga0075429_100057032 | 3300006880 | Bacteria | 3400 |
| 59 | Ga0068865_100049393 | 3300006881 | Bacteria | 2900 |
| 60 | Ga0075436_100001315 | 3300006914 | Bacteria | 16891 |
| 61 | Ga0075435_100009776 | 3300007076 | Bacteria | 6978 |
| 62 | Ga0075435_100050612 | 3300007076 | Bacteria | 3344 |
| 63 | Ga0105251_10120232 | 3300009011 | Bacteria | 1193 |
| 64 | Ga0111539_10016671 | 3300009094 | Bacteria | 9104 |
| 65 | Ga0111539_10042444 | 3300009094 | Bacteria | 5461 |
| 66 | Ga0105245_10165308 | 3300009098 | Bacteria | 2103 |
| 67 | Ga0105245_10208948 | 3300009098 | Bacteria | 1878 |
| 68 | Ga0105245_10272146 | 3300009098 | Bacteria | 1652 |
| 69 | Ga0114129_10007635 | 3300009147 | Bacteria | 15388 |
| 70 | Ga0114129_10623846 | 3300009147 | Bacteria | 1394 |
| 71 | Ga0105243_10001026 | 3300009148 | Bacteria | 25748 |
| 72 | Ga0105243_10010702 | 3300009148 | Bacteria | 6950 |
| 73 | Ga0105243_10172910 | 3300009148 | Bacteria | 1872 |
| 74 | Ga0105242_10029874 | 3300009176 | Bacteria | 4350 |
| 75 | Ga0105242_10033249 | 3300009176 | Bacteria | 4128 |
| 76 | Ga0105249_10047639 | 3300009553 | Bacteria | 3906 |
| 77 | Ga0105249_10148751 | 3300009553 | Bacteria | 2252 |
| 78 | Ga0105249_10512743 | 3300009553 | Bacteria | 1246 |
| 79 | Ga0105239_10335190 | 3300010375 | Bacteria | 1707 |
| 80 | Ga0157371_10063370 | 3300013102 | Bacteria | 2620 |
| 81 | Ga0157370_10120004 | 3300013104 | Bacteria | 2455 |
| 82 | Ga0157369_10078298 | 3300013105 | Bacteria | 3542 |
| 83 | Ga0157369_10616135 | 3300013105 | Bacteria | 1120 |
| 84 | Ga0157378_10085776 | 3300013297 | Bacteria | 2853 |
| 85 | Ga0163162_10098288 | 3300013306 | Bacteria | 3016 |
| 86 | Ga0157372_10091846 | 3300013307 | Bacteria | 3453 |
| 87 | Ga0157372_10100272 | 3300013307 | Bacteria | 3305 |
| 88 | Ga0157372_10210192 | 3300013307 | Bacteria | 2255 |
| 89 | Ga0157375_10082397 | 3300013308 | Bacteria | 3259 |
| 90 | Ga0157375_10091297 | 3300013308 | Bacteria | 3107 |
| 91 | Ga0157375_10369724 | 3300013308 | Bacteria | 1600 |
| 92 | Ga0157380_10008855 | 3300014326 | Bacteria | 7192 |
| 93 | Ga0157380_10298514 | 3300014326 | Bacteria | 1483 |
| 94 | Ga0157380_10585117 | 3300014326 | Bacteria | 1101 |
| 95 | Ga0157376_10676198 | 3300014969 | Bacteria | 1035 |
| 96 | Ga0163161_10104718 | 3300017792 | Bacteria | 2109 |
| 97 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 98 | Ga0207688_10004056 | 3300025901 | Bacteria | 7978 |
| 99 | Ga0207688_10087187 | 3300025901 | Bacteria | 1789 |
| 100 | Ga0207688_10110805 | 3300025901 | Bacteria | 1593 |
| 101 | Ga0207647_10035764 | 3300025904 | Bacteria | 3162 |
| 102 | Ga0207657_10272529 | 3300025919 | Bacteria | 1345 |
| 103 | Ga0207652_10205460 | 3300025921 | Bacteria | 1773 |
| 104 | Ga0207681_10145056 | 3300025923 | Bacteria | 1773 |
| 105 | Ga0207650_10225505 | 3300025925 | Bacteria | 1510 |
| 106 | Ga0207706_10004652 | 3300025933 | Bacteria | 12861 |
| 107 | Ga0207686_10014788 | 3300025934 | Bacteria | 4354 |
| 108 | Ga0207686_10017586 | 3300025934 | Bacteria | 4032 |
| 109 | Ga0207709_10001922 | 3300025935 | Bacteria | 13650 |
| 110 | Ga0207709_10048666 | 3300025935 | Bacteria | 2584 |
| 111 | Ga0207709_10158788 | 3300025935 | Bacteria | 1574 |
| 112 | Ga0207689_10042899 | 3300025942 | Bacteria | 3740 |
| 113 | Ga0207661_10211946 | 3300025944 | Bacteria | 1708 |
| 114 | Ga0207712_10153139 | 3300025961 | Bacteria | 1783 |
| 115 | Ga0207712_10320291 | 3300025961 | Bacteria | 1279 |
| 116 | Ga0207677_10648106 | 3300026023 | Bacteria | 932 |
| 117 | Ga0207639_10018244 | 3300026041 | Bacteria | 4984 |
| 118 | Ga0207678_10088173 | 3300026067 | Bacteria | 2652 |
| 119 | Ga0207678_10206493 | 3300026067 | Bacteria | 1680 |
| 120 | Ga0207702_10030199 | 3300026078 | Bacteria | 4516 |
| 121 | Ga0207641_10040462 | 3300026088 | Bacteria | 3904 |
| 122 | Ga0207674_10010418 | 3300026116 | Bacteria | 10533 |
| 123 | Ga0207674_10043716 | 3300026116 | Bacteria | 4618 |
| 124 | Ga0207683_10268411 | 3300026121 | Bacteria | 1559 |
| 125 | Ga0207698_10042665 | 3300026142 | Bacteria | 3391 |
| 126 | Ga0207428_10000346 | 3300027907 | Bacteria | 60257 |
| 127 | Ga0207428_10001581 | 3300027907 | Bacteria | 23705 |
| 128 | Ga0268264_10440741 | 3300028381 | Bacteria | 1260 |
| 129 | Ga0307515_10219837 | 3300028794 | Bacteria | 1721 |
| 130 | Ga0265327_10000131 | 3300031251 | Bacteria | 164189 |
| 131 | Ga0307513_10102662 | 3300031456 | Bacteria | 2878 |
| 132 | Ga0307408_100012139 | 3300031548 | Bacteria | 5703 |
| 133 | Ga0307516_10301549 | 3300031730 | Bacteria | 1278 |
| 134 | Ga0307405_10037872 | 3300031731 | Bacteria | 2902 |
| 135 | Ga0307405_10084463 | 3300031731 | Bacteria | 2084 |
| 136 | Ga0307413_10001251 | 3300031824 | Bacteria | 9466 |
| 137 | Ga0307410_10000043 | 3300031852 | Bacteria | 43864 |
| 138 | Ga0307410_10000686 | 3300031852 | Bacteria | 14117 |
| 139 | Ga0307410_10087233 | 3300031852 | Bacteria | 2206 |
| 140 | Ga0307410_10295473 | 3300031852 | Bacteria | 1276 |
| 141 | Ga0307406_10000008 | 3300031901 | Bacteria | 120233 |
| 142 | Ga0307406_10045042 | 3300031901 | Bacteria | 2767 |
| 143 | Ga0307407_10000280 | 3300031903 | Bacteria | 15048 |
| 144 | Ga0307407_10049104 | 3300031903 | Bacteria | 2406 |
| 145 | Ga0307407_10054590 | 3300031903 | Bacteria | 2305 |
| 146 | Ga0307407_10068582 | 3300031903 | Bacteria | 2101 |
| 147 | Ga0307407_10068908 | 3300031903 | Bacteria | 2098 |
| 148 | Ga0307407_10082569 | 3300031903 | Bacteria | 1948 |
| 149 | Ga0307407_10244634 | 3300031903 | Bacteria | 1226 |
| 150 | Ga0307412_10013192 | 3300031911 | Bacteria | 4837 |
| 151 | Ga0307409_100000014 | 3300031995 | Bacteria | 62867 |
| 152 | Ga0307409_100004869 | 3300031995 | Bacteria | 7630 |
| 153 | Ga0307409_100011859 | 3300031995 | Bacteria | 5520 |
| 154 | Ga0307409_100014546 | 3300031995 | Bacteria | 5125 |
| 155 | Ga0307409_100175446 | 3300031995 | Bacteria | 1891 |
| 156 | Ga0307409_100275106 | 3300031995 | Bacteria | 1553 |
| 157 | Ga0307416_100000088 | 3300032002 | Bacteria | 62911 |
| 158 | Ga0307416_100005660 | 3300032002 | Bacteria | 7716 |
| 159 | Ga0307416_100008033 | 3300032002 | Bacteria | 6762 |
| 160 | Ga0307416_100011774 | 3300032002 | Bacteria | 5858 |
| 161 | Ga0307416_100041061 | 3300032002 | Bacteria | 3600 |
| 162 | Ga0307414_10044143 | 3300032004 | Bacteria | 3041 |
| 163 | Ga0307411_10002933 | 3300032005 | Bacteria | 7737 |
| 164 | Ga0307411_10177451 | 3300032005 | Bacteria | 1613 |
| 165 | Ga0307411_10212079 | 3300032005 | Bacteria | 1496 |
| 166 | Ga0307415_100000783 | 3300032126 | Bacteria | 14410 |
| 167 | Ga0307415_100014180 | 3300032126 | Bacteria | 4677 |
| 168 | Ga0307415_100122950 | 3300032126 | Bacteria | 1950 |
| 169 | Ga0307507_10035240 | 3300033179 | Bacteria | 5145 |
| 170 | Ga0373956_0002488 | 3300035119 | Bacteria | 7499 |
| 171 | Ga0373931_0178626 | 3300035691 | Bacteria | 1256 |
| 172 | Ga0316584_0067861 | 3300036712 | Bacteria | 2673 |
| 173 | Ga0395900_0011779 | 3300037418 | Bacteria | 8943 |
| 174 | Ga0395898_0004389 | 3300037466 | Bacteria | 15427 |
| 175 | Ga0395898_0205021 | 3300037466 | Bacteria | 1882 |
| 176 | Ga0395901_0006313 | 3300038443 | Bacteria | 12007 |
| 177 | Ga0395901_0137849 | 3300038443 | Bacteria | 2564 |
| 178 | Ga0395901_0156421 | 3300038443 | Bacteria | 2394 |
| 179 | Ga0439465_0019075 | 3300041413 | Bacteria | 2144 |
| 180 | Ga0451843_0367205 | 3300041509 | Bacteria | 2900 |
| 181 | Ga0451853_1145375 | 3300041512 | Bacteria | 3733 |
| 182 | Ga0439450_011672 | 3300042008 | Bacteria | 1726 |
| 183 | Ga0439463_018380 | 3300042016 | Bacteria | 1740 |
| 184 | Ga0439435_0046525 | 3300042436 | Bacteria | 1229 |
| 185 | Ga0439460_0038180 | 3300042461 | Bacteria | 1400 |
| 186 | Ga0439460_0039556 | 3300042461 | Bacteria | 1379 |
| 187 | Ga0466966_0048208 | 3300044684 | Bacteria | 2714 |
| 188 | Ga0453684_0108600 | 3300044712 | Bacteria | 3376 |
| 189 | Ga0466971_0068297 | 3300044719 | Bacteria | 1612 |
| 190 | Ga0466960_0051232 | 3300044901 | Bacteria | 1993 |
| 191 | Ga0466967_0013385 | 3300045976 | Bacteria | 6337 |
| 192 | Ga0495580_0277245 | 3300046472 | Bacteria | 1144 |
| 193 | Ga0495582_0014724 | 3300046473 | Bacteria | 4299 |
| 194 | Ga0495606_0143478 | 3300046507 | Bacteria | 1408 |
| 195 | Ga0495620_0028314 | 3300046515 | Bacteria | 2608 |
| 196 | Ga0495631_0179613 | 3300046518 | Bacteria | 907 |
| 197 | Ga0495652_0270323 | 3300046529 | Bacteria | 1250 |
| 198 | Ga0495665_0015113 | 3300046531 | Bacteria | 4161 |
| 199 | Ga0495645_0029914 | 3300046543 | Bacteria | 3967 |
| 200 | Ga0495667_0127020 | 3300046559 | Bacteria | 1645 |
| 201 | Ga0495656_0037645 | 3300046615 | Bacteria | 2000 |
| 202 | Ga0495625_0068883 | 3300046660 | Bacteria | 2487 |
| 203 | Ga0495625_0139857 | 3300046660 | Bacteria | 1634 |
| 204 | Ga0495588_0072088 | 3300046674 | Bacteria | 1797 |
| 205 | Ga0495657_0110899 | 3300046675 | Bacteria | 1738 |
| 206 | Ga0495658_0141370 | 3300046683 | Bacteria | 1472 |
| 207 | Ga0495600_0056403 | 3300046809 | Bacteria | 2567 |
| 208 | Ga0495581_0013855 | 3300047315 | Bacteria | 4674 |
| 209 | Ga0495680_0055790 | 3300047322 | Bacteria | 3063 |
| 210 | Ga0495683_0000245 | 3300047323 | Bacteria | 48819 |
| 211 | Ga0496101_0106909 | 3300048904 | Bacteria | 2102 |
| 212 | Ga0496101_0211345 | 3300048904 | Bacteria | 1503 |
| 213 | Ga0496102_0006103 | 3300048905 | Bacteria | 10271 |
| 214 | Ga0496102_0025393 | 3300048905 | Bacteria | 5274 |
| 215 | Ga0496103_0138120 | 3300048906 | Bacteria | 1558 |
| 216 | Ga0496104_0207738 | 3300048907 | Bacteria | 1870 |
| 217 | Ga0496105_0005893 | 3300048908 | Bacteria | 9346 |
| 218 | Ga0496105_0229467 | 3300048908 | Bacteria | 1509 |
| 219 | Ga0496106_0330248 | 3300048909 | Bacteria | 1224 |
| 220 | Ga0496108_0046088 | 3300048911 | Bacteria | 3642 |
| 221 | Ga0496110_0035929 | 3300048913 | Bacteria | 4302 |
| 222 | Ga0496113_0376847 | 3300048916 | Bacteria | 1139 |
| 223 | Ga0496114_0026673 | 3300048917 | Bacteria | 4732 |
| 224 | Ga0496114_0043622 | 3300048917 | Bacteria | 3719 |
| 225 | Ga0496114_0164644 | 3300048917 | Bacteria | 1930 |
| 226 | Ga0496126_0266553 | 3300048929 | Bacteria | 1423 |
| 227 | Ga0501310_003352 | 3300049130 | Bacteria | 1562 |
| 228 | Ga0501321_001402 | 3300049537 | Bacteria | 1904 |
| 229 | Ga0501325_000320 | 3300049541 | Bacteria | 2136 |
| 230 | Ga0501031_0018846 | 3300049568 | Bacteria | 4493 |
| 231 | Ga0501033_0102691 | 3300049570 | Bacteria | 2085 |
| 232 | Ga0501036_0280141 | 3300049572 | Bacteria | 1395 |
| 233 | Ga0501038_0039460 | 3300049574 | Bacteria | 4130 |
| 234 | Ga0501039_0104577 | 3300049575 | Bacteria | 2210 |
| 235 | Ga0501040_0024040 | 3300049576 | Bacteria | 4088 |
| 236 | Ga0501041_0032734 | 3300049577 | Bacteria | 3142 |
| 237 | Ga0501042_0047924 | 3300049578 | Bacteria | 3046 |
| 238 | Ga0501043_0073535 | 3300049579 | Bacteria | 2685 |
| 239 | Ga0501046_0064699 | 3300049580 | Bacteria | 2854 |
| 240 | Ga0501048_0049562 | 3300049582 | Bacteria | 2992 |
| 241 | Ga0501071_0032463 | 3300049587 | Bacteria | 3707 |
| 242 | Ga0501072_0260023 | 3300049588 | Bacteria | 1382 |
| 243 | Ga0501074_0124256 | 3300049590 | Bacteria | 1845 |
| 244 | Ga0501075_0061486 | 3300049591 | Bacteria | 2830 |
| 245 | Ga0501076_0074512 | 3300049592 | Bacteria | 2719 |
| 246 | Ga0501077_0033579 | 3300049593 | Bacteria | 3266 |
| 247 | Ga0501079_0042766 | 3300049741 | Bacteria | 3498 |
| 248 | Ga0501080_0060833 | 3300049742 | Bacteria | 3516 |
| 249 | Ga0501081_0046776 | 3300049743 | Bacteria | 2975 |
| 250 | Ga0501035_0079382 | 3300049822 | Bacteria | 2899 |
| 251 | Ga0501044_0003096 | 3300049823 | Bacteria | 18834 |
| 252 | Ga0501045_0003413 | 3300049824 | Bacteria | 10869 |
| 253 | nmdc:mga03n38_37548_c1 | 3300050490 | Bacteria | 2090 |
| 254 | nmdc:mga00v17_61243_c1 | 3300050491 | Bacteria | 2313 |
| 255 | nmdc:mga06z11_52324_c1 | 3300050494 | Bacteria | 2094 |
| 256 | nmdc:mga07m45_6845_c1 | 3300050496 | Bacteria | 5795 |
| 257 | nmdc:mga05p37_10046_c1 | 3300050507 | Bacteria | 11232 |
| 258 | nmdc:mga09592_108491_c1 | 3300050508 | Bacteria | 2381 |
| 259 | nmdc:mga0qj67_71115_c1 | 3300050509 | Bacteria | 2776 |
| 260 | nmdc:mga06r32_38693_c1 | 3300050510 | Bacteria | 4521 |
| 261 | nmdc:mga08y16_28321_c1 | 3300050511 | Bacteria | 5906 |
| 262 | nmdc:mga08y16_8050_c1 | 3300050511 | Bacteria | 11031 |
| 263 | nmdc:mga0n895_3217_c1 | 3300050512 | Bacteria | 13076 |
| 264 | nmdc:mga0n895_5412_c1 | 3300050512 | Bacteria | 10665 |
| 265 | nmdc:mga0rr50_12544_c1 | 3300050513 | Bacteria | 5484 |
| 266 | nmdc:mga0rr50_38107_c1 | 3300050513 | Bacteria | 3476 |
| 267 | nmdc:mga08x19_3050_c1 | 3300050514 | Bacteria | 10071 |
| 268 | nmdc:mga0a205_2560_c1 | 3300050515 | Bacteria | 16032 |
| 269 | nmdc:mga0a205_516_c1 | 3300050515 | Bacteria | 30318 |
| 270 | nmdc:mga0sz30_1354_c2 | 3300050516 | Bacteria | 4382 |
| 271 | Ga0495619_0460761 | 3300053085 | Bacteria | 876 |
| 272 | Ga0500616_0001111 | 3300053153 | Bacteria | 27803 |
| 273 | Ga0530510_0045939 | 3300061734 | Bacteria | 3155 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046515 | Ga0495620_0028314 | Ga0495620_0028314_36_797 | 235 |
| 2 | 3300053085 | Ga0495619_0460761 | Ga0495619_0460761_28_789 | 235 |
| 3 | 3300046518 | Ga0495631_0179613 | Ga0495631_0179613_69_884 | 253 |
| 4 | 3300046660 | Ga0495625_0139857 | Ga0495625_0139857_243_1163 | 257 |
| 5 | 3300013105 | Ga0157369_10078298 | Ga0157369_100782982 | 258 |
| 6 | 3300045976 | Ga0466967_0013385 | Ga0466967_0013385_1664_2515 | 260 |
| 7 | 3300031548 | Ga0307408_100012139 | Ga0307408_1000121392 | 262 |
| 8 | 3300031852 | Ga0307410_10000043 | Ga0307410_1000004336 | 262 |
| 9 | 3300031901 | Ga0307406_10000008 | Ga0307406_10000008108 | 262 |
| 10 | 3300031903 | Ga0307407_10054590 | Ga0307407_100545902 | 262 |
| 11 | 3300031995 | Ga0307409_100000014 | Ga0307409_10000001426 | 262 |
| 12 | 3300032002 | Ga0307416_100000088 | Ga0307416_10000008815 | 262 |
| 13 | 3300032005 | Ga0307411_10212079 | Ga0307411_102120791 | 262 |
| 14 | 3300032126 | Ga0307415_100000783 | Ga0307415_1000007839 | 262 |
| 15 | 3300031903 | Ga0307407_10082569 | Ga0307407_100825692 | 263 |
| 16 | 3300044712 | Ga0453684_0108600 | Ga0453684_0108600_1585_2457 | 263 |
| 17 | 3300005331 | Ga0070670_100432611 | Ga0070670_1004326111 | 264 |
| 18 | 3300028381 | Ga0268264_10440741 | Ga0268264_104407412 | 264 |
| 19 | 3300013104 | Ga0157370_10120004 | Ga0157370_101200042 | 265 |
| 20 | 3300013105 | Ga0157369_10616135 | Ga0157369_106161352 | 265 |
| 21 | 3300013307 | Ga0157372_10091846 | Ga0157372_100918461 | 265 |
| 22 | 3300048907 | Ga0496104_0207738 | Ga0496104_0207738_328_1251 | 265 |
| 23 | 3300048908 | Ga0496105_0005893 | Ga0496105_0005893_5626_6549 | 265 |
| 24 | 3300048913 | Ga0496110_0035929 | Ga0496110_0035929_1018_1941 | 265 |
| 25 | 3300006353 | Ga0075370_10071030 | Ga0075370_100710302 | 266 |
| 26 | 3300009011 | Ga0105251_10120232 | Ga0105251_101202321 | 268 |
| 27 | 3300009148 | Ga0105243_10001026 | Ga0105243_1000102612 | 268 |
| 28 | 3300009553 | Ga0105249_10148751 | Ga0105249_101487512 | 268 |
| 29 | 3300014969 | Ga0157376_10676198 | Ga0157376_106761982 | 268 |
| 30 | 3300025935 | Ga0207709_10001922 | Ga0207709_100019225 | 268 |
| 31 | 3300025961 | Ga0207712_10153139 | Ga0207712_101531392 | 268 |
| 32 | 3300026067 | Ga0207678_10088173 | Ga0207678_100881732 | 268 |
| 33 | 3300031731 | Ga0307405_10084463 | Ga0307405_100844632 | 268 |
| 34 | 3300031852 | Ga0307410_10087233 | Ga0307410_100872332 | 268 |
| 35 | 3300031901 | Ga0307406_10045042 | Ga0307406_100450425 | 268 |
| 36 | 3300031903 | Ga0307407_10049104 | Ga0307407_100491042 | 268 |
| 37 | 3300031995 | Ga0307409_100004869 | Ga0307409_1000048698 | 268 |
| 38 | 3300032002 | Ga0307416_100041061 | Ga0307416_1000410613 | 268 |
| 39 | 3300001989 | JGI24739J22299_10082106 | JGI24739J22299_100821061 | 269 |
| 40 | 3300005937 | Ga0081455_10029816 | Ga0081455_100298162 | 269 |
| 41 | 3300006353 | Ga0075370_10162439 | Ga0075370_101624391 | 269 |
| 42 | 3300013308 | Ga0157375_10369724 | Ga0157375_103697242 | 269 |
| 43 | 3300009147 | Ga0114129_10623846 | Ga0114129_106238462 | 270 |
| 44 | 3300026023 | Ga0207677_10648106 | Ga0207677_106481061 | 270 |
| 45 | iso_pu_bacteria | 2811994882 | 2812373223 | 270 |
| 46 | 3300005937 | Ga0081455_10099706 | Ga0081455_100997063 | 271 |
| 47 | 3300005937 | Ga0081455_10175151 | Ga0081455_101751512 | 271 |
| 48 | 3300006058 | Ga0075432_10000008 | Ga0075432_100000082 | 271 |
| 49 | 3300006844 | Ga0075428_100142575 | Ga0075428_1001425752 | 271 |
| 50 | 3300006852 | Ga0075433_10000294 | Ga0075433_1000029421 | 271 |
| 51 | 3300006871 | Ga0075434_100000444 | Ga0075434_10000044412 | 271 |
| 52 | 3300006914 | Ga0075436_100001315 | Ga0075436_1000013152 | 271 |
| 53 | 3300007076 | Ga0075435_100050612 | Ga0075435_1000506123 | 271 |
| 54 | 3300009094 | Ga0111539_10042444 | Ga0111539_100424441 | 271 |
| 55 | 3300027907 | Ga0207428_10000346 | Ga0207428_1000034651 | 271 |
| 56 | 3300041509 | Ga0451843_0367205 | Ga0451843_0367205_529_1491 | 271 |
| 57 | 3300049823 | Ga0501044_0003096 | Ga0501044_0003096_17052_17969 | 271 |
| 58 | 3300050511 | nmdc:mga08y16_28321_c1 | nmdc:mga08y16_28321_c1_3436_4338 | 271 |
| 59 | 3300050512 | nmdc:mga0n895_3217_c1 | nmdc:mga0n895_3217_c1_9338_10240 | 271 |
| 60 | 3300050513 | nmdc:mga0rr50_12544_c1 | nmdc:mga0rr50_12544_c1_2458_3360 | 271 |
| 61 | 3300050514 | nmdc:mga08x19_3050_c1 | nmdc:mga08x19_3050_c1_7671_8573 | 271 |
| 62 | 3300050515 | nmdc:mga0a205_516_c1 | nmdc:mga0a205_516_c1_16100_17002 | 271 |
| 63 | 3300003373 | JGI25407J50210_10003138 | JGI25407J50210_100031382 | 272 |
| 64 | 3300005981 | Ga0081538_10000380 | Ga0081538_1000038043 | 272 |
| 65 | 3300036712 | Ga0316584_0067861 | Ga0316584_0067861_1224_2129 | 272 |
| 66 | 3300037418 | Ga0395900_0011779 | Ga0395900_0011779_6824_7759 | 272 |
| 67 | 3300037466 | Ga0395898_0004389 | Ga0395898_0004389_8207_9142 | 272 |
| 68 | 3300038443 | Ga0395901_0006313 | Ga0395901_0006313_1216_2151 | 272 |
| 69 | iso_pu_bacteria | 2919446982 | 2919448278 | 272 |
| 70 | 3300005841 | Ga0068863_100292875 | Ga0068863_1002928752 | 273 |
| 71 | 3300026088 | Ga0207641_10040462 | Ga0207641_100404623 | 273 |
| 72 | 3300035119 | Ga0373956_0002488 | Ga0373956_0002488_6032_6937 | 273 |
| 73 | 3300042461 | Ga0439460_0039556 | Ga0439460_0039556_110_1018 | 273 |
| 74 | iso_pu_bacteria | 2734482000 | 2734969177 | 273 |
| 75 | 3300005530 | Ga0070679_100365018 | Ga0070679_1003650182 | 274 |
| 76 | 3300005539 | Ga0068853_100187905 | Ga0068853_1001879052 | 274 |
| 77 | 3300026041 | Ga0207639_10018244 | Ga0207639_100182442 | 274 |
| 78 | 3300026142 | Ga0207698_10042665 | Ga0207698_100426653 | 274 |
| 79 | 3300042008 | Ga0439450_011672 | Ga0439450_011672_429_1340 | 274 |
| 80 | 3300042436 | Ga0439435_0046525 | Ga0439435_0046525_189_1100 | 274 |
| 81 | 3300048904 | Ga0496101_0211345 | Ga0496101_0211345_454_1368 | 274 |
| 82 | 3300048909 | Ga0496106_0330248 | Ga0496106_0330248_50_964 | 274 |
| 83 | iso_pu_bacteria | 2643221679 | 2644446940 | 274 |
| 84 | iso_pu_bacteria | 2808606365 | 2808871903 | 275 |
| 85 | 3300001989 | JGI24739J22299_10027058 | JGI24739J22299_100270582 | 276 |
| 86 | 3300009148 | Ga0105243_10172910 | Ga0105243_101729102 | 276 |
| 87 | 3300025935 | Ga0207709_10158788 | Ga0207709_101587882 | 276 |
| 88 | 3300005329 | Ga0070683_100111758 | Ga0070683_1001117582 | 277 |
| 89 | 3300005577 | Ga0068857_100113525 | Ga0068857_1001135252 | 277 |
| 90 | 3300025919 | Ga0207657_10272529 | Ga0207657_102725292 | 277 |
| 91 | 3300025944 | Ga0207661_10211946 | Ga0207661_102119461 | 277 |
| 92 | 3300026116 | Ga0207674_10010418 | Ga0207674_100104187 | 277 |
| 93 | 3300028794 | Ga0307515_10219837 | Ga0307515_102198372 | 277 |
| 94 | 3300031730 | Ga0307516_10301549 | Ga0307516_103015492 | 277 |
| 95 | 3300031852 | Ga0307410_10295473 | Ga0307410_102954731 | 277 |
| 96 | 3300031903 | Ga0307407_10244634 | Ga0307407_102446342 | 277 |
| 97 | 3300031995 | Ga0307409_100275106 | Ga0307409_1002751062 | 277 |
| 98 | 3300048905 | Ga0496102_0006103 | Ga0496102_0006103_8429_9403 | 277 |
| 99 | 3300048917 | Ga0496114_0043622 | Ga0496114_0043622_1932_2906 | 277 |
| 100 | 3300048917 | Ga0496114_0164644 | Ga0496114_0164644_551_1462 | 277 |
| 101 | 3300053153 | Ga0500616_0001111 | Ga0500616_0001111_25860_26771 | 277 |
| 102 | iso_pu_bacteria | 2551306166 | 2552105585 | 277 |
| 103 | iso_pu_bacteria | 2919713450 | 2919717875 | 277 |
| 104 | 3300005327 | Ga0070658_10432198 | Ga0070658_104321981 | 278 |
| 105 | 3300005334 | Ga0068869_100062765 | Ga0068869_1000627651 | 278 |
| 106 | 3300005614 | Ga0068856_100096775 | Ga0068856_1000967753 | 278 |
| 107 | 3300005983 | Ga0081540_1003138 | Ga0081540_10031388 | 278 |
| 108 | 3300005985 | Ga0081539_10008851 | Ga0081539_100088515 | 278 |
| 109 | 3300005985 | Ga0081539_10014214 | Ga0081539_100142142 | 278 |
| 110 | 3300014326 | Ga0157380_10298514 | Ga0157380_102985142 | 278 |
| 111 | 3300025942 | Ga0207689_10042899 | Ga0207689_100428992 | 278 |
| 112 | 3300026078 | Ga0207702_10030199 | Ga0207702_100301993 | 278 |
| 113 | 3300031995 | Ga0307409_100175446 | Ga0307409_1001754462 | 278 |
| 114 | 3300048904 | Ga0496101_0106909 | Ga0496101_0106909_834_1757 | 278 |
| 115 | iso_pu_bacteria | 2565956761 | 2566995828 | 278 |
| 116 | iso_pu_bacteria | 2738541308 | 2738888678 | 278 |
| 117 | iso_pu_bacteria | 2738543011 | 2739237928 | 278 |
| 118 | iso_pu_bacteria | 2842134933 | 2842139535 | 278 |
| 119 | iso_pu_bacteria | 2889300758 | 2889303557 | 278 |
| 120 | iso_pu_bacteria | 2904535858 | 2904537619 | 278 |
| 121 | iso_pu_bacteria | 2922554459 | 2922558736 | 278 |
| 122 | iso_pu_bacteria | 2928142448 | 2928145404 | 278 |
| 123 | iso_pu_bacteria | 2939743619 | 2939747342 | 278 |
| 124 | 3300025921 | Ga0207652_10205460 | Ga0207652_102054603 | 279 |
| 125 | 3300035691 | Ga0373931_0178626 | Ga0373931_0178626_291_1205 | 279 |
| 126 | 3300037466 | Ga0395898_0205021 | Ga0395898_0205021_124_1155 | 279 |
| 127 | 3300038443 | Ga0395901_0137849 | Ga0395901_0137849_1268_2299 | 279 |
| 128 | 3300046473 | Ga0495582_0014724 | Ga0495582_0014724_2432_3355 | 279 |
| 129 | 3300046529 | Ga0495652_0270323 | Ga0495652_0270323_25_942 | 279 |
| 130 | 3300046543 | Ga0495645_0029914 | Ga0495645_0029914_1576_2493 | 279 |
| 131 | 3300046559 | Ga0495667_0127020 | Ga0495667_0127020_86_1003 | 279 |
| 132 | 3300046675 | Ga0495657_0110899 | Ga0495657_0110899_808_1725 | 279 |
| 133 | 3300046683 | Ga0495658_0141370 | Ga0495658_0141370_516_1439 | 279 |
| 134 | 3300046809 | Ga0495600_0056403 | Ga0495600_0056403_1059_1982 | 279 |
| 135 | 3300047322 | Ga0495680_0055790 | Ga0495680_0055790_1303_2220 | 279 |
| 136 | 3300048905 | Ga0496102_0025393 | Ga0496102_0025393_593_1516 | 279 |
| 137 | 3300048906 | Ga0496103_0138120 | Ga0496103_0138120_581_1504 | 279 |
| 138 | 3300048917 | Ga0496114_0026673 | Ga0496114_0026673_3631_4554 | 279 |
| 139 | iso_pu_bacteria | 2643221692 | 2644515570 | 279 |
| 140 | iso_pu_bacteria | 2738543034 | 2739364560 | 279 |
| 141 | iso_pu_bacteria | 2904765812 | 2904766742 | 279 |
| 142 | iso_pu_bacteria | 2904770941 | 2904775246 | 279 |
| 143 | iso_pu_bacteria | 2908811453 | 2908814436 | 279 |
| 144 | iso_pu_bacteria | 2919420072 | 2919420822 | 279 |
| 145 | iso_pu_bacteria | 2919432681 | 2919433420 | 279 |
| 146 | 3300005440 | Ga0070705_100048426 | Ga0070705_1000484262 | 280 |
| 147 | 3300005615 | Ga0070702_100007000 | Ga0070702_1000070003 | 280 |
| 148 | 3300005616 | Ga0068852_100413543 | Ga0068852_1004135432 | 280 |
| 149 | 3300009176 | Ga0105242_10029874 | Ga0105242_100298743 | 280 |
| 150 | 3300013297 | Ga0157378_10085776 | Ga0157378_100857762 | 280 |
| 151 | 3300013308 | Ga0157375_10082397 | Ga0157375_100823973 | 280 |
| 152 | 3300025934 | Ga0207686_10017586 | Ga0207686_100175864 | 280 |
| 153 | 3300031731 | Ga0307405_10037872 | Ga0307405_100378722 | 280 |
| 154 | 3300031852 | Ga0307410_10000686 | Ga0307410_1000068611 | 280 |
| 155 | 3300031903 | Ga0307407_10068908 | Ga0307407_100689082 | 280 |
| 156 | 3300031995 | Ga0307409_100011859 | Ga0307409_1000118592 | 280 |
| 157 | 3300032002 | Ga0307416_100011774 | Ga0307416_1000117744 | 280 |
| 158 | 3300032005 | Ga0307411_10177451 | Ga0307411_101774512 | 280 |
| 159 | 3300049568 | Ga0501031_0018846 | Ga0501031_0018846_1059_1979 | 280 |
| 160 | 3300049570 | Ga0501033_0102691 | Ga0501033_0102691_883_1803 | 280 |
| 161 | 3300049572 | Ga0501036_0280141 | Ga0501036_0280141_189_1109 | 280 |
| 162 | 3300049574 | Ga0501038_0039460 | Ga0501038_0039460_1068_1988 | 280 |
| 163 | 3300049575 | Ga0501039_0104577 | Ga0501039_0104577_140_1060 | 280 |
| 164 | 3300049576 | Ga0501040_0024040 | Ga0501040_0024040_2094_3014 | 280 |
| 165 | 3300049577 | Ga0501041_0032734 | Ga0501041_0032734_1080_2000 | 280 |
| 166 | 3300049578 | Ga0501042_0047924 | Ga0501042_0047924_1089_2009 | 280 |
| 167 | 3300049579 | Ga0501043_0073535 | Ga0501043_0073535_931_1851 | 280 |
| 168 | 3300049580 | Ga0501046_0064699 | Ga0501046_0064699_898_1818 | 280 |
| 169 | 3300049582 | Ga0501048_0049562 | Ga0501048_0049562_994_1914 | 280 |
| 170 | 3300049587 | Ga0501071_0032463 | Ga0501071_0032463_2273_3193 | 280 |
| 171 | 3300049588 | Ga0501072_0260023 | Ga0501072_0260023_43_963 | 280 |
| 172 | 3300049590 | Ga0501074_0124256 | Ga0501074_0124256_152_1072 | 280 |
| 173 | 3300049591 | Ga0501075_0061486 | Ga0501075_0061486_1102_2022 | 280 |
| 174 | 3300049592 | Ga0501076_0074512 | Ga0501076_0074512_951_1871 | 280 |
| 175 | 3300049593 | Ga0501077_0033579 | Ga0501077_0033579_1073_1993 | 280 |
| 176 | 3300049741 | Ga0501079_0042766 | Ga0501079_0042766_1474_2394 | 280 |
| 177 | 3300049742 | Ga0501080_0060833 | Ga0501080_0060833_1097_2017 | 280 |
| 178 | 3300049743 | Ga0501081_0046776 | Ga0501081_0046776_1008_1928 | 280 |
| 179 | 3300049822 | Ga0501035_0079382 | Ga0501035_0079382_1038_1958 | 280 |
| 180 | 3300049824 | Ga0501045_0003413 | Ga0501045_0003413_1092_2012 | 280 |
| 181 | 3300061734 | Ga0530510_0045939 | Ga0530510_0045939_1070_1990 | 280 |
| 182 | iso_pu_bacteria | 2675903058 | 2676477410 | 280 |
| 183 | iso_pu_bacteria | 2728369276 | 2729909325 | 280 |
| 184 | iso_pu_bacteria | 2744054611 | 2744955171 | 280 |
| 185 | iso_pu_bacteria | 2827628540 | 2827634667 | 280 |
| 186 | 3300005440 | Ga0070705_100066525 | Ga0070705_1000665252 | 281 |
| 187 | 3300009553 | Ga0105249_10512743 | Ga0105249_105127432 | 281 |
| 188 | 3300013308 | Ga0157375_10091297 | Ga0157375_100912972 | 281 |
| 189 | 3300025961 | Ga0207712_10320291 | Ga0207712_103202912 | 281 |
| 190 | 3300031456 | Ga0307513_10102662 | Ga0307513_101026622 | 281 |
| 191 | 3300038443 | Ga0395901_0156421 | Ga0395901_0156421_563_1558 | 281 |
| 192 | 3300044684 | Ga0466966_0048208 | Ga0466966_0048208_943_1890 | 281 |
| 193 | iso_pu_bacteria | 2515154155 | 2515856318 | 281 |
| 194 | iso_pu_bacteria | 2643221567 | 2643852282 | 281 |
| 195 | iso_pu_bacteria | 2643221624 | 2644136804 | 281 |
| 196 | iso_pu_bacteria | 2751185734 | 2753069689 | 281 |
| 197 | iso_pu_bacteria | 2775506925 | 2776371787 | 281 |
| 198 | iso_pu_bacteria | 2863067949 | 2863070081 | 281 |
| 199 | iso_pu_bacteria | 2866552031 | 2866555830 | 281 |
| 200 | iso_pu_bacteria | 2870721527 | 2870727803 | 281 |
| 201 | iso_pu_bacteria | 8047710418 | 8047716328 | 281 |
| 202 | iso_pu_bacteria | 8056207758 | 8056214061 | 281 |
| 203 | 3300005338 | Ga0068868_100370663 | Ga0068868_1003706631 | 282 |
| 204 | 3300005435 | Ga0070714_100117922 | Ga0070714_1001179222 | 282 |
| 205 | 3300005457 | Ga0070662_100021016 | Ga0070662_1000210163 | 282 |
| 206 | 3300005616 | Ga0068852_100374232 | Ga0068852_1003742321 | 282 |
| 207 | 3300005718 | Ga0068866_10005390 | Ga0068866_100053903 | 282 |
| 208 | 3300005937 | Ga0081455_10009008 | Ga0081455_1000900811 | 282 |
| 209 | 3300005937 | Ga0081455_10028270 | Ga0081455_100282703 | 282 |
| 210 | 3300006048 | Ga0075363_100047226 | Ga0075363_1000472263 | 282 |
| 211 | 3300006051 | Ga0075364_10014506 | Ga0075364_100145065 | 282 |
| 212 | 3300006058 | Ga0075432_10000239 | Ga0075432_100002399 | 282 |
| 213 | 3300006186 | Ga0075369_10029523 | Ga0075369_100295232 | 282 |
| 214 | 3300006353 | Ga0075370_10012472 | Ga0075370_100124725 | 282 |
| 215 | 3300006844 | Ga0075428_100004182 | Ga0075428_1000041826 | 282 |
| 216 | 3300006847 | Ga0075431_100023469 | Ga0075431_1000234693 | 282 |
| 217 | 3300006852 | Ga0075433_10004230 | Ga0075433_1000423011 | 282 |
| 218 | 3300006871 | Ga0075434_100007845 | Ga0075434_1000078456 | 282 |
| 219 | 3300006880 | Ga0075429_100057032 | Ga0075429_1000570323 | 282 |
| 220 | 3300006881 | Ga0068865_100049393 | Ga0068865_1000493932 | 282 |
| 221 | 3300007076 | Ga0075435_100009776 | Ga0075435_1000097764 | 282 |
| 222 | 3300009094 | Ga0111539_10016671 | Ga0111539_100166714 | 282 |
| 223 | 3300009098 | Ga0105245_10165308 | Ga0105245_101653082 | 282 |
| 224 | 3300009098 | Ga0105245_10208948 | Ga0105245_102089483 | 282 |
| 225 | 3300009147 | Ga0114129_10007635 | Ga0114129_100076353 | 282 |
| 226 | 3300009148 | Ga0105243_10010702 | Ga0105243_100107026 | 282 |
| 227 | 3300009176 | Ga0105242_10033249 | Ga0105242_100332492 | 282 |
| 228 | 3300009553 | Ga0105249_10047639 | Ga0105249_100476393 | 282 |
| 229 | 3300010375 | Ga0105239_10335190 | Ga0105239_103351902 | 282 |
| 230 | 3300013102 | Ga0157371_10063370 | Ga0157371_100633702 | 282 |
| 231 | 3300013306 | Ga0163162_10098288 | Ga0163162_100982883 | 282 |
| 232 | 3300013307 | Ga0157372_10100272 | Ga0157372_101002722 | 282 |
| 233 | 3300014326 | Ga0157380_10008855 | Ga0157380_100088556 | 282 |
| 234 | 3300017792 | Ga0163161_10104718 | Ga0163161_101047182 | 282 |
| 235 | 3300025901 | Ga0207688_10004056 | Ga0207688_100040565 | 282 |
| 236 | 3300025901 | Ga0207688_10087187 | Ga0207688_100871872 | 282 |
| 237 | 3300025923 | Ga0207681_10145056 | Ga0207681_101450562 | 282 |
| 238 | 3300025933 | Ga0207706_10004652 | Ga0207706_100046522 | 282 |
| 239 | 3300025934 | Ga0207686_10014788 | Ga0207686_100147882 | 282 |
| 240 | 3300025935 | Ga0207709_10048666 | Ga0207709_100486662 | 282 |
| 241 | 3300027907 | Ga0207428_10001581 | Ga0207428_1000158110 | 282 |
| 242 | 3300031824 | Ga0307413_10001251 | Ga0307413_100012517 | 282 |
| 243 | 3300031903 | Ga0307407_10000280 | Ga0307407_100002804 | 282 |
| 244 | 3300031903 | Ga0307407_10068582 | Ga0307407_100685822 | 282 |
| 245 | 3300031911 | Ga0307412_10013192 | Ga0307412_100131924 | 282 |
| 246 | 3300031995 | Ga0307409_100014546 | Ga0307409_1000145465 | 282 |
| 247 | 3300032002 | Ga0307416_100005660 | Ga0307416_1000056608 | 282 |
| 248 | 3300032002 | Ga0307416_100008033 | Ga0307416_1000080334 | 282 |
| 249 | 3300032004 | Ga0307414_10044143 | Ga0307414_100441432 | 282 |
| 250 | 3300032005 | Ga0307411_10002933 | Ga0307411_100029335 | 282 |
| 251 | 3300032126 | Ga0307415_100014180 | Ga0307415_1000141804 | 282 |
| 252 | 3300033179 | Ga0307507_10035240 | Ga0307507_100352402 | 282 |
| 253 | 3300041413 | Ga0439465_0019075 | Ga0439465_0019075_343_1245 | 282 |
| 254 | 3300042016 | Ga0439463_018380 | Ga0439463_018380_794_1696 | 282 |
| 255 | 3300042461 | Ga0439460_0038180 | Ga0439460_0038180_345_1247 | 282 |
| 256 | 3300044719 | Ga0466971_0068297 | Ga0466971_0068297_418_1350 | 282 |
| 257 | 3300044901 | Ga0466960_0051232 | Ga0466960_0051232_620_1552 | 282 |
| 258 | 3300046472 | Ga0495580_0277245 | Ga0495580_0277245_106_1014 | 282 |
| 259 | 3300046507 | Ga0495606_0143478 | Ga0495606_0143478_153_1055 | 282 |
| 260 | 3300046531 | Ga0495665_0015113 | Ga0495665_0015113_2337_3245 | 282 |
| 261 | 3300046615 | Ga0495656_0037645 | Ga0495656_0037645_958_1860 | 282 |
| 262 | 3300046674 | Ga0495588_0072088 | Ga0495588_0072088_218_1126 | 282 |
| 263 | 3300047315 | Ga0495581_0013855 | Ga0495581_0013855_2764_3672 | 282 |
| 264 | 3300047323 | Ga0495683_0000245 | Ga0495683_0000245_39740_40642 | 282 |
| 265 | 3300048911 | Ga0496108_0046088 | Ga0496108_0046088_121_1029 | 282 |
| 266 | 3300048929 | Ga0496126_0266553 | Ga0496126_0266553_190_1098 | 282 |
| 267 | 3300050494 | nmdc:mga06z11_52324_c1 | nmdc:mga06z11_52324_c1_729_1637 | 282 |
| 268 | 3300050496 | nmdc:mga07m45_6845_c1 | nmdc:mga07m45_6845_c1_2228_3136 | 282 |
| 269 | 3300050507 | nmdc:mga05p37_10046_c1 | nmdc:mga05p37_10046_c1_4227_5129 | 282 |
| 270 | 3300050508 | nmdc:mga09592_108491_c1 | nmdc:mga09592_108491_c1_1070_1972 | 282 |
| 271 | 3300050509 | nmdc:mga0qj67_71115_c1 | nmdc:mga0qj67_71115_c1_1396_2298 | 282 |
| 272 | 3300050510 | nmdc:mga06r32_38693_c1 | nmdc:mga06r32_38693_c1_3482_4384 | 282 |
| 273 | 3300050511 | nmdc:mga08y16_8050_c1 | nmdc:mga08y16_8050_c1_4301_5203 | 282 |
| 274 | 3300050512 | nmdc:mga0n895_5412_c1 | nmdc:mga0n895_5412_c1_1284_2186 | 282 |
| 275 | 3300050513 | nmdc:mga0rr50_38107_c1 | nmdc:mga0rr50_38107_c1_1494_2396 | 282 |
| 276 | 3300050515 | nmdc:mga0a205_2560_c1 | nmdc:mga0a205_2560_c1_12245_13147 | 282 |
| 277 | 3300050516 | nmdc:mga0sz30_1354_c2 | nmdc:mga0sz30_1354_c2_2772_3674 | 282 |
| 278 | 3300005329 | Ga0070683_100285082 | Ga0070683_1002850822 | 283 |
| 279 | 3300006048 | Ga0075363_100041619 | Ga0075363_1000416192 | 283 |
| 280 | 3300006051 | Ga0075364_10037825 | Ga0075364_100378254 | 283 |
| 281 | 3300031251 | Ga0265327_10000131 | Ga0265327_1000013179 | 283 |
| 282 | 3300041512 | Ga0451853_1145375 | Ga0451853_1145375_2550_3461 | 283 |
| 283 | 3300048908 | Ga0496105_0229467 | Ga0496105_0229467_532_1470 | 283 |
| 284 | 3300049130 | Ga0501310_003352 | Ga0501310_003352_399_1313 | 283 |
| 285 | 3300049537 | Ga0501321_001402 | Ga0501321_001402_562_1467 | 283 |
| 286 | 3300049541 | Ga0501325_000320 | Ga0501325_000320_803_1708 | 283 |
| 287 | 3300050490 | nmdc:mga03n38_37548_c1 | nmdc:mga03n38_37548_c1_749_1657 | 283 |
| 288 | 3300050491 | nmdc:mga00v17_61243_c1 | nmdc:mga00v17_61243_c1_1030_1938 | 283 |
| 289 | iso_pu_bacteria | 2784132109 | 2784473105 | 283 |
| 290 | 3300003792 | Ga0055540_1000071 | Ga0055540_100007141 | 284 |
| 291 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033272 | 284 |
| 292 | iso_pu_bacteria | 2974315732 | 2974318720 | 284 |
| 293 | 3300001979 | JGI24740J21852_10050723 | JGI24740J21852_100507231 | 285 |
| 294 | 3300005455 | Ga0070663_100425532 | Ga0070663_1004255321 | 285 |
| 295 | 3300013307 | Ga0157372_10210192 | Ga0157372_102101922 | 285 |
| 296 | 3300046660 | Ga0495625_0068883 | Ga0495625_0068883_865_1785 | 285 |
| 297 | 3300048916 | Ga0496113_0376847 | Ga0496113_0376847_141_1061 | 285 |
| 298 | iso_pu_bacteria | 2816332119 | 2816423228 | 285 |
| 299 | 3300005356 | Ga0070674_100267452 | Ga0070674_1002674522 | 286 |
| 300 | 3300025901 | Ga0207688_10110805 | Ga0207688_101108052 | 286 |
| 301 | 3300026067 | Ga0207678_10206493 | Ga0207678_102064932 | 286 |
| 302 | 3300026121 | Ga0207683_10268411 | Ga0207683_102684112 | 286 |
| 303 | 3300032126 | Ga0307415_100122950 | Ga0307415_1001229502 | 287 |
| 304 | 3300001979 | JGI24740J21852_10008599 | JGI24740J21852_100085992 | 288 |
| 305 | 3300001990 | JGI24737J22298_10002043 | JGI24737J22298_100020434 | 288 |
| 306 | 3300002067 | JGI24735J21928_10019708 | JGI24735J21928_100197082 | 288 |
| 307 | 3300005347 | Ga0070668_100210392 | Ga0070668_1002103922 | 288 |
| 308 | 3300005937 | Ga0081455_10127409 | Ga0081455_101274092 | 288 |
| 309 | 3300009098 | Ga0105245_10272146 | Ga0105245_102721462 | 288 |
| 310 | 3300014326 | Ga0157380_10585117 | Ga0157380_105851172 | 288 |
| 311 | 3300025904 | Ga0207647_10035764 | Ga0207647_100357644 | 288 |
| 312 | 3300025925 | Ga0207650_10225505 | Ga0207650_102255051 | 288 |
| 313 | 3300026116 | Ga0207674_10043716 | Ga0207674_100437165 | 288 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
142
341
0.81
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar