F402214

General Info

Members Datasets Scaffolds Average Seq Length
313 230 273 299

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10205460|Ga0207652_102054603
Length 343
Sequence MTIENPPASEPMLPAASHDLSVGPALVTSTPGAEPTSGRLTRSDVDRLLSPAGDRPILVATSGRRRLMDRAATVAMAVAFVLALVPLVWILATVVSKGGHLLVESGWWSETQRGITSRRVGGGALHAIVGTLLQAAVTAAISLPIGVLAAVYLVEYPRTKVSRAVSFMVDILTGVPSIVAALFVYALWVTTLGFQRVAFAVSLSLVLLMVPVVVRSTEEMLRLVPADLREASAALGVPTWRTVVSVVLPTAMSGIITGALLGLARVMGETAPLLILGPYTKQLATGLFGGPMATLPTMINQDRTEALAPAVDRVWAAALTLVLLVLLLNVLGRLVGRRHRVAA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
5 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
6 2643221679 Angustibacter sp. Root456 Isolate Unclassified
7 2643221692 Nocardia sp. Root136 Isolate Unclassified
8 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
9 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
10 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
11 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
12 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
16 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
17 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
18 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
19 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
20 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
21 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
22 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
23 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
24 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
25 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
26 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
27 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
28 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
29 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
30 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
31 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
32 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
33 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
34 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
35 2922554459 Rhodococcus sp. 66b Isolate Unclassified
36 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
37 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
38 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
149 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
161 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
230 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.26
Metatranscriptomes 0.96
Isolates 12.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 0.32
Rhizoplane 4.79
Rhizosphere 81.79
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10008599 3300001979 Bacteria 4054
2 JGI24740J21852_10050723 3300001979 Bacteria 1192
3 JGI24739J22299_10027058 3300001989 Bacteria 2007
4 JGI24739J22299_10082106 3300001989 Bacteria 989
5 JGI24737J22298_10002043 3300001990 Bacteria 7223
6 JGI24735J21928_10019708 3300002067 Bacteria 2072
7 JGI25407J50210_10003138 3300003373 Bacteria 3935
8 Ga0055540_1000071 3300003792 Bacteria 117607
9 Ga0070658_10432198 3300005327 Bacteria 1133
10 Ga0070683_100111758 3300005329 Bacteria 2578
11 Ga0070683_100285082 3300005329 Bacteria 1571
12 Ga0070670_100432611 3300005331 Bacteria 1164
13 Ga0068869_100062765 3300005334 Bacteria 2728
14 Ga0068868_100370663 3300005338 Bacteria 1230
15 Ga0070668_100210392 3300005347 Bacteria 1600
16 Ga0070674_100267452 3300005356 Bacteria 1350
17 Ga0070714_100117922 3300005435 Bacteria 2358
18 Ga0070705_100048426 3300005440 Bacteria 2462
19 Ga0070705_100066525 3300005440 Bacteria 2161
20 Ga0070663_100425532 3300005455 Bacteria 1090
21 Ga0070662_100021016 3300005457 Bacteria 4452
22 Ga0070679_100365018 3300005530 Bacteria 1391
23 Ga0068853_100187905 3300005539 Bacteria 1876
24 Ga0068857_100113525 3300005577 Bacteria 2436
25 Ga0068856_100096775 3300005614 Bacteria 2940
26 Ga0070702_100007000 3300005615 Bacteria 5375
27 Ga0068852_100374232 3300005616 Bacteria 1396
28 Ga0068852_100413543 3300005616 Bacteria 1329
29 Ga0068866_10005390 3300005718 Bacteria 5278
30 Ga0068863_100292875 3300005841 Bacteria 1578
31 Ga0081455_10009008 3300005937 Bacteria 10304
32 Ga0081455_10028270 3300005937 Bacteria 5125
33 Ga0081455_10029816 3300005937 Bacteria 4969
34 Ga0081455_10099706 3300005937 Bacteria 2336
35 Ga0081455_10127409 3300005937 Bacteria 1995
36 Ga0081455_10175151 3300005937 Bacteria 1630
37 Ga0081538_10000380 3300005981 Bacteria 50675
38 Ga0081540_1003138 3300005983 Bacteria 13214
39 Ga0081539_10008851 3300005985 Bacteria 8606
40 Ga0081539_10014214 3300005985 Bacteria 5910
41 Ga0075363_100041619 3300006048 Bacteria 2424
42 Ga0075363_100047226 3300006048 Bacteria 2286
43 Ga0075364_10014506 3300006051 Bacteria 4871
44 Ga0075364_10037825 3300006051 Bacteria 3127
45 Ga0075432_10000008 3300006058 Bacteria 38971
46 Ga0075432_10000239 3300006058 Bacteria 14797
47 Ga0075369_10029523 3300006186 Bacteria 2304
48 Ga0075370_10012472 3300006353 Bacteria 4492
49 Ga0075370_10071030 3300006353 Bacteria 1992
50 Ga0075370_10162439 3300006353 Bacteria 1311
51 Ga0075428_100004182 3300006844 Bacteria 15891
52 Ga0075428_100142575 3300006844 Bacteria 2605
53 Ga0075431_100023469 3300006847 Bacteria 6311
54 Ga0075433_10000294 3300006852 Bacteria 29844
55 Ga0075433_10004230 3300006852 Bacteria 11147
56 Ga0075434_100000444 3300006871 Bacteria 30784
57 Ga0075434_100007845 3300006871 Bacteria 9890
58 Ga0075429_100057032 3300006880 Bacteria 3400
59 Ga0068865_100049393 3300006881 Bacteria 2900
60 Ga0075436_100001315 3300006914 Bacteria 16891
61 Ga0075435_100009776 3300007076 Bacteria 6978
62 Ga0075435_100050612 3300007076 Bacteria 3344
63 Ga0105251_10120232 3300009011 Bacteria 1193
64 Ga0111539_10016671 3300009094 Bacteria 9104
65 Ga0111539_10042444 3300009094 Bacteria 5461
66 Ga0105245_10165308 3300009098 Bacteria 2103
67 Ga0105245_10208948 3300009098 Bacteria 1878
68 Ga0105245_10272146 3300009098 Bacteria 1652
69 Ga0114129_10007635 3300009147 Bacteria 15388
70 Ga0114129_10623846 3300009147 Bacteria 1394
71 Ga0105243_10001026 3300009148 Bacteria 25748
72 Ga0105243_10010702 3300009148 Bacteria 6950
73 Ga0105243_10172910 3300009148 Bacteria 1872
74 Ga0105242_10029874 3300009176 Bacteria 4350
75 Ga0105242_10033249 3300009176 Bacteria 4128
76 Ga0105249_10047639 3300009553 Bacteria 3906
77 Ga0105249_10148751 3300009553 Bacteria 2252
78 Ga0105249_10512743 3300009553 Bacteria 1246
79 Ga0105239_10335190 3300010375 Bacteria 1707
80 Ga0157371_10063370 3300013102 Bacteria 2620
81 Ga0157370_10120004 3300013104 Bacteria 2455
82 Ga0157369_10078298 3300013105 Bacteria 3542
83 Ga0157369_10616135 3300013105 Bacteria 1120
84 Ga0157378_10085776 3300013297 Bacteria 2853
85 Ga0163162_10098288 3300013306 Bacteria 3016
86 Ga0157372_10091846 3300013307 Bacteria 3453
87 Ga0157372_10100272 3300013307 Bacteria 3305
88 Ga0157372_10210192 3300013307 Bacteria 2255
89 Ga0157375_10082397 3300013308 Bacteria 3259
90 Ga0157375_10091297 3300013308 Bacteria 3107
91 Ga0157375_10369724 3300013308 Bacteria 1600
92 Ga0157380_10008855 3300014326 Bacteria 7192
93 Ga0157380_10298514 3300014326 Bacteria 1483
94 Ga0157380_10585117 3300014326 Bacteria 1101
95 Ga0157376_10676198 3300014969 Bacteria 1035
96 Ga0163161_10104718 3300017792 Bacteria 2109
97 Ga0209051_1000033 3300025303 Bacteria 380540
98 Ga0207688_10004056 3300025901 Bacteria 7978
99 Ga0207688_10087187 3300025901 Bacteria 1789
100 Ga0207688_10110805 3300025901 Bacteria 1593
101 Ga0207647_10035764 3300025904 Bacteria 3162
102 Ga0207657_10272529 3300025919 Bacteria 1345
103 Ga0207652_10205460 3300025921 Bacteria 1773
104 Ga0207681_10145056 3300025923 Bacteria 1773
105 Ga0207650_10225505 3300025925 Bacteria 1510
106 Ga0207706_10004652 3300025933 Bacteria 12861
107 Ga0207686_10014788 3300025934 Bacteria 4354
108 Ga0207686_10017586 3300025934 Bacteria 4032
109 Ga0207709_10001922 3300025935 Bacteria 13650
110 Ga0207709_10048666 3300025935 Bacteria 2584
111 Ga0207709_10158788 3300025935 Bacteria 1574
112 Ga0207689_10042899 3300025942 Bacteria 3740
113 Ga0207661_10211946 3300025944 Bacteria 1708
114 Ga0207712_10153139 3300025961 Bacteria 1783
115 Ga0207712_10320291 3300025961 Bacteria 1279
116 Ga0207677_10648106 3300026023 Bacteria 932
117 Ga0207639_10018244 3300026041 Bacteria 4984
118 Ga0207678_10088173 3300026067 Bacteria 2652
119 Ga0207678_10206493 3300026067 Bacteria 1680
120 Ga0207702_10030199 3300026078 Bacteria 4516
121 Ga0207641_10040462 3300026088 Bacteria 3904
122 Ga0207674_10010418 3300026116 Bacteria 10533
123 Ga0207674_10043716 3300026116 Bacteria 4618
124 Ga0207683_10268411 3300026121 Bacteria 1559
125 Ga0207698_10042665 3300026142 Bacteria 3391
126 Ga0207428_10000346 3300027907 Bacteria 60257
127 Ga0207428_10001581 3300027907 Bacteria 23705
128 Ga0268264_10440741 3300028381 Bacteria 1260
129 Ga0307515_10219837 3300028794 Bacteria 1721
130 Ga0265327_10000131 3300031251 Bacteria 164189
131 Ga0307513_10102662 3300031456 Bacteria 2878
132 Ga0307408_100012139 3300031548 Bacteria 5703
133 Ga0307516_10301549 3300031730 Bacteria 1278
134 Ga0307405_10037872 3300031731 Bacteria 2902
135 Ga0307405_10084463 3300031731 Bacteria 2084
136 Ga0307413_10001251 3300031824 Bacteria 9466
137 Ga0307410_10000043 3300031852 Bacteria 43864
138 Ga0307410_10000686 3300031852 Bacteria 14117
139 Ga0307410_10087233 3300031852 Bacteria 2206
140 Ga0307410_10295473 3300031852 Bacteria 1276
141 Ga0307406_10000008 3300031901 Bacteria 120233
142 Ga0307406_10045042 3300031901 Bacteria 2767
143 Ga0307407_10000280 3300031903 Bacteria 15048
144 Ga0307407_10049104 3300031903 Bacteria 2406
145 Ga0307407_10054590 3300031903 Bacteria 2305
146 Ga0307407_10068582 3300031903 Bacteria 2101
147 Ga0307407_10068908 3300031903 Bacteria 2098
148 Ga0307407_10082569 3300031903 Bacteria 1948
149 Ga0307407_10244634 3300031903 Bacteria 1226
150 Ga0307412_10013192 3300031911 Bacteria 4837
151 Ga0307409_100000014 3300031995 Bacteria 62867
152 Ga0307409_100004869 3300031995 Bacteria 7630
153 Ga0307409_100011859 3300031995 Bacteria 5520
154 Ga0307409_100014546 3300031995 Bacteria 5125
155 Ga0307409_100175446 3300031995 Bacteria 1891
156 Ga0307409_100275106 3300031995 Bacteria 1553
157 Ga0307416_100000088 3300032002 Bacteria 62911
158 Ga0307416_100005660 3300032002 Bacteria 7716
159 Ga0307416_100008033 3300032002 Bacteria 6762
160 Ga0307416_100011774 3300032002 Bacteria 5858
161 Ga0307416_100041061 3300032002 Bacteria 3600
162 Ga0307414_10044143 3300032004 Bacteria 3041
163 Ga0307411_10002933 3300032005 Bacteria 7737
164 Ga0307411_10177451 3300032005 Bacteria 1613
165 Ga0307411_10212079 3300032005 Bacteria 1496
166 Ga0307415_100000783 3300032126 Bacteria 14410
167 Ga0307415_100014180 3300032126 Bacteria 4677
168 Ga0307415_100122950 3300032126 Bacteria 1950
169 Ga0307507_10035240 3300033179 Bacteria 5145
170 Ga0373956_0002488 3300035119 Bacteria 7499
171 Ga0373931_0178626 3300035691 Bacteria 1256
172 Ga0316584_0067861 3300036712 Bacteria 2673
173 Ga0395900_0011779 3300037418 Bacteria 8943
174 Ga0395898_0004389 3300037466 Bacteria 15427
175 Ga0395898_0205021 3300037466 Bacteria 1882
176 Ga0395901_0006313 3300038443 Bacteria 12007
177 Ga0395901_0137849 3300038443 Bacteria 2564
178 Ga0395901_0156421 3300038443 Bacteria 2394
179 Ga0439465_0019075 3300041413 Bacteria 2144
180 Ga0451843_0367205 3300041509 Bacteria 2900
181 Ga0451853_1145375 3300041512 Bacteria 3733
182 Ga0439450_011672 3300042008 Bacteria 1726
183 Ga0439463_018380 3300042016 Bacteria 1740
184 Ga0439435_0046525 3300042436 Bacteria 1229
185 Ga0439460_0038180 3300042461 Bacteria 1400
186 Ga0439460_0039556 3300042461 Bacteria 1379
187 Ga0466966_0048208 3300044684 Bacteria 2714
188 Ga0453684_0108600 3300044712 Bacteria 3376
189 Ga0466971_0068297 3300044719 Bacteria 1612
190 Ga0466960_0051232 3300044901 Bacteria 1993
191 Ga0466967_0013385 3300045976 Bacteria 6337
192 Ga0495580_0277245 3300046472 Bacteria 1144
193 Ga0495582_0014724 3300046473 Bacteria 4299
194 Ga0495606_0143478 3300046507 Bacteria 1408
195 Ga0495620_0028314 3300046515 Bacteria 2608
196 Ga0495631_0179613 3300046518 Bacteria 907
197 Ga0495652_0270323 3300046529 Bacteria 1250
198 Ga0495665_0015113 3300046531 Bacteria 4161
199 Ga0495645_0029914 3300046543 Bacteria 3967
200 Ga0495667_0127020 3300046559 Bacteria 1645
201 Ga0495656_0037645 3300046615 Bacteria 2000
202 Ga0495625_0068883 3300046660 Bacteria 2487
203 Ga0495625_0139857 3300046660 Bacteria 1634
204 Ga0495588_0072088 3300046674 Bacteria 1797
205 Ga0495657_0110899 3300046675 Bacteria 1738
206 Ga0495658_0141370 3300046683 Bacteria 1472
207 Ga0495600_0056403 3300046809 Bacteria 2567
208 Ga0495581_0013855 3300047315 Bacteria 4674
209 Ga0495680_0055790 3300047322 Bacteria 3063
210 Ga0495683_0000245 3300047323 Bacteria 48819
211 Ga0496101_0106909 3300048904 Bacteria 2102
212 Ga0496101_0211345 3300048904 Bacteria 1503
213 Ga0496102_0006103 3300048905 Bacteria 10271
214 Ga0496102_0025393 3300048905 Bacteria 5274
215 Ga0496103_0138120 3300048906 Bacteria 1558
216 Ga0496104_0207738 3300048907 Bacteria 1870
217 Ga0496105_0005893 3300048908 Bacteria 9346
218 Ga0496105_0229467 3300048908 Bacteria 1509
219 Ga0496106_0330248 3300048909 Bacteria 1224
220 Ga0496108_0046088 3300048911 Bacteria 3642
221 Ga0496110_0035929 3300048913 Bacteria 4302
222 Ga0496113_0376847 3300048916 Bacteria 1139
223 Ga0496114_0026673 3300048917 Bacteria 4732
224 Ga0496114_0043622 3300048917 Bacteria 3719
225 Ga0496114_0164644 3300048917 Bacteria 1930
226 Ga0496126_0266553 3300048929 Bacteria 1423
227 Ga0501310_003352 3300049130 Bacteria 1562
228 Ga0501321_001402 3300049537 Bacteria 1904
229 Ga0501325_000320 3300049541 Bacteria 2136
230 Ga0501031_0018846 3300049568 Bacteria 4493
231 Ga0501033_0102691 3300049570 Bacteria 2085
232 Ga0501036_0280141 3300049572 Bacteria 1395
233 Ga0501038_0039460 3300049574 Bacteria 4130
234 Ga0501039_0104577 3300049575 Bacteria 2210
235 Ga0501040_0024040 3300049576 Bacteria 4088
236 Ga0501041_0032734 3300049577 Bacteria 3142
237 Ga0501042_0047924 3300049578 Bacteria 3046
238 Ga0501043_0073535 3300049579 Bacteria 2685
239 Ga0501046_0064699 3300049580 Bacteria 2854
240 Ga0501048_0049562 3300049582 Bacteria 2992
241 Ga0501071_0032463 3300049587 Bacteria 3707
242 Ga0501072_0260023 3300049588 Bacteria 1382
243 Ga0501074_0124256 3300049590 Bacteria 1845
244 Ga0501075_0061486 3300049591 Bacteria 2830
245 Ga0501076_0074512 3300049592 Bacteria 2719
246 Ga0501077_0033579 3300049593 Bacteria 3266
247 Ga0501079_0042766 3300049741 Bacteria 3498
248 Ga0501080_0060833 3300049742 Bacteria 3516
249 Ga0501081_0046776 3300049743 Bacteria 2975
250 Ga0501035_0079382 3300049822 Bacteria 2899
251 Ga0501044_0003096 3300049823 Bacteria 18834
252 Ga0501045_0003413 3300049824 Bacteria 10869
253 nmdc:mga03n38_37548_c1 3300050490 Bacteria 2090
254 nmdc:mga00v17_61243_c1 3300050491 Bacteria 2313
255 nmdc:mga06z11_52324_c1 3300050494 Bacteria 2094
256 nmdc:mga07m45_6845_c1 3300050496 Bacteria 5795
257 nmdc:mga05p37_10046_c1 3300050507 Bacteria 11232
258 nmdc:mga09592_108491_c1 3300050508 Bacteria 2381
259 nmdc:mga0qj67_71115_c1 3300050509 Bacteria 2776
260 nmdc:mga06r32_38693_c1 3300050510 Bacteria 4521
261 nmdc:mga08y16_28321_c1 3300050511 Bacteria 5906
262 nmdc:mga08y16_8050_c1 3300050511 Bacteria 11031
263 nmdc:mga0n895_3217_c1 3300050512 Bacteria 13076
264 nmdc:mga0n895_5412_c1 3300050512 Bacteria 10665
265 nmdc:mga0rr50_12544_c1 3300050513 Bacteria 5484
266 nmdc:mga0rr50_38107_c1 3300050513 Bacteria 3476
267 nmdc:mga08x19_3050_c1 3300050514 Bacteria 10071
268 nmdc:mga0a205_2560_c1 3300050515 Bacteria 16032
269 nmdc:mga0a205_516_c1 3300050515 Bacteria 30318
270 nmdc:mga0sz30_1354_c2 3300050516 Bacteria 4382
271 Ga0495619_0460761 3300053085 Bacteria 876
272 Ga0500616_0001111 3300053153 Bacteria 27803
273 Ga0530510_0045939 3300061734 Bacteria 3155

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0028314 Ga0495620_0028314_36_797 235
2 3300053085 Ga0495619_0460761 Ga0495619_0460761_28_789 235
3 3300046518 Ga0495631_0179613 Ga0495631_0179613_69_884 253
4 3300046660 Ga0495625_0139857 Ga0495625_0139857_243_1163 257
5 3300013105 Ga0157369_10078298 Ga0157369_100782982 258
6 3300045976 Ga0466967_0013385 Ga0466967_0013385_1664_2515 260
7 3300031548 Ga0307408_100012139 Ga0307408_1000121392 262
8 3300031852 Ga0307410_10000043 Ga0307410_1000004336 262
9 3300031901 Ga0307406_10000008 Ga0307406_10000008108 262
10 3300031903 Ga0307407_10054590 Ga0307407_100545902 262
11 3300031995 Ga0307409_100000014 Ga0307409_10000001426 262
12 3300032002 Ga0307416_100000088 Ga0307416_10000008815 262
13 3300032005 Ga0307411_10212079 Ga0307411_102120791 262
14 3300032126 Ga0307415_100000783 Ga0307415_1000007839 262
15 3300031903 Ga0307407_10082569 Ga0307407_100825692 263
16 3300044712 Ga0453684_0108600 Ga0453684_0108600_1585_2457 263
17 3300005331 Ga0070670_100432611 Ga0070670_1004326111 264
18 3300028381 Ga0268264_10440741 Ga0268264_104407412 264
19 3300013104 Ga0157370_10120004 Ga0157370_101200042 265
20 3300013105 Ga0157369_10616135 Ga0157369_106161352 265
21 3300013307 Ga0157372_10091846 Ga0157372_100918461 265
22 3300048907 Ga0496104_0207738 Ga0496104_0207738_328_1251 265
23 3300048908 Ga0496105_0005893 Ga0496105_0005893_5626_6549 265
24 3300048913 Ga0496110_0035929 Ga0496110_0035929_1018_1941 265
25 3300006353 Ga0075370_10071030 Ga0075370_100710302 266
26 3300009011 Ga0105251_10120232 Ga0105251_101202321 268
27 3300009148 Ga0105243_10001026 Ga0105243_1000102612 268
28 3300009553 Ga0105249_10148751 Ga0105249_101487512 268
29 3300014969 Ga0157376_10676198 Ga0157376_106761982 268
30 3300025935 Ga0207709_10001922 Ga0207709_100019225 268
31 3300025961 Ga0207712_10153139 Ga0207712_101531392 268
32 3300026067 Ga0207678_10088173 Ga0207678_100881732 268
33 3300031731 Ga0307405_10084463 Ga0307405_100844632 268
34 3300031852 Ga0307410_10087233 Ga0307410_100872332 268
35 3300031901 Ga0307406_10045042 Ga0307406_100450425 268
36 3300031903 Ga0307407_10049104 Ga0307407_100491042 268
37 3300031995 Ga0307409_100004869 Ga0307409_1000048698 268
38 3300032002 Ga0307416_100041061 Ga0307416_1000410613 268
39 3300001989 JGI24739J22299_10082106 JGI24739J22299_100821061 269
40 3300005937 Ga0081455_10029816 Ga0081455_100298162 269
41 3300006353 Ga0075370_10162439 Ga0075370_101624391 269
42 3300013308 Ga0157375_10369724 Ga0157375_103697242 269
43 3300009147 Ga0114129_10623846 Ga0114129_106238462 270
44 3300026023 Ga0207677_10648106 Ga0207677_106481061 270
45 iso_pu_bacteria 2811994882 2812373223 270
46 3300005937 Ga0081455_10099706 Ga0081455_100997063 271
47 3300005937 Ga0081455_10175151 Ga0081455_101751512 271
48 3300006058 Ga0075432_10000008 Ga0075432_100000082 271
49 3300006844 Ga0075428_100142575 Ga0075428_1001425752 271
50 3300006852 Ga0075433_10000294 Ga0075433_1000029421 271
51 3300006871 Ga0075434_100000444 Ga0075434_10000044412 271
52 3300006914 Ga0075436_100001315 Ga0075436_1000013152 271
53 3300007076 Ga0075435_100050612 Ga0075435_1000506123 271
54 3300009094 Ga0111539_10042444 Ga0111539_100424441 271
55 3300027907 Ga0207428_10000346 Ga0207428_1000034651 271
56 3300041509 Ga0451843_0367205 Ga0451843_0367205_529_1491 271
57 3300049823 Ga0501044_0003096 Ga0501044_0003096_17052_17969 271
58 3300050511 nmdc:mga08y16_28321_c1 nmdc:mga08y16_28321_c1_3436_4338 271
59 3300050512 nmdc:mga0n895_3217_c1 nmdc:mga0n895_3217_c1_9338_10240 271
60 3300050513 nmdc:mga0rr50_12544_c1 nmdc:mga0rr50_12544_c1_2458_3360 271
61 3300050514 nmdc:mga08x19_3050_c1 nmdc:mga08x19_3050_c1_7671_8573 271
62 3300050515 nmdc:mga0a205_516_c1 nmdc:mga0a205_516_c1_16100_17002 271
63 3300003373 JGI25407J50210_10003138 JGI25407J50210_100031382 272
64 3300005981 Ga0081538_10000380 Ga0081538_1000038043 272
65 3300036712 Ga0316584_0067861 Ga0316584_0067861_1224_2129 272
66 3300037418 Ga0395900_0011779 Ga0395900_0011779_6824_7759 272
67 3300037466 Ga0395898_0004389 Ga0395898_0004389_8207_9142 272
68 3300038443 Ga0395901_0006313 Ga0395901_0006313_1216_2151 272
69 iso_pu_bacteria 2919446982 2919448278 272
70 3300005841 Ga0068863_100292875 Ga0068863_1002928752 273
71 3300026088 Ga0207641_10040462 Ga0207641_100404623 273
72 3300035119 Ga0373956_0002488 Ga0373956_0002488_6032_6937 273
73 3300042461 Ga0439460_0039556 Ga0439460_0039556_110_1018 273
74 iso_pu_bacteria 2734482000 2734969177 273
75 3300005530 Ga0070679_100365018 Ga0070679_1003650182 274
76 3300005539 Ga0068853_100187905 Ga0068853_1001879052 274
77 3300026041 Ga0207639_10018244 Ga0207639_100182442 274
78 3300026142 Ga0207698_10042665 Ga0207698_100426653 274
79 3300042008 Ga0439450_011672 Ga0439450_011672_429_1340 274
80 3300042436 Ga0439435_0046525 Ga0439435_0046525_189_1100 274
81 3300048904 Ga0496101_0211345 Ga0496101_0211345_454_1368 274
82 3300048909 Ga0496106_0330248 Ga0496106_0330248_50_964 274
83 iso_pu_bacteria 2643221679 2644446940 274
84 iso_pu_bacteria 2808606365 2808871903 275
85 3300001989 JGI24739J22299_10027058 JGI24739J22299_100270582 276
86 3300009148 Ga0105243_10172910 Ga0105243_101729102 276
87 3300025935 Ga0207709_10158788 Ga0207709_101587882 276
88 3300005329 Ga0070683_100111758 Ga0070683_1001117582 277
89 3300005577 Ga0068857_100113525 Ga0068857_1001135252 277
90 3300025919 Ga0207657_10272529 Ga0207657_102725292 277
91 3300025944 Ga0207661_10211946 Ga0207661_102119461 277
92 3300026116 Ga0207674_10010418 Ga0207674_100104187 277
93 3300028794 Ga0307515_10219837 Ga0307515_102198372 277
94 3300031730 Ga0307516_10301549 Ga0307516_103015492 277
95 3300031852 Ga0307410_10295473 Ga0307410_102954731 277
96 3300031903 Ga0307407_10244634 Ga0307407_102446342 277
97 3300031995 Ga0307409_100275106 Ga0307409_1002751062 277
98 3300048905 Ga0496102_0006103 Ga0496102_0006103_8429_9403 277
99 3300048917 Ga0496114_0043622 Ga0496114_0043622_1932_2906 277
100 3300048917 Ga0496114_0164644 Ga0496114_0164644_551_1462 277
101 3300053153 Ga0500616_0001111 Ga0500616_0001111_25860_26771 277
102 iso_pu_bacteria 2551306166 2552105585 277
103 iso_pu_bacteria 2919713450 2919717875 277
104 3300005327 Ga0070658_10432198 Ga0070658_104321981 278
105 3300005334 Ga0068869_100062765 Ga0068869_1000627651 278
106 3300005614 Ga0068856_100096775 Ga0068856_1000967753 278
107 3300005983 Ga0081540_1003138 Ga0081540_10031388 278
108 3300005985 Ga0081539_10008851 Ga0081539_100088515 278
109 3300005985 Ga0081539_10014214 Ga0081539_100142142 278
110 3300014326 Ga0157380_10298514 Ga0157380_102985142 278
111 3300025942 Ga0207689_10042899 Ga0207689_100428992 278
112 3300026078 Ga0207702_10030199 Ga0207702_100301993 278
113 3300031995 Ga0307409_100175446 Ga0307409_1001754462 278
114 3300048904 Ga0496101_0106909 Ga0496101_0106909_834_1757 278
115 iso_pu_bacteria 2565956761 2566995828 278
116 iso_pu_bacteria 2738541308 2738888678 278
117 iso_pu_bacteria 2738543011 2739237928 278
118 iso_pu_bacteria 2842134933 2842139535 278
119 iso_pu_bacteria 2889300758 2889303557 278
120 iso_pu_bacteria 2904535858 2904537619 278
121 iso_pu_bacteria 2922554459 2922558736 278
122 iso_pu_bacteria 2928142448 2928145404 278
123 iso_pu_bacteria 2939743619 2939747342 278
124 3300025921 Ga0207652_10205460 Ga0207652_102054603 279
125 3300035691 Ga0373931_0178626 Ga0373931_0178626_291_1205 279
126 3300037466 Ga0395898_0205021 Ga0395898_0205021_124_1155 279
127 3300038443 Ga0395901_0137849 Ga0395901_0137849_1268_2299 279
128 3300046473 Ga0495582_0014724 Ga0495582_0014724_2432_3355 279
129 3300046529 Ga0495652_0270323 Ga0495652_0270323_25_942 279
130 3300046543 Ga0495645_0029914 Ga0495645_0029914_1576_2493 279
131 3300046559 Ga0495667_0127020 Ga0495667_0127020_86_1003 279
132 3300046675 Ga0495657_0110899 Ga0495657_0110899_808_1725 279
133 3300046683 Ga0495658_0141370 Ga0495658_0141370_516_1439 279
134 3300046809 Ga0495600_0056403 Ga0495600_0056403_1059_1982 279
135 3300047322 Ga0495680_0055790 Ga0495680_0055790_1303_2220 279
136 3300048905 Ga0496102_0025393 Ga0496102_0025393_593_1516 279
137 3300048906 Ga0496103_0138120 Ga0496103_0138120_581_1504 279
138 3300048917 Ga0496114_0026673 Ga0496114_0026673_3631_4554 279
139 iso_pu_bacteria 2643221692 2644515570 279
140 iso_pu_bacteria 2738543034 2739364560 279
141 iso_pu_bacteria 2904765812 2904766742 279
142 iso_pu_bacteria 2904770941 2904775246 279
143 iso_pu_bacteria 2908811453 2908814436 279
144 iso_pu_bacteria 2919420072 2919420822 279
145 iso_pu_bacteria 2919432681 2919433420 279
146 3300005440 Ga0070705_100048426 Ga0070705_1000484262 280
147 3300005615 Ga0070702_100007000 Ga0070702_1000070003 280
148 3300005616 Ga0068852_100413543 Ga0068852_1004135432 280
149 3300009176 Ga0105242_10029874 Ga0105242_100298743 280
150 3300013297 Ga0157378_10085776 Ga0157378_100857762 280
151 3300013308 Ga0157375_10082397 Ga0157375_100823973 280
152 3300025934 Ga0207686_10017586 Ga0207686_100175864 280
153 3300031731 Ga0307405_10037872 Ga0307405_100378722 280
154 3300031852 Ga0307410_10000686 Ga0307410_1000068611 280
155 3300031903 Ga0307407_10068908 Ga0307407_100689082 280
156 3300031995 Ga0307409_100011859 Ga0307409_1000118592 280
157 3300032002 Ga0307416_100011774 Ga0307416_1000117744 280
158 3300032005 Ga0307411_10177451 Ga0307411_101774512 280
159 3300049568 Ga0501031_0018846 Ga0501031_0018846_1059_1979 280
160 3300049570 Ga0501033_0102691 Ga0501033_0102691_883_1803 280
161 3300049572 Ga0501036_0280141 Ga0501036_0280141_189_1109 280
162 3300049574 Ga0501038_0039460 Ga0501038_0039460_1068_1988 280
163 3300049575 Ga0501039_0104577 Ga0501039_0104577_140_1060 280
164 3300049576 Ga0501040_0024040 Ga0501040_0024040_2094_3014 280
165 3300049577 Ga0501041_0032734 Ga0501041_0032734_1080_2000 280
166 3300049578 Ga0501042_0047924 Ga0501042_0047924_1089_2009 280
167 3300049579 Ga0501043_0073535 Ga0501043_0073535_931_1851 280
168 3300049580 Ga0501046_0064699 Ga0501046_0064699_898_1818 280
169 3300049582 Ga0501048_0049562 Ga0501048_0049562_994_1914 280
170 3300049587 Ga0501071_0032463 Ga0501071_0032463_2273_3193 280
171 3300049588 Ga0501072_0260023 Ga0501072_0260023_43_963 280
172 3300049590 Ga0501074_0124256 Ga0501074_0124256_152_1072 280
173 3300049591 Ga0501075_0061486 Ga0501075_0061486_1102_2022 280
174 3300049592 Ga0501076_0074512 Ga0501076_0074512_951_1871 280
175 3300049593 Ga0501077_0033579 Ga0501077_0033579_1073_1993 280
176 3300049741 Ga0501079_0042766 Ga0501079_0042766_1474_2394 280
177 3300049742 Ga0501080_0060833 Ga0501080_0060833_1097_2017 280
178 3300049743 Ga0501081_0046776 Ga0501081_0046776_1008_1928 280
179 3300049822 Ga0501035_0079382 Ga0501035_0079382_1038_1958 280
180 3300049824 Ga0501045_0003413 Ga0501045_0003413_1092_2012 280
181 3300061734 Ga0530510_0045939 Ga0530510_0045939_1070_1990 280
182 iso_pu_bacteria 2675903058 2676477410 280
183 iso_pu_bacteria 2728369276 2729909325 280
184 iso_pu_bacteria 2744054611 2744955171 280
185 iso_pu_bacteria 2827628540 2827634667 280
186 3300005440 Ga0070705_100066525 Ga0070705_1000665252 281
187 3300009553 Ga0105249_10512743 Ga0105249_105127432 281
188 3300013308 Ga0157375_10091297 Ga0157375_100912972 281
189 3300025961 Ga0207712_10320291 Ga0207712_103202912 281
190 3300031456 Ga0307513_10102662 Ga0307513_101026622 281
191 3300038443 Ga0395901_0156421 Ga0395901_0156421_563_1558 281
192 3300044684 Ga0466966_0048208 Ga0466966_0048208_943_1890 281
193 iso_pu_bacteria 2515154155 2515856318 281
194 iso_pu_bacteria 2643221567 2643852282 281
195 iso_pu_bacteria 2643221624 2644136804 281
196 iso_pu_bacteria 2751185734 2753069689 281
197 iso_pu_bacteria 2775506925 2776371787 281
198 iso_pu_bacteria 2863067949 2863070081 281
199 iso_pu_bacteria 2866552031 2866555830 281
200 iso_pu_bacteria 2870721527 2870727803 281
201 iso_pu_bacteria 8047710418 8047716328 281
202 iso_pu_bacteria 8056207758 8056214061 281
203 3300005338 Ga0068868_100370663 Ga0068868_1003706631 282
204 3300005435 Ga0070714_100117922 Ga0070714_1001179222 282
205 3300005457 Ga0070662_100021016 Ga0070662_1000210163 282
206 3300005616 Ga0068852_100374232 Ga0068852_1003742321 282
207 3300005718 Ga0068866_10005390 Ga0068866_100053903 282
208 3300005937 Ga0081455_10009008 Ga0081455_1000900811 282
209 3300005937 Ga0081455_10028270 Ga0081455_100282703 282
210 3300006048 Ga0075363_100047226 Ga0075363_1000472263 282
211 3300006051 Ga0075364_10014506 Ga0075364_100145065 282
212 3300006058 Ga0075432_10000239 Ga0075432_100002399 282
213 3300006186 Ga0075369_10029523 Ga0075369_100295232 282
214 3300006353 Ga0075370_10012472 Ga0075370_100124725 282
215 3300006844 Ga0075428_100004182 Ga0075428_1000041826 282
216 3300006847 Ga0075431_100023469 Ga0075431_1000234693 282
217 3300006852 Ga0075433_10004230 Ga0075433_1000423011 282
218 3300006871 Ga0075434_100007845 Ga0075434_1000078456 282
219 3300006880 Ga0075429_100057032 Ga0075429_1000570323 282
220 3300006881 Ga0068865_100049393 Ga0068865_1000493932 282
221 3300007076 Ga0075435_100009776 Ga0075435_1000097764 282
222 3300009094 Ga0111539_10016671 Ga0111539_100166714 282
223 3300009098 Ga0105245_10165308 Ga0105245_101653082 282
224 3300009098 Ga0105245_10208948 Ga0105245_102089483 282
225 3300009147 Ga0114129_10007635 Ga0114129_100076353 282
226 3300009148 Ga0105243_10010702 Ga0105243_100107026 282
227 3300009176 Ga0105242_10033249 Ga0105242_100332492 282
228 3300009553 Ga0105249_10047639 Ga0105249_100476393 282
229 3300010375 Ga0105239_10335190 Ga0105239_103351902 282
230 3300013102 Ga0157371_10063370 Ga0157371_100633702 282
231 3300013306 Ga0163162_10098288 Ga0163162_100982883 282
232 3300013307 Ga0157372_10100272 Ga0157372_101002722 282
233 3300014326 Ga0157380_10008855 Ga0157380_100088556 282
234 3300017792 Ga0163161_10104718 Ga0163161_101047182 282
235 3300025901 Ga0207688_10004056 Ga0207688_100040565 282
236 3300025901 Ga0207688_10087187 Ga0207688_100871872 282
237 3300025923 Ga0207681_10145056 Ga0207681_101450562 282
238 3300025933 Ga0207706_10004652 Ga0207706_100046522 282
239 3300025934 Ga0207686_10014788 Ga0207686_100147882 282
240 3300025935 Ga0207709_10048666 Ga0207709_100486662 282
241 3300027907 Ga0207428_10001581 Ga0207428_1000158110 282
242 3300031824 Ga0307413_10001251 Ga0307413_100012517 282
243 3300031903 Ga0307407_10000280 Ga0307407_100002804 282
244 3300031903 Ga0307407_10068582 Ga0307407_100685822 282
245 3300031911 Ga0307412_10013192 Ga0307412_100131924 282
246 3300031995 Ga0307409_100014546 Ga0307409_1000145465 282
247 3300032002 Ga0307416_100005660 Ga0307416_1000056608 282
248 3300032002 Ga0307416_100008033 Ga0307416_1000080334 282
249 3300032004 Ga0307414_10044143 Ga0307414_100441432 282
250 3300032005 Ga0307411_10002933 Ga0307411_100029335 282
251 3300032126 Ga0307415_100014180 Ga0307415_1000141804 282
252 3300033179 Ga0307507_10035240 Ga0307507_100352402 282
253 3300041413 Ga0439465_0019075 Ga0439465_0019075_343_1245 282
254 3300042016 Ga0439463_018380 Ga0439463_018380_794_1696 282
255 3300042461 Ga0439460_0038180 Ga0439460_0038180_345_1247 282
256 3300044719 Ga0466971_0068297 Ga0466971_0068297_418_1350 282
257 3300044901 Ga0466960_0051232 Ga0466960_0051232_620_1552 282
258 3300046472 Ga0495580_0277245 Ga0495580_0277245_106_1014 282
259 3300046507 Ga0495606_0143478 Ga0495606_0143478_153_1055 282
260 3300046531 Ga0495665_0015113 Ga0495665_0015113_2337_3245 282
261 3300046615 Ga0495656_0037645 Ga0495656_0037645_958_1860 282
262 3300046674 Ga0495588_0072088 Ga0495588_0072088_218_1126 282
263 3300047315 Ga0495581_0013855 Ga0495581_0013855_2764_3672 282
264 3300047323 Ga0495683_0000245 Ga0495683_0000245_39740_40642 282
265 3300048911 Ga0496108_0046088 Ga0496108_0046088_121_1029 282
266 3300048929 Ga0496126_0266553 Ga0496126_0266553_190_1098 282
267 3300050494 nmdc:mga06z11_52324_c1 nmdc:mga06z11_52324_c1_729_1637 282
268 3300050496 nmdc:mga07m45_6845_c1 nmdc:mga07m45_6845_c1_2228_3136 282
269 3300050507 nmdc:mga05p37_10046_c1 nmdc:mga05p37_10046_c1_4227_5129 282
270 3300050508 nmdc:mga09592_108491_c1 nmdc:mga09592_108491_c1_1070_1972 282
271 3300050509 nmdc:mga0qj67_71115_c1 nmdc:mga0qj67_71115_c1_1396_2298 282
272 3300050510 nmdc:mga06r32_38693_c1 nmdc:mga06r32_38693_c1_3482_4384 282
273 3300050511 nmdc:mga08y16_8050_c1 nmdc:mga08y16_8050_c1_4301_5203 282
274 3300050512 nmdc:mga0n895_5412_c1 nmdc:mga0n895_5412_c1_1284_2186 282
275 3300050513 nmdc:mga0rr50_38107_c1 nmdc:mga0rr50_38107_c1_1494_2396 282
276 3300050515 nmdc:mga0a205_2560_c1 nmdc:mga0a205_2560_c1_12245_13147 282
277 3300050516 nmdc:mga0sz30_1354_c2 nmdc:mga0sz30_1354_c2_2772_3674 282
278 3300005329 Ga0070683_100285082 Ga0070683_1002850822 283
279 3300006048 Ga0075363_100041619 Ga0075363_1000416192 283
280 3300006051 Ga0075364_10037825 Ga0075364_100378254 283
281 3300031251 Ga0265327_10000131 Ga0265327_1000013179 283
282 3300041512 Ga0451853_1145375 Ga0451853_1145375_2550_3461 283
283 3300048908 Ga0496105_0229467 Ga0496105_0229467_532_1470 283
284 3300049130 Ga0501310_003352 Ga0501310_003352_399_1313 283
285 3300049537 Ga0501321_001402 Ga0501321_001402_562_1467 283
286 3300049541 Ga0501325_000320 Ga0501325_000320_803_1708 283
287 3300050490 nmdc:mga03n38_37548_c1 nmdc:mga03n38_37548_c1_749_1657 283
288 3300050491 nmdc:mga00v17_61243_c1 nmdc:mga00v17_61243_c1_1030_1938 283
289 iso_pu_bacteria 2784132109 2784473105 283
290 3300003792 Ga0055540_1000071 Ga0055540_100007141 284
291 3300025303 Ga0209051_1000033 Ga0209051_1000033272 284
292 iso_pu_bacteria 2974315732 2974318720 284
293 3300001979 JGI24740J21852_10050723 JGI24740J21852_100507231 285
294 3300005455 Ga0070663_100425532 Ga0070663_1004255321 285
295 3300013307 Ga0157372_10210192 Ga0157372_102101922 285
296 3300046660 Ga0495625_0068883 Ga0495625_0068883_865_1785 285
297 3300048916 Ga0496113_0376847 Ga0496113_0376847_141_1061 285
298 iso_pu_bacteria 2816332119 2816423228 285
299 3300005356 Ga0070674_100267452 Ga0070674_1002674522 286
300 3300025901 Ga0207688_10110805 Ga0207688_101108052 286
301 3300026067 Ga0207678_10206493 Ga0207678_102064932 286
302 3300026121 Ga0207683_10268411 Ga0207683_102684112 286
303 3300032126 Ga0307415_100122950 Ga0307415_1001229502 287
304 3300001979 JGI24740J21852_10008599 JGI24740J21852_100085992 288
305 3300001990 JGI24737J22298_10002043 JGI24737J22298_100020434 288
306 3300002067 JGI24735J21928_10019708 JGI24735J21928_100197082 288
307 3300005347 Ga0070668_100210392 Ga0070668_1002103922 288
308 3300005937 Ga0081455_10127409 Ga0081455_101274092 288
309 3300009098 Ga0105245_10272146 Ga0105245_102721462 288
310 3300014326 Ga0157380_10585117 Ga0157380_105851172 288
311 3300025904 Ga0207647_10035764 Ga0207647_100357644 288
312 3300025925 Ga0207650_10225505 Ga0207650_102255051 288
313 3300026116 Ga0207674_10043716 Ga0207674_100437165 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

142

341

0.81

Feature Viewer

pLDDT pTM Quality
63.32 0.37 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map