F402179
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 313 | 171 | 312 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10074222|Ga0157369_100742223 |
| Length | 284 |
| Sequence | MSMAKTSPVANGTAPGADPALLEVRNLRAGFGSQTIIHGVDLDVRAGEVTGIFGLNGAGKSVLLKVIAGVVPTWSGSVRLDGAEISKLLPEQRVARGMAHVPQGRQVFPSLSVEQNLRVGAYTLRRRDRSAYAGRLEMVYDIFPRLAERRGQAAGTMSGGEQAMLAVGRALICDPKLVLIDEPSAGLAPAVVEDLLEVLLKVRELGLTMLLVEQNIRFGLRLSERACLLQKGRVVYSGSREDLDQERLAQYLGVGRLLSSDLSAGLDKPKRRSAPRRPKTKPQP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 2 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 46 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 47 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 48 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 51 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 109 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 117 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 118 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 119 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 120 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 121 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 122 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 126 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 132 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 135 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 151 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.64 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.64 |
| Nodule | 0 |
| Rhizoplane | 1.28 |
| Rhizosphere | 97.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25405J52794_10009843 | 3300003911 | Bacteria | 1811 |
| 2 | Ga0070658_10000174 | 3300005327 | Bacteria | 56278 |
| 3 | Ga0070658_10134989 | 3300005327 | Bacteria | 2058 |
| 4 | Ga0070658_10513292 | 3300005327 | Bacteria | 1036 |
| 5 | Ga0070676_10305282 | 3300005328 | Bacteria | 1080 |
| 6 | Ga0070683_100117417 | 3300005329 | Bacteria | 2512 |
| 7 | Ga0070660_100001756 | 3300005339 | Bacteria | 14874 |
| 8 | Ga0070660_100297151 | 3300005339 | Bacteria | 1323 |
| 9 | Ga0070660_100363486 | 3300005339 | Bacteria | 1193 |
| 10 | Ga0070660_100392343 | 3300005339 | Bacteria | 1147 |
| 11 | Ga0070689_100308892 | 3300005340 | Bacteria | 1318 |
| 12 | Ga0070661_100009713 | 3300005344 | Bacteria | 6674 |
| 13 | Ga0070668_100299785 | 3300005347 | Unclassified | 1348 |
| 14 | Ga0070659_100000860 | 3300005366 | Bacteria | 22191 |
| 15 | Ga0070659_100054762 | 3300005366 | Bacteria | 3143 |
| 16 | Ga0070659_100149150 | 3300005366 | Bacteria | 1907 |
| 17 | Ga0070659_100237910 | 3300005366 | Bacteria | 1506 |
| 18 | Ga0070667_100106899 | 3300005367 | Bacteria | 2422 |
| 19 | Ga0070709_10002505 | 3300005434 | Bacteria | 9942 |
| 20 | Ga0070714_100014028 | 3300005435 | Bacteria | 6429 |
| 21 | Ga0070714_100565055 | 3300005435 | Bacteria | 1090 |
| 22 | Ga0070714_100821472 | 3300005435 | Bacteria | 901 |
| 23 | Ga0070713_100003704 | 3300005436 | Bacteria | 10118 |
| 24 | Ga0070710_10142504 | 3300005437 | Bacteria | 1471 |
| 25 | Ga0070711_100024373 | 3300005439 | Bacteria | 3946 |
| 26 | Ga0070694_100019254 | 3300005444 | Bacteria | 4340 |
| 27 | Ga0070708_100007089 | 3300005445 | Bacteria | 8944 |
| 28 | Ga0070708_100136696 | 3300005445 | Bacteria | 2271 |
| 29 | Ga0070663_100037215 | 3300005455 | Bacteria | 3386 |
| 30 | Ga0070662_100000609 | 3300005457 | Bacteria | 21833 |
| 31 | Ga0070681_10017286 | 3300005458 | Bacteria | 7208 |
| 32 | Ga0070681_10515940 | 3300005458 | Bacteria | 1108 |
| 33 | Ga0068867_100139038 | 3300005459 | Bacteria | 1896 |
| 34 | Ga0070706_100086991 | 3300005467 | Bacteria | 2896 |
| 35 | Ga0070706_100092110 | 3300005467 | Bacteria | 2812 |
| 36 | Ga0070707_100021234 | 3300005468 | Bacteria | 6137 |
| 37 | Ga0070707_100041632 | 3300005468 | Bacteria | 4398 |
| 38 | Ga0070698_100006586 | 3300005471 | Bacteria | 12593 |
| 39 | Ga0070699_100027034 | 3300005518 | Bacteria | 4949 |
| 40 | Ga0070699_100867411 | 3300005518 | Bacteria | 826 |
| 41 | Ga0070679_100028535 | 3300005530 | Bacteria | 5503 |
| 42 | Ga0070679_100043561 | 3300005530 | Bacteria | 4470 |
| 43 | Ga0070679_100048731 | 3300005530 | Bacteria | 4220 |
| 44 | Ga0070679_100089138 | 3300005530 | Bacteria | 3072 |
| 45 | Ga0070684_100667665 | 3300005535 | Bacteria | 968 |
| 46 | Ga0070697_100023704 | 3300005536 | Bacteria | 4883 |
| 47 | Ga0068853_100007581 | 3300005539 | Bacteria | 8691 |
| 48 | Ga0070695_100013747 | 3300005545 | Bacteria | 4865 |
| 49 | Ga0070696_100003209 | 3300005546 | Bacteria | 10887 |
| 50 | Ga0068855_100000661 | 3300005563 | Bacteria | 42196 |
| 51 | Ga0068855_100269804 | 3300005563 | Bacteria | 1892 |
| 52 | Ga0070664_100002475 | 3300005564 | Bacteria | 14875 |
| 53 | Ga0068857_100252217 | 3300005577 | Bacteria | 1618 |
| 54 | Ga0068856_100001862 | 3300005614 | Bacteria | 22019 |
| 55 | Ga0068859_100514546 | 3300005617 | Bacteria | 1292 |
| 56 | Ga0068858_100013832 | 3300005842 | Bacteria | 7616 |
| 57 | Ga0081455_10001419 | 3300005937 | Bacteria | 29668 |
| 58 | Ga0081455_10005497 | 3300005937 | Bacteria | 13890 |
| 59 | Ga0081455_10039032 | 3300005937 | Bacteria | 4200 |
| 60 | Ga0075432_10010554 | 3300006058 | Bacteria | 3137 |
| 61 | Ga0075427_10000669 | 3300006194 | Bacteria | 4076 |
| 62 | Ga0075366_10015884 | 3300006195 | Bacteria | 4321 |
| 63 | Ga0075428_100056705 | 3300006844 | Bacteria | 4290 |
| 64 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 65 | Ga0075431_100019547 | 3300006847 | Bacteria | 6909 |
| 66 | Ga0075431_100061949 | 3300006847 | Bacteria | 3860 |
| 67 | Ga0075433_10004877 | 3300006852 | Bacteria | 10495 |
| 68 | Ga0075434_100039312 | 3300006871 | Bacteria | 4687 |
| 69 | Ga0075429_100036239 | 3300006880 | Bacteria | 4290 |
| 70 | Ga0068865_100246384 | 3300006881 | Bacteria | 1408 |
| 71 | Ga0075436_100000428 | 3300006914 | Bacteria | 26958 |
| 72 | Ga0097620_100514468 | 3300006931 | Bacteria | 1292 |
| 73 | Ga0075435_100106281 | 3300007076 | Bacteria | 2330 |
| 74 | Ga0105240_10411177 | 3300009093 | Unclassified | 1522 |
| 75 | Ga0111539_10003613 | 3300009094 | Bacteria | 20380 |
| 76 | Ga0111539_10444803 | 3300009094 | Bacteria | 1509 |
| 77 | Ga0114129_10005426 | 3300009147 | Bacteria | 18011 |
| 78 | Ga0105242_10093100 | 3300009176 | Bacteria | 2540 |
| 79 | Ga0105242_10209309 | 3300009176 | Bacteria | 1737 |
| 80 | Ga0105242_10642708 | 3300009176 | Unclassified | 1031 |
| 81 | Ga0105237_10030254 | 3300009545 | Bacteria | 5501 |
| 82 | Ga0105249_10884011 | 3300009553 | Bacteria | 960 |
| 83 | Ga0105246_10787802 | 3300011119 | Bacteria | 842 |
| 84 | Ga0157373_10003405 | 3300013100 | Bacteria | 12029 |
| 85 | Ga0157373_10046911 | 3300013100 | Bacteria | 3082 |
| 86 | Ga0157373_10126964 | 3300013100 | Bacteria | 1794 |
| 87 | Ga0157371_10001755 | 3300013102 | Bacteria | 21981 |
| 88 | Ga0157371_10158450 | 3300013102 | Bacteria | 1616 |
| 89 | Ga0157370_10013710 | 3300013104 | Bacteria | 8334 |
| 90 | Ga0157370_10018157 | 3300013104 | Bacteria | 7079 |
| 91 | Ga0157370_10038268 | 3300013104 | Bacteria | 4641 |
| 92 | Ga0157370_10187116 | 3300013104 | Bacteria | 1922 |
| 93 | Ga0157370_10294878 | 3300013104 | Bacteria | 1498 |
| 94 | Ga0157369_10000279 | 3300013105 | Bacteria | 68845 |
| 95 | Ga0157369_10001689 | 3300013105 | Bacteria | 26944 |
| 96 | Ga0157369_10060371 | 3300013105 | Bacteria | 4089 |
| 97 | Ga0157369_10074222 | 3300013105 | Bacteria | 3648 |
| 98 | Ga0157369_10101909 | 3300013105 | Bacteria | 3060 |
| 99 | Ga0157369_10272286 | 3300013105 | Unclassified | 1764 |
| 100 | Ga0157369_10361342 | 3300013105 | Bacteria | 1507 |
| 101 | Ga0157369_10815294 | 3300013105 | Unclassified | 959 |
| 102 | Ga0157378_10394447 | 3300013297 | Bacteria | 1362 |
| 103 | Ga0157372_10002010 | 3300013307 | Bacteria | 22098 |
| 104 | Ga0157372_10016594 | 3300013307 | Bacteria | 7902 |
| 105 | Ga0157372_10040480 | 3300013307 | Bacteria | 5148 |
| 106 | Ga0157372_10390705 | 3300013307 | Bacteria | 1621 |
| 107 | Ga0157372_10392741 | 3300013307 | Bacteria | 1617 |
| 108 | Ga0157372_10705247 | 3300013307 | Bacteria | 1174 |
| 109 | Ga0206353_10473421 | 3300020082 | Bacteria | 2698 |
| 110 | Ga0206353_11156606 | 3300020082 | Bacteria | 1779 |
| 111 | Ga0207692_10175944 | 3300025898 | Bacteria | 1243 |
| 112 | Ga0207699_10005990 | 3300025906 | Bacteria | 5851 |
| 113 | Ga0207645_10165404 | 3300025907 | Bacteria | 1448 |
| 114 | Ga0207705_10000240 | 3300025909 | Bacteria | 54242 |
| 115 | Ga0207705_10007944 | 3300025909 | Bacteria | 7786 |
| 116 | Ga0207705_10055288 | 3300025909 | Bacteria | 2862 |
| 117 | Ga0207705_10168885 | 3300025909 | Bacteria | 1646 |
| 118 | Ga0207705_10258909 | 3300025909 | Bacteria | 1328 |
| 119 | Ga0207684_10000570 | 3300025910 | Bacteria | 44869 |
| 120 | Ga0207684_10076131 | 3300025910 | Bacteria | 2852 |
| 121 | Ga0207707_10014384 | 3300025912 | Bacteria | 6893 |
| 122 | Ga0207707_10053634 | 3300025912 | Bacteria | 3510 |
| 123 | Ga0207707_10144848 | 3300025912 | Bacteria | 2077 |
| 124 | Ga0207707_10430539 | 3300025912 | Unclassified | 1130 |
| 125 | Ga0207660_10136224 | 3300025917 | Bacteria | 1874 |
| 126 | Ga0207657_10004565 | 3300025919 | Bacteria | 14642 |
| 127 | Ga0207657_10081223 | 3300025919 | Bacteria | 2723 |
| 128 | Ga0207657_10085360 | 3300025919 | Bacteria | 2644 |
| 129 | Ga0207657_10192070 | 3300025919 | Bacteria | 1646 |
| 130 | Ga0207657_10307458 | 3300025919 | Bacteria | 1255 |
| 131 | Ga0207649_10222052 | 3300025920 | Bacteria | 1346 |
| 132 | Ga0207652_10016443 | 3300025921 | Bacteria | 6042 |
| 133 | Ga0207652_10017166 | 3300025921 | Bacteria | 5921 |
| 134 | Ga0207652_10046760 | 3300025921 | Bacteria | 3694 |
| 135 | Ga0207652_10181457 | 3300025921 | Bacteria | 1892 |
| 136 | Ga0207652_10219830 | 3300025921 | Bacteria | 1712 |
| 137 | Ga0207652_10442384 | 3300025921 | Bacteria | 1172 |
| 138 | Ga0207652_10448462 | 3300025921 | Bacteria | 1163 |
| 139 | Ga0207646_10000408 | 3300025922 | Bacteria | 57610 |
| 140 | Ga0207646_10095361 | 3300025922 | Bacteria | 2665 |
| 141 | Ga0207681_10107605 | 3300025923 | Bacteria | 2023 |
| 142 | Ga0207694_10125216 | 3300025924 | Bacteria | 2055 |
| 143 | Ga0207700_10447891 | 3300025928 | Bacteria | 1137 |
| 144 | Ga0207700_10506125 | 3300025928 | Bacteria | 1069 |
| 145 | Ga0207664_10096197 | 3300025929 | Bacteria | 2437 |
| 146 | Ga0207664_10137250 | 3300025929 | Bacteria | 2065 |
| 147 | Ga0207664_10279467 | 3300025929 | Bacteria | 1465 |
| 148 | Ga0207664_10677813 | 3300025929 | Bacteria | 927 |
| 149 | Ga0207690_10000663 | 3300025932 | Bacteria | 22031 |
| 150 | Ga0207706_10001672 | 3300025933 | Bacteria | 21909 |
| 151 | Ga0207706_10073369 | 3300025933 | Bacteria | 3009 |
| 152 | Ga0207686_10141488 | 3300025934 | Unclassified | 1664 |
| 153 | Ga0207686_10449725 | 3300025934 | Bacteria | 991 |
| 154 | Ga0207665_10370504 | 3300025939 | Bacteria | 1085 |
| 155 | Ga0207661_10031846 | 3300025944 | Bacteria | 4079 |
| 156 | Ga0207661_10083107 | 3300025944 | Bacteria | 2649 |
| 157 | Ga0207661_10353257 | 3300025944 | Bacteria | 1327 |
| 158 | Ga0207679_10000959 | 3300025945 | Bacteria | 18517 |
| 159 | Ga0207667_10003354 | 3300025949 | Bacteria | 19763 |
| 160 | Ga0207667_10043495 | 3300025949 | Bacteria | 4766 |
| 161 | Ga0207667_10230893 | 3300025949 | Bacteria | 1895 |
| 162 | Ga0207667_10431579 | 3300025949 | Unclassified | 1340 |
| 163 | Ga0207639_10009310 | 3300026041 | Bacteria | 6771 |
| 164 | Ga0207678_10009891 | 3300026067 | Bacteria | 8372 |
| 165 | Ga0207708_10024310 | 3300026075 | Bacteria | 4582 |
| 166 | Ga0207702_10003515 | 3300026078 | Bacteria | 14284 |
| 167 | Ga0207648_10016339 | 3300026089 | Bacteria | 6785 |
| 168 | Ga0207648_10023091 | 3300026089 | Bacteria | 5579 |
| 169 | Ga0207675_100412859 | 3300026118 | Unclassified | 1332 |
| 170 | Ga0209967_1017508 | 3300027364 | Bacteria | 1034 |
| 171 | Ga0209984_1001169 | 3300027424 | Bacteria | 2812 |
| 172 | Ga0209995_1000516 | 3300027471 | Bacteria | 5870 |
| 173 | Ga0209968_1002255 | 3300027526 | Bacteria | 2914 |
| 174 | Ga0209999_1015951 | 3300027543 | Bacteria | 1367 |
| 175 | Ga0209982_1007251 | 3300027552 | Bacteria | 1620 |
| 176 | Ga0210002_1001793 | 3300027617 | Bacteria | 3059 |
| 177 | Ga0209983_1000050 | 3300027665 | Bacteria | 17529 |
| 178 | Ga0209971_1000011 | 3300027682 | Bacteria | 74088 |
| 179 | Ga0209966_1000380 | 3300027695 | Bacteria | 13475 |
| 180 | Ga0209974_10000045 | 3300027876 | Bacteria | 30820 |
| 181 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 182 | Ga0268265_10208906 | 3300028380 | Bacteria | 1700 |
| 183 | Ga0265325_10000034 | 3300031241 | Bacteria | 99371 |
| 184 | Ga0265313_10007713 | 3300031595 | Bacteria | 7286 |
| 185 | Ga0307416_100927362 | 3300032002 | Bacteria | 972 |
| 186 | Ga0373948_0057450 | 3300034817 | Bacteria | 848 |
| 187 | Ga0395898_0047842 | 3300037466 | Bacteria | 4195 |
| 188 | Ga0395898_0317846 | 3300037466 | Bacteria | 1485 |
| 189 | Ga0395901_0142910 | 3300038443 | Bacteria | 2515 |
| 190 | Ga0395901_0261693 | 3300038443 | Bacteria | 1800 |
| 191 | Ga0436365_1285164 | 3300039437 | Bacteria | 916 |
| 192 | Ga0451577_0082728 | 3300042876 | Bacteria | 2863 |
| 193 | Ga0451577_0159641 | 3300042876 | Bacteria | 2030 |
| 194 | Ga0451577_0285799 | 3300042876 | Bacteria | 1495 |
| 195 | Ga0451577_0584601 | 3300042876 | Bacteria | 1014 |
| 196 | Ga0453683_0049482 | 3300044673 | Bacteria | 2634 |
| 197 | Ga0453683_0167657 | 3300044673 | Bacteria | 1391 |
| 198 | Ga0466966_0075117 | 3300044684 | Bacteria | 2112 |
| 199 | Ga0466961_0011050 | 3300044693 | Bacteria | 5770 |
| 200 | Ga0466961_0197411 | 3300044693 | Bacteria | 1245 |
| 201 | Ga0466963_0023745 | 3300044694 | Bacteria | 3898 |
| 202 | Ga0466963_0435519 | 3300044694 | Bacteria | 925 |
| 203 | Ga0453684_0093692 | 3300044712 | Bacteria | 3698 |
| 204 | Ga0466959_0105238 | 3300045049 | Bacteria | 2018 |
| 205 | Ga0466959_0305679 | 3300045049 | Bacteria | 1089 |
| 206 | Ga0451576_0177287 | 3300045051 | Bacteria | 2225 |
| 207 | Ga0466958_0039174 | 3300045836 | Bacteria | 2846 |
| 208 | Ga0466958_0396388 | 3300045836 | Bacteria | 891 |
| 209 | Ga0496102_0566649 | 3300048905 | Bacteria | 1058 |
| 210 | Ga0496103_0116126 | 3300048906 | Bacteria | 1702 |
| 211 | Ga0496106_0011782 | 3300048909 | Bacteria | 6454 |
| 212 | Ga0496112_0211405 | 3300048915 | Bacteria | 1897 |
| 213 | Ga0501032_0269402 | 3300049569 | Bacteria | 1103 |
| 214 | Ga0501033_0069771 | 3300049570 | Bacteria | 2583 |
| 215 | Ga0501033_0302110 | 3300049570 | Bacteria | 1126 |
| 216 | Ga0501034_0003159 | 3300049571 | Bacteria | 18942 |
| 217 | Ga0501034_0005470 | 3300049571 | Bacteria | 13871 |
| 218 | Ga0501034_0255146 | 3300049571 | Bacteria | 1697 |
| 219 | Ga0501034_0665817 | 3300049571 | Bacteria | 941 |
| 220 | Ga0501034_0886909 | 3300049571 | Bacteria | 780 |
| 221 | Ga0501036_0306242 | 3300049572 | Bacteria | 1328 |
| 222 | Ga0501036_0312550 | 3300049572 | Bacteria | 1313 |
| 223 | Ga0501037_0034926 | 3300049573 | Bacteria | 3708 |
| 224 | Ga0501038_0047311 | 3300049574 | Bacteria | 3726 |
| 225 | Ga0501038_0369359 | 3300049574 | Bacteria | 1114 |
| 226 | Ga0501039_0058157 | 3300049575 | Bacteria | 2994 |
| 227 | Ga0501039_0181106 | 3300049575 | Bacteria | 1657 |
| 228 | Ga0501039_0263170 | 3300049575 | Bacteria | 1355 |
| 229 | Ga0501040_0001379 | 3300049576 | Bacteria | 15333 |
| 230 | Ga0501040_0116455 | 3300049576 | Bacteria | 1872 |
| 231 | Ga0501041_0004828 | 3300049577 | Bacteria | 7834 |
| 232 | Ga0501041_0066792 | 3300049577 | Bacteria | 2204 |
| 233 | Ga0501042_0008914 | 3300049578 | Bacteria | 6655 |
| 234 | Ga0501043_0136862 | 3300049579 | Bacteria | 1918 |
| 235 | Ga0501046_0001576 | 3300049580 | Bacteria | 21809 |
| 236 | Ga0501047_0004644 | 3300049581 | Bacteria | 12926 |
| 237 | Ga0501047_0017810 | 3300049581 | Bacteria | 6805 |
| 238 | Ga0501047_0180540 | 3300049581 | Bacteria | 1977 |
| 239 | Ga0501047_0482294 | 3300049581 | Bacteria | 1067 |
| 240 | Ga0501048_0041210 | 3300049582 | Bacteria | 3308 |
| 241 | Ga0501068_0041689 | 3300049584 | Bacteria | 2759 |
| 242 | Ga0501068_0193717 | 3300049584 | Bacteria | 1288 |
| 243 | Ga0501068_0224712 | 3300049584 | Bacteria | 1193 |
| 244 | Ga0501069_0004283 | 3300049585 | Bacteria | 7376 |
| 245 | Ga0501069_0018089 | 3300049585 | Bacteria | 3802 |
| 246 | Ga0501070_0035938 | 3300049586 | Bacteria | 4137 |
| 247 | Ga0501070_0096940 | 3300049586 | Bacteria | 2439 |
| 248 | Ga0501070_0188115 | 3300049586 | Bacteria | 1697 |
| 249 | Ga0501070_0244220 | 3300049586 | Bacteria | 1469 |
| 250 | Ga0501070_0255050 | 3300049586 | Bacteria | 1434 |
| 251 | Ga0501070_0713238 | 3300049586 | Bacteria | 792 |
| 252 | Ga0501071_0029585 | 3300049587 | Bacteria | 3867 |
| 253 | Ga0501071_0038277 | 3300049587 | Bacteria | 3427 |
| 254 | Ga0501071_0234256 | 3300049587 | Bacteria | 1384 |
| 255 | Ga0501072_0006406 | 3300049588 | Bacteria | 8970 |
| 256 | Ga0501073_0000327 | 3300049589 | Bacteria | 31946 |
| 257 | Ga0501073_0044988 | 3300049589 | Bacteria | 3111 |
| 258 | Ga0501074_0001824 | 3300049590 | Bacteria | 14583 |
| 259 | Ga0501074_0003510 | 3300049590 | Bacteria | 11128 |
| 260 | Ga0501074_0107394 | 3300049590 | Bacteria | 1998 |
| 261 | Ga0501074_0138963 | 3300049590 | Bacteria | 1738 |
| 262 | Ga0501075_0010442 | 3300049591 | Bacteria | 6525 |
| 263 | Ga0501075_0124223 | 3300049591 | Bacteria | 1965 |
| 264 | Ga0501075_0183485 | 3300049591 | Bacteria | 1596 |
| 265 | Ga0501075_0386359 | 3300049591 | Bacteria | 1067 |
| 266 | Ga0501076_0002188 | 3300049592 | Bacteria | 13381 |
| 267 | Ga0501076_0122967 | 3300049592 | Bacteria | 2102 |
| 268 | Ga0501076_0192101 | 3300049592 | Bacteria | 1666 |
| 269 | Ga0501077_0005453 | 3300049593 | Bacteria | 7742 |
| 270 | Ga0501077_0368958 | 3300049593 | Bacteria | 917 |
| 271 | Ga0501079_0000914 | 3300049741 | Bacteria | 20276 |
| 272 | Ga0501079_0256420 | 3300049741 | Bacteria | 1367 |
| 273 | Ga0501079_0280077 | 3300049741 | Bacteria | 1304 |
| 274 | Ga0501079_0502004 | 3300049741 | Bacteria | 954 |
| 275 | Ga0501080_0006066 | 3300049742 | Bacteria | 10834 |
| 276 | Ga0501080_0169221 | 3300049742 | Bacteria | 2016 |
| 277 | Ga0501080_0369401 | 3300049742 | Bacteria | 1293 |
| 278 | Ga0501080_0774691 | 3300049742 | Bacteria | 842 |
| 279 | Ga0501080_0802246 | 3300049742 | Bacteria | 825 |
| 280 | Ga0501081_0044915 | 3300049743 | Bacteria | 3034 |
| 281 | Ga0501081_0051085 | 3300049743 | Bacteria | 2850 |
| 282 | Ga0501083_0002026 | 3300049744 | Bacteria | 13941 |
| 283 | Ga0501083_0188655 | 3300049744 | Bacteria | 1345 |
| 284 | Ga0501035_0065139 | 3300049822 | Bacteria | 3237 |
| 285 | Ga0501035_0078356 | 3300049822 | Bacteria | 2919 |
| 286 | Ga0501035_0598594 | 3300049822 | Bacteria | 898 |
| 287 | Ga0501044_0054809 | 3300049823 | Bacteria | 4096 |
| 288 | Ga0501044_0388101 | 3300049823 | Bacteria | 1310 |
| 289 | Ga0501045_0002112 | 3300049824 | Bacteria | 13449 |
| 290 | nmdc:mga0k408_6820_c1 | 3300050493 | Bacteria | 2981 |
| 291 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 292 | nmdc:mga05p37_489561_c1 | 3300050507 | Bacteria | 1414 |
| 293 | nmdc:mga09592_3106_c1 | 3300050508 | Bacteria | 13485 |
| 294 | nmdc:mga0qj67_1076_c1 | 3300050509 | Bacteria | 18902 |
| 295 | nmdc:mga06r32_1900_c1 | 3300050510 | Bacteria | 18601 |
| 296 | nmdc:mga06r32_235671_c1 | 3300050510 | Bacteria | 1818 |
| 297 | nmdc:mga08y16_13186_c2 | 3300050511 | Bacteria | 4290 |
| 298 | nmdc:mga08y16_711278_c1 | 3300050511 | Bacteria | 1003 |
| 299 | nmdc:mga0n895_1533_c1 | 3300050512 | Bacteria | 17365 |
| 300 | nmdc:mga0rr50_21901_c1 | 3300050513 | Bacteria | 4374 |
| 301 | nmdc:mga08x19_261_c1 | 3300050514 | Bacteria | 40081 |
| 302 | nmdc:mga0a205_3714_c1 | 3300050515 | Bacteria | 13666 |
| 303 | Ga0501084_0006749 | 3300054114 | Bacteria | 9436 |
| 304 | Ga0501084_0244871 | 3300054114 | Bacteria | 1513 |
| 305 | Ga0501084_0251851 | 3300054114 | Bacteria | 1491 |
| 306 | Ga0501084_0589477 | 3300054114 | Bacteria | 939 |
| 307 | Ga0501082_0005093 | 3300060353 | Bacteria | 11450 |
| 308 | Ga0501082_0073406 | 3300060353 | Bacteria | 2947 |
| 309 | Ga0501082_0121293 | 3300060353 | Bacteria | 2266 |
| 310 | Ga0530510_0024408 | 3300061734 | Bacteria | 4313 |
| 311 | Ga0530510_0103629 | 3300061734 | Bacteria | 2081 |
| 312 | Ga0530510_0161514 | 3300061734 | Bacteria | 1657 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10000174 | Ga0070658_100001743 | 208 |
| 2 | 3300025909 | Ga0207705_10000240 | Ga0207705_100002403 | 208 |
| 3 | 3300025917 | Ga0207660_10136224 | Ga0207660_101362242 | 208 |
| 4 | 3300013105 | Ga0157369_10272286 | Ga0157369_102722862 | 209 |
| 5 | 3300044694 | Ga0466963_0023745 | Ga0466963_0023745_1518_2321 | 225 |
| 6 | 3300005535 | Ga0070684_100667665 | Ga0070684_1006676652 | 230 |
| 7 | 3300020082 | Ga0206353_10473421 | Ga0206353_104734213 | 230 |
| 8 | 3300005327 | Ga0070658_10513292 | Ga0070658_105132921 | 231 |
| 9 | 3300005339 | Ga0070660_100392343 | Ga0070660_1003923432 | 231 |
| 10 | 3300005435 | Ga0070714_100565055 | Ga0070714_1005650551 | 231 |
| 11 | 3300005937 | Ga0081455_10039032 | Ga0081455_100390323 | 231 |
| 12 | 3300009093 | Ga0105240_10411177 | Ga0105240_104111773 | 231 |
| 13 | 3300009176 | Ga0105242_10093100 | Ga0105242_100931002 | 231 |
| 14 | 3300009545 | Ga0105237_10030254 | Ga0105237_100302542 | 231 |
| 15 | 3300013104 | Ga0157370_10187116 | Ga0157370_101871162 | 231 |
| 16 | 3300013105 | Ga0157369_10101909 | Ga0157369_101019092 | 231 |
| 17 | 3300013297 | Ga0157378_10394447 | Ga0157378_103944472 | 231 |
| 18 | 3300013307 | Ga0157372_10392741 | Ga0157372_103927411 | 231 |
| 19 | 3300025909 | Ga0207705_10258909 | Ga0207705_102589092 | 231 |
| 20 | 3300025919 | Ga0207657_10192070 | Ga0207657_101920701 | 231 |
| 21 | 3300025929 | Ga0207664_10677813 | Ga0207664_106778132 | 231 |
| 22 | 3300025949 | Ga0207667_10230893 | Ga0207667_102308932 | 231 |
| 23 | 3300049741 | Ga0501079_0280077 | Ga0501079_0280077_505_1206 | 231 |
| 24 | 3300054114 | Ga0501084_0589477 | Ga0501084_0589477_31_732 | 231 |
| 25 | 3300005367 | Ga0070667_100106899 | Ga0070667_1001068993 | 232 |
| 26 | 3300013105 | Ga0157369_10060371 | Ga0157369_100603712 | 232 |
| 27 | 3300013307 | Ga0157372_10705247 | Ga0157372_107052472 | 232 |
| 28 | 3300025939 | Ga0207665_10370504 | Ga0207665_103705042 | 232 |
| 29 | 3300025944 | Ga0207661_10083107 | Ga0207661_100831072 | 232 |
| 30 | 3300044693 | Ga0466961_0197411 | Ga0466961_0197411_255_1064 | 232 |
| 31 | 3300045049 | Ga0466959_0305679 | Ga0466959_0305679_84_893 | 232 |
| 32 | iso_pu_bacteria | 2887375801 | 2887376694 | 232 |
| 33 | 3300005366 | Ga0070659_100149150 | Ga0070659_1001491502 | 233 |
| 34 | 3300005444 | Ga0070694_100019254 | Ga0070694_1000192542 | 233 |
| 35 | 3300005445 | Ga0070708_100007089 | Ga0070708_1000070891 | 233 |
| 36 | 3300005458 | Ga0070681_10017286 | Ga0070681_100172862 | 233 |
| 37 | 3300005458 | Ga0070681_10515940 | Ga0070681_105159402 | 233 |
| 38 | 3300005467 | Ga0070706_100086991 | Ga0070706_1000869912 | 233 |
| 39 | 3300005468 | Ga0070707_100021234 | Ga0070707_1000212346 | 233 |
| 40 | 3300005468 | Ga0070707_100041632 | Ga0070707_1000416322 | 233 |
| 41 | 3300005471 | Ga0070698_100006586 | Ga0070698_1000065869 | 233 |
| 42 | 3300005518 | Ga0070699_100867411 | Ga0070699_1008674111 | 233 |
| 43 | 3300005530 | Ga0070679_100048731 | Ga0070679_1000487312 | 233 |
| 44 | 3300005536 | Ga0070697_100023704 | Ga0070697_1000237045 | 233 |
| 45 | 3300005545 | Ga0070695_100013747 | Ga0070695_1000137473 | 233 |
| 46 | 3300005577 | Ga0068857_100252217 | Ga0068857_1002522172 | 233 |
| 47 | 3300005937 | Ga0081455_10005497 | Ga0081455_100054973 | 233 |
| 48 | 3300006847 | Ga0075431_100061949 | Ga0075431_1000619492 | 233 |
| 49 | 3300006914 | Ga0075436_100000428 | Ga0075436_10000042811 | 233 |
| 50 | 3300009094 | Ga0111539_10444803 | Ga0111539_104448032 | 233 |
| 51 | 3300011119 | Ga0105246_10787802 | Ga0105246_107878022 | 233 |
| 52 | 3300013102 | Ga0157371_10158450 | Ga0157371_101584502 | 233 |
| 53 | 3300013105 | Ga0157369_10000279 | Ga0157369_1000027963 | 233 |
| 54 | 3300013105 | Ga0157369_10001689 | Ga0157369_1000168919 | 233 |
| 55 | 3300013307 | Ga0157372_10390705 | Ga0157372_103907052 | 233 |
| 56 | 3300020082 | Ga0206353_11156606 | Ga0206353_111566061 | 233 |
| 57 | 3300025909 | Ga0207705_10007944 | Ga0207705_100079442 | 233 |
| 58 | 3300025909 | Ga0207705_10168885 | Ga0207705_101688852 | 233 |
| 59 | 3300025910 | Ga0207684_10000570 | Ga0207684_100005708 | 233 |
| 60 | 3300025912 | Ga0207707_10014384 | Ga0207707_100143842 | 233 |
| 61 | 3300025912 | Ga0207707_10053634 | Ga0207707_100536342 | 233 |
| 62 | 3300025912 | Ga0207707_10430539 | Ga0207707_104305392 | 233 |
| 63 | 3300025921 | Ga0207652_10016443 | Ga0207652_100164436 | 233 |
| 64 | 3300025921 | Ga0207652_10017166 | Ga0207652_100171664 | 233 |
| 65 | 3300025922 | Ga0207646_10000408 | Ga0207646_1000040850 | 233 |
| 66 | 3300025922 | Ga0207646_10095361 | Ga0207646_100953611 | 233 |
| 67 | 3300025923 | Ga0207681_10107605 | Ga0207681_101076052 | 233 |
| 68 | 3300025929 | Ga0207664_10137250 | Ga0207664_101372502 | 233 |
| 69 | 3300025933 | Ga0207706_10073369 | Ga0207706_100733692 | 233 |
| 70 | 3300025944 | Ga0207661_10353257 | Ga0207661_103532572 | 233 |
| 71 | 3300025949 | Ga0207667_10431579 | Ga0207667_104315792 | 233 |
| 72 | 3300027364 | Ga0209967_1017508 | Ga0209967_10175081 | 233 |
| 73 | 3300027424 | Ga0209984_1001169 | Ga0209984_10011693 | 233 |
| 74 | 3300027471 | Ga0209995_1000516 | Ga0209995_10005166 | 233 |
| 75 | 3300027526 | Ga0209968_1002255 | Ga0209968_10022552 | 233 |
| 76 | 3300027543 | Ga0209999_1015951 | Ga0209999_10159512 | 233 |
| 77 | 3300027552 | Ga0209982_1007251 | Ga0209982_10072512 | 233 |
| 78 | 3300027617 | Ga0210002_1001793 | Ga0210002_10017932 | 233 |
| 79 | 3300027665 | Ga0209983_1000050 | Ga0209983_100005016 | 233 |
| 80 | 3300027682 | Ga0209971_1000011 | Ga0209971_100001110 | 233 |
| 81 | 3300027695 | Ga0209966_1000380 | Ga0209966_10003809 | 233 |
| 82 | 3300027876 | Ga0209974_10000045 | Ga0209974_1000004529 | 233 |
| 83 | 3300028380 | Ga0268265_10208906 | Ga0268265_102089062 | 233 |
| 84 | 3300034817 | Ga0373948_0057450 | Ga0373948_0057450_41_745 | 233 |
| 85 | 3300037466 | Ga0395898_0047842 | Ga0395898_0047842_2945_3727 | 233 |
| 86 | 3300038443 | Ga0395901_0261693 | Ga0395901_0261693_656_1438 | 233 |
| 87 | 3300042876 | Ga0451577_0082728 | Ga0451577_0082728_1869_2573 | 233 |
| 88 | 3300042876 | Ga0451577_0584601 | Ga0451577_0584601_169_873 | 233 |
| 89 | 3300044673 | Ga0453683_0049482 | Ga0453683_0049482_419_1123 | 233 |
| 90 | 3300044684 | Ga0466966_0075117 | Ga0466966_0075117_145_963 | 233 |
| 91 | 3300044694 | Ga0466963_0435519 | Ga0466963_0435519_54_866 | 233 |
| 92 | 3300044712 | Ga0453684_0093692 | Ga0453684_0093692_1496_2200 | 233 |
| 93 | 3300045049 | Ga0466959_0105238 | Ga0466959_0105238_341_1135 | 233 |
| 94 | 3300045051 | Ga0451576_0177287 | Ga0451576_0177287_312_1016 | 233 |
| 95 | 3300045836 | Ga0466958_0039174 | Ga0466958_0039174_1288_2106 | 233 |
| 96 | 3300049570 | Ga0501033_0069771 | Ga0501033_0069771_382_1086 | 233 |
| 97 | 3300049574 | Ga0501038_0369359 | Ga0501038_0369359_326_1030 | 233 |
| 98 | 3300049575 | Ga0501039_0058157 | Ga0501039_0058157_2119_2823 | 233 |
| 99 | 3300049576 | Ga0501040_0001379 | Ga0501040_0001379_6585_7289 | 233 |
| 100 | 3300049577 | Ga0501041_0004828 | Ga0501041_0004828_3453_4157 | 233 |
| 101 | 3300049578 | Ga0501042_0008914 | Ga0501042_0008914_192_896 | 233 |
| 102 | 3300049580 | Ga0501046_0001576 | Ga0501046_0001576_18699_19403 | 233 |
| 103 | 3300049581 | Ga0501047_0017810 | Ga0501047_0017810_4423_5127 | 233 |
| 104 | 3300049582 | Ga0501048_0041210 | Ga0501048_0041210_206_910 | 233 |
| 105 | 3300049584 | Ga0501068_0041689 | Ga0501068_0041689_245_949 | 233 |
| 106 | 3300049584 | Ga0501068_0193717 | Ga0501068_0193717_309_1013 | 233 |
| 107 | 3300049587 | Ga0501071_0038277 | Ga0501071_0038277_551_1255 | 233 |
| 108 | 3300049587 | Ga0501071_0234256 | Ga0501071_0234256_524_1228 | 233 |
| 109 | 3300049589 | Ga0501073_0044988 | Ga0501073_0044988_1719_2423 | 233 |
| 110 | 3300049590 | Ga0501074_0001824 | Ga0501074_0001824_8543_9247 | 233 |
| 111 | 3300049590 | Ga0501074_0138963 | Ga0501074_0138963_185_889 | 233 |
| 112 | 3300049591 | Ga0501075_0010442 | Ga0501075_0010442_413_1117 | 233 |
| 113 | 3300049591 | Ga0501075_0124223 | Ga0501075_0124223_717_1421 | 233 |
| 114 | 3300049591 | Ga0501075_0183485 | Ga0501075_0183485_456_1160 | 233 |
| 115 | 3300049591 | Ga0501075_0386359 | Ga0501075_0386359_74_778 | 233 |
| 116 | 3300049592 | Ga0501076_0002188 | Ga0501076_0002188_8537_9241 | 233 |
| 117 | 3300049592 | Ga0501076_0122967 | Ga0501076_0122967_1169_1873 | 233 |
| 118 | 3300049592 | Ga0501076_0192101 | Ga0501076_0192101_479_1183 | 233 |
| 119 | 3300049593 | Ga0501077_0005453 | Ga0501077_0005453_5375_6079 | 233 |
| 120 | 3300049593 | Ga0501077_0368958 | Ga0501077_0368958_117_821 | 233 |
| 121 | 3300049741 | Ga0501079_0000914 | Ga0501079_0000914_14557_15261 | 233 |
| 122 | 3300049741 | Ga0501079_0256420 | Ga0501079_0256420_471_1175 | 233 |
| 123 | 3300049741 | Ga0501079_0502004 | Ga0501079_0502004_141_845 | 233 |
| 124 | 3300049742 | Ga0501080_0169221 | Ga0501080_0169221_237_941 | 233 |
| 125 | 3300049743 | Ga0501081_0044915 | Ga0501081_0044915_880_1584 | 233 |
| 126 | 3300049743 | Ga0501081_0051085 | Ga0501081_0051085_83_787 | 233 |
| 127 | 3300049744 | Ga0501083_0002026 | Ga0501083_0002026_4808_5512 | 233 |
| 128 | 3300049822 | Ga0501035_0065139 | Ga0501035_0065139_1164_1868 | 233 |
| 129 | 3300049824 | Ga0501045_0002112 | Ga0501045_0002112_6577_7281 | 233 |
| 130 | 3300050507 | nmdc:mga05p37_489561_c1 | nmdc:mga05p37_489561_c1_291_995 | 233 |
| 131 | 3300050510 | nmdc:mga06r32_235671_c1 | nmdc:mga06r32_235671_c1_719_1423 | 233 |
| 132 | 3300050511 | nmdc:mga08y16_711278_c1 | nmdc:mga08y16_711278_c1_246_950 | 233 |
| 133 | 3300050514 | nmdc:mga08x19_261_c1 | nmdc:mga08x19_261_c1_11380_12087 | 233 |
| 134 | 3300054114 | Ga0501084_0006749 | Ga0501084_0006749_1449_2153 | 233 |
| 135 | 3300054114 | Ga0501084_0244871 | Ga0501084_0244871_438_1142 | 233 |
| 136 | 3300054114 | Ga0501084_0251851 | Ga0501084_0251851_411_1115 | 233 |
| 137 | 3300060353 | Ga0501082_0005093 | Ga0501082_0005093_8468_9172 | 233 |
| 138 | 3300060353 | Ga0501082_0073406 | Ga0501082_0073406_1813_2517 | 233 |
| 139 | 3300061734 | Ga0530510_0024408 | Ga0530510_0024408_2733_3437 | 233 |
| 140 | 3300061734 | Ga0530510_0103629 | Ga0530510_0103629_1165_1869 | 233 |
| 141 | 3300061734 | Ga0530510_0161514 | Ga0530510_0161514_234_938 | 233 |
| 142 | 3300005329 | Ga0070683_100117417 | Ga0070683_1001174172 | 234 |
| 143 | 3300005445 | Ga0070708_100136696 | Ga0070708_1001366962 | 234 |
| 144 | 3300005467 | Ga0070706_100092110 | Ga0070706_1000921103 | 234 |
| 145 | 3300013105 | Ga0157369_10074222 | Ga0157369_100742223 | 234 |
| 146 | 3300025910 | Ga0207684_10076131 | Ga0207684_100761313 | 234 |
| 147 | 3300025929 | Ga0207664_10279467 | Ga0207664_102794671 | 234 |
| 148 | 3300025944 | Ga0207661_10031846 | Ga0207661_100318463 | 234 |
| 149 | 3300044693 | Ga0466961_0011050 | Ga0466961_0011050_4379_5203 | 234 |
| 150 | 3300005347 | Ga0070668_100299785 | Ga0070668_1002997852 | 235 |
| 151 | 3300005459 | Ga0068867_100139038 | Ga0068867_1001390383 | 235 |
| 152 | 3300005842 | Ga0068858_100013832 | Ga0068858_1000138329 | 235 |
| 153 | 3300025934 | Ga0207686_10141488 | Ga0207686_101414882 | 235 |
| 154 | 3300026089 | Ga0207648_10023091 | Ga0207648_100230915 | 235 |
| 155 | 3300026118 | Ga0207675_100412859 | Ga0207675_1004128592 | 235 |
| 156 | 3300032002 | Ga0307416_100927362 | Ga0307416_1009273621 | 235 |
| 157 | 3300049575 | Ga0501039_0181106 | Ga0501039_0181106_727_1434 | 235 |
| 158 | 3300049576 | Ga0501040_0116455 | Ga0501040_0116455_992_1699 | 235 |
| 159 | 3300049577 | Ga0501041_0066792 | Ga0501041_0066792_590_1297 | 235 |
| 160 | 3300003911 | JGI25405J52794_10009843 | JGI25405J52794_100098432 | 236 |
| 161 | 3300005327 | Ga0070658_10134989 | Ga0070658_101349892 | 236 |
| 162 | 3300005328 | Ga0070676_10305282 | Ga0070676_103052822 | 236 |
| 163 | 3300005339 | Ga0070660_100001756 | Ga0070660_1000017569 | 236 |
| 164 | 3300005339 | Ga0070660_100297151 | Ga0070660_1002971512 | 236 |
| 165 | 3300005339 | Ga0070660_100363486 | Ga0070660_1003634861 | 236 |
| 166 | 3300005340 | Ga0070689_100308892 | Ga0070689_1003088921 | 236 |
| 167 | 3300005344 | Ga0070661_100009713 | Ga0070661_1000097133 | 236 |
| 168 | 3300005366 | Ga0070659_100000860 | Ga0070659_10000086018 | 236 |
| 169 | 3300005366 | Ga0070659_100054762 | Ga0070659_1000547621 | 236 |
| 170 | 3300005366 | Ga0070659_100237910 | Ga0070659_1002379102 | 236 |
| 171 | 3300005434 | Ga0070709_10002505 | Ga0070709_100025052 | 236 |
| 172 | 3300005435 | Ga0070714_100014028 | Ga0070714_1000140281 | 236 |
| 173 | 3300005435 | Ga0070714_100821472 | Ga0070714_1008214721 | 236 |
| 174 | 3300005436 | Ga0070713_100003704 | Ga0070713_10000370411 | 236 |
| 175 | 3300005437 | Ga0070710_10142504 | Ga0070710_101425042 | 236 |
| 176 | 3300005439 | Ga0070711_100024373 | Ga0070711_1000243732 | 236 |
| 177 | 3300005455 | Ga0070663_100037215 | Ga0070663_1000372153 | 236 |
| 178 | 3300005457 | Ga0070662_100000609 | Ga0070662_10000060917 | 236 |
| 179 | 3300005518 | Ga0070699_100027034 | Ga0070699_1000270342 | 236 |
| 180 | 3300005530 | Ga0070679_100028535 | Ga0070679_1000285352 | 236 |
| 181 | 3300005530 | Ga0070679_100043561 | Ga0070679_1000435614 | 236 |
| 182 | 3300005530 | Ga0070679_100089138 | Ga0070679_1000891383 | 236 |
| 183 | 3300005539 | Ga0068853_100007581 | Ga0068853_1000075818 | 236 |
| 184 | 3300005546 | Ga0070696_100003209 | Ga0070696_1000032098 | 236 |
| 185 | 3300005563 | Ga0068855_100000661 | Ga0068855_10000066135 | 236 |
| 186 | 3300005563 | Ga0068855_100269804 | Ga0068855_1002698043 | 236 |
| 187 | 3300005564 | Ga0070664_100002475 | Ga0070664_10000247511 | 236 |
| 188 | 3300005614 | Ga0068856_100001862 | Ga0068856_1000018628 | 236 |
| 189 | 3300005617 | Ga0068859_100514546 | Ga0068859_1005145462 | 236 |
| 190 | 3300005937 | Ga0081455_10001419 | Ga0081455_100014196 | 236 |
| 191 | 3300006058 | Ga0075432_10010554 | Ga0075432_100105543 | 236 |
| 192 | 3300006194 | Ga0075427_10000669 | Ga0075427_100006693 | 236 |
| 193 | 3300006195 | Ga0075366_10015884 | Ga0075366_100158845 | 236 |
| 194 | 3300006844 | Ga0075428_100056705 | Ga0075428_1000567052 | 236 |
| 195 | 3300006846 | Ga0075430_100000070 | Ga0075430_1000000707 | 236 |
| 196 | 3300006847 | Ga0075431_100019547 | Ga0075431_1000195477 | 236 |
| 197 | 3300006852 | Ga0075433_10004877 | Ga0075433_100048776 | 236 |
| 198 | 3300006871 | Ga0075434_100039312 | Ga0075434_1000393122 | 236 |
| 199 | 3300006880 | Ga0075429_100036239 | Ga0075429_1000362392 | 236 |
| 200 | 3300006881 | Ga0068865_100246384 | Ga0068865_1002463842 | 236 |
| 201 | 3300006931 | Ga0097620_100514468 | Ga0097620_1005144682 | 236 |
| 202 | 3300007076 | Ga0075435_100106281 | Ga0075435_1001062812 | 236 |
| 203 | 3300009094 | Ga0111539_10003613 | Ga0111539_100036132 | 236 |
| 204 | 3300009147 | Ga0114129_10005426 | Ga0114129_100054262 | 236 |
| 205 | 3300009176 | Ga0105242_10209309 | Ga0105242_102093092 | 236 |
| 206 | 3300009176 | Ga0105242_10642708 | Ga0105242_106427082 | 236 |
| 207 | 3300009553 | Ga0105249_10884011 | Ga0105249_108840111 | 236 |
| 208 | 3300013100 | Ga0157373_10003405 | Ga0157373_1000340512 | 236 |
| 209 | 3300013100 | Ga0157373_10046911 | Ga0157373_100469113 | 236 |
| 210 | 3300013100 | Ga0157373_10126964 | Ga0157373_101269642 | 236 |
| 211 | 3300013102 | Ga0157371_10001755 | Ga0157371_100017557 | 236 |
| 212 | 3300013104 | Ga0157370_10013710 | Ga0157370_100137104 | 236 |
| 213 | 3300013104 | Ga0157370_10018157 | Ga0157370_100181578 | 236 |
| 214 | 3300013104 | Ga0157370_10038268 | Ga0157370_100382686 | 236 |
| 215 | 3300013104 | Ga0157370_10294878 | Ga0157370_102948782 | 236 |
| 216 | 3300013105 | Ga0157369_10361342 | Ga0157369_103613422 | 236 |
| 217 | 3300013105 | Ga0157369_10815294 | Ga0157369_108152942 | 236 |
| 218 | 3300013307 | Ga0157372_10002010 | Ga0157372_1000201017 | 236 |
| 219 | 3300013307 | Ga0157372_10016594 | Ga0157372_100165946 | 236 |
| 220 | 3300013307 | Ga0157372_10040480 | Ga0157372_100404804 | 236 |
| 221 | 3300025898 | Ga0207692_10175944 | Ga0207692_101759442 | 236 |
| 222 | 3300025906 | Ga0207699_10005990 | Ga0207699_100059906 | 236 |
| 223 | 3300025907 | Ga0207645_10165404 | Ga0207645_101654042 | 236 |
| 224 | 3300025909 | Ga0207705_10055288 | Ga0207705_100552882 | 236 |
| 225 | 3300025912 | Ga0207707_10144848 | Ga0207707_101448482 | 236 |
| 226 | 3300025919 | Ga0207657_10004565 | Ga0207657_100045658 | 236 |
| 227 | 3300025919 | Ga0207657_10081223 | Ga0207657_100812232 | 236 |
| 228 | 3300025919 | Ga0207657_10085360 | Ga0207657_100853602 | 236 |
| 229 | 3300025919 | Ga0207657_10307458 | Ga0207657_103074582 | 236 |
| 230 | 3300025920 | Ga0207649_10222052 | Ga0207649_102220521 | 236 |
| 231 | 3300025921 | Ga0207652_10046760 | Ga0207652_100467603 | 236 |
| 232 | 3300025921 | Ga0207652_10181457 | Ga0207652_101814572 | 236 |
| 233 | 3300025921 | Ga0207652_10219830 | Ga0207652_102198303 | 236 |
| 234 | 3300025921 | Ga0207652_10442384 | Ga0207652_104423842 | 236 |
| 235 | 3300025921 | Ga0207652_10448462 | Ga0207652_104484622 | 236 |
| 236 | 3300025924 | Ga0207694_10125216 | Ga0207694_101252162 | 236 |
| 237 | 3300025928 | Ga0207700_10447891 | Ga0207700_104478912 | 236 |
| 238 | 3300025928 | Ga0207700_10506125 | Ga0207700_105061251 | 236 |
| 239 | 3300025929 | Ga0207664_10096197 | Ga0207664_100961973 | 236 |
| 240 | 3300025932 | Ga0207690_10000663 | Ga0207690_100006638 | 236 |
| 241 | 3300025933 | Ga0207706_10001672 | Ga0207706_100016728 | 236 |
| 242 | 3300025934 | Ga0207686_10449725 | Ga0207686_104497252 | 236 |
| 243 | 3300025945 | Ga0207679_10000959 | Ga0207679_1000095915 | 236 |
| 244 | 3300025949 | Ga0207667_10003354 | Ga0207667_100033545 | 236 |
| 245 | 3300025949 | Ga0207667_10043495 | Ga0207667_100434955 | 236 |
| 246 | 3300026041 | Ga0207639_10009310 | Ga0207639_100093103 | 236 |
| 247 | 3300026067 | Ga0207678_10009891 | Ga0207678_100098913 | 236 |
| 248 | 3300026075 | Ga0207708_10024310 | Ga0207708_100243104 | 236 |
| 249 | 3300026078 | Ga0207702_10003515 | Ga0207702_1000351512 | 236 |
| 250 | 3300026089 | Ga0207648_10016339 | Ga0207648_100163394 | 236 |
| 251 | 3300027907 | Ga0207428_10000075 | Ga0207428_1000007538 | 236 |
| 252 | 3300031241 | Ga0265325_10000034 | Ga0265325_1000003416 | 236 |
| 253 | 3300031595 | Ga0265313_10007713 | Ga0265313_100077135 | 236 |
| 254 | 3300037466 | Ga0395898_0317846 | Ga0395898_0317846_534_1244 | 236 |
| 255 | 3300038443 | Ga0395901_0142910 | Ga0395901_0142910_1213_1923 | 236 |
| 256 | 3300039437 | Ga0436365_1285164 | Ga0436365_1285164_66_779 | 236 |
| 257 | 3300042876 | Ga0451577_0159641 | Ga0451577_0159641_573_1295 | 236 |
| 258 | 3300042876 | Ga0451577_0285799 | Ga0451577_0285799_621_1331 | 236 |
| 259 | 3300044673 | Ga0453683_0167657 | Ga0453683_0167657_648_1367 | 236 |
| 260 | 3300045836 | Ga0466958_0396388 | Ga0466958_0396388_35_751 | 236 |
| 261 | 3300048905 | Ga0496102_0566649 | Ga0496102_0566649_228_947 | 236 |
| 262 | 3300048906 | Ga0496103_0116126 | Ga0496103_0116126_367_1086 | 236 |
| 263 | 3300048909 | Ga0496106_0011782 | Ga0496106_0011782_3347_4066 | 236 |
| 264 | 3300048915 | Ga0496112_0211405 | Ga0496112_0211405_276_992 | 236 |
| 265 | 3300049569 | Ga0501032_0269402 | Ga0501032_0269402_314_1024 | 236 |
| 266 | 3300049570 | Ga0501033_0302110 | Ga0501033_0302110_245_955 | 236 |
| 267 | 3300049571 | Ga0501034_0003159 | Ga0501034_0003159_8888_9613 | 236 |
| 268 | 3300049571 | Ga0501034_0005470 | Ga0501034_0005470_7323_8048 | 236 |
| 269 | 3300049571 | Ga0501034_0255146 | Ga0501034_0255146_314_1024 | 236 |
| 270 | 3300049571 | Ga0501034_0665817 | Ga0501034_0665817_172_882 | 236 |
| 271 | 3300049571 | Ga0501034_0886909 | Ga0501034_0886909_60_770 | 236 |
| 272 | 3300049572 | Ga0501036_0306242 | Ga0501036_0306242_79_789 | 236 |
| 273 | 3300049572 | Ga0501036_0312550 | Ga0501036_0312550_540_1250 | 236 |
| 274 | 3300049573 | Ga0501037_0034926 | Ga0501037_0034926_1804_2514 | 236 |
| 275 | 3300049574 | Ga0501038_0047311 | Ga0501038_0047311_1804_2514 | 236 |
| 276 | 3300049575 | Ga0501039_0263170 | Ga0501039_0263170_106_816 | 236 |
| 277 | 3300049579 | Ga0501043_0136862 | Ga0501043_0136862_44_754 | 236 |
| 278 | 3300049581 | Ga0501047_0004644 | Ga0501047_0004644_3230_3949 | 236 |
| 279 | 3300049581 | Ga0501047_0180540 | Ga0501047_0180540_418_1137 | 236 |
| 280 | 3300049581 | Ga0501047_0482294 | Ga0501047_0482294_44_754 | 236 |
| 281 | 3300049584 | Ga0501068_0224712 | Ga0501068_0224712_172_882 | 236 |
| 282 | 3300049585 | Ga0501069_0004283 | Ga0501069_0004283_5681_6400 | 236 |
| 283 | 3300049585 | Ga0501069_0018089 | Ga0501069_0018089_2290_3003 | 236 |
| 284 | 3300049586 | Ga0501070_0035938 | Ga0501070_0035938_3113_3832 | 236 |
| 285 | 3300049586 | Ga0501070_0096940 | Ga0501070_0096940_1416_2126 | 236 |
| 286 | 3300049586 | Ga0501070_0188115 | Ga0501070_0188115_674_1384 | 236 |
| 287 | 3300049586 | Ga0501070_0244220 | Ga0501070_0244220_25_738 | 236 |
| 288 | 3300049586 | Ga0501070_0255050 | Ga0501070_0255050_629_1342 | 236 |
| 289 | 3300049586 | Ga0501070_0713238 | Ga0501070_0713238_60_770 | 236 |
| 290 | 3300049587 | Ga0501071_0029585 | Ga0501071_0029585_77_787 | 236 |
| 291 | 3300049588 | Ga0501072_0006406 | Ga0501072_0006406_610_1335 | 236 |
| 292 | 3300049589 | Ga0501073_0000327 | Ga0501073_0000327_21138_21857 | 236 |
| 293 | 3300049590 | Ga0501074_0003510 | Ga0501074_0003510_1444_2163 | 236 |
| 294 | 3300049590 | Ga0501074_0107394 | Ga0501074_0107394_897_1610 | 236 |
| 295 | 3300049742 | Ga0501080_0006066 | Ga0501080_0006066_7237_7956 | 236 |
| 296 | 3300049742 | Ga0501080_0369401 | Ga0501080_0369401_44_754 | 236 |
| 297 | 3300049742 | Ga0501080_0774691 | Ga0501080_0774691_16_735 | 236 |
| 298 | 3300049742 | Ga0501080_0802246 | Ga0501080_0802246_56_766 | 236 |
| 299 | 3300049744 | Ga0501083_0188655 | Ga0501083_0188655_540_1250 | 236 |
| 300 | 3300049822 | Ga0501035_0078356 | Ga0501035_0078356_78_788 | 236 |
| 301 | 3300049822 | Ga0501035_0598594 | Ga0501035_0598594_150_860 | 236 |
| 302 | 3300049823 | Ga0501044_0054809 | Ga0501044_0054809_673_1383 | 236 |
| 303 | 3300049823 | Ga0501044_0388101 | Ga0501044_0388101_429_1139 | 236 |
| 304 | 3300050493 | nmdc:mga0k408_6820_c1 | nmdc:mga0k408_6820_c1_191_901 | 236 |
| 305 | 3300050507 | nmdc:mga05p37_32_c1 | nmdc:mga05p37_32_c1_83733_84446 | 236 |
| 306 | 3300050508 | nmdc:mga09592_3106_c1 | nmdc:mga09592_3106_c1_4826_5539 | 236 |
| 307 | 3300050509 | nmdc:mga0qj67_1076_c1 | nmdc:mga0qj67_1076_c1_2813_3526 | 236 |
| 308 | 3300050510 | nmdc:mga06r32_1900_c1 | nmdc:mga06r32_1900_c1_6450_7163 | 236 |
| 309 | 3300050511 | nmdc:mga08y16_13186_c2 | nmdc:mga08y16_13186_c2_702_1415 | 236 |
| 310 | 3300050512 | nmdc:mga0n895_1533_c1 | nmdc:mga0n895_1533_c1_14578_15291 | 236 |
| 311 | 3300050513 | nmdc:mga0rr50_21901_c1 | nmdc:mga0rr50_21901_c1_2887_3600 | 236 |
| 312 | 3300050515 | nmdc:mga0a205_3714_c1 | nmdc:mga0a205_3714_c1_2941_3654 | 236 |
| 313 | 3300060353 | Ga0501082_0121293 | Ga0501082_0121293_355_1074 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9557 | 1 | 236 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9518 | 1 | 236 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9444 | 4 | 224 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9369 | 4 | 224 |
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.9286 | 4 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9718 | 1 | 236 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9677 | 1 | 236 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.966 | 5 | 236 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.95 | 5 | 236 | 3.40.50.300 |
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9441 | 2 | 68 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382XKN7-F1-model_v4 | ABC transporter domain-containing protein | 0.9791 | 7 | 217 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A351AAV7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9786 | 10 | 196 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A536ECH0-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9785 | 5 | 236 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A381SD12-F1-model_v4 | ABC transporter domain-containing protein | 0.9766 | 27 | 236 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A399EYD5-F1-model_v4 | High-affinity branched-chain amino acid transport ATP-binding protein LivF | 0.9748 | 5 | 236 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar