F402179

General Info

Members Datasets Scaffolds Average Seq Length
313 171 312 241

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10074222|Ga0157369_100742223
Length 284
Sequence MSMAKTSPVANGTAPGADPALLEVRNLRAGFGSQTIIHGVDLDVRAGEVTGIFGLNGAGKSVLLKVIAGVVPTWSGSVRLDGAEISKLLPEQRVARGMAHVPQGRQVFPSLSVEQNLRVGAYTLRRRDRSAYAGRLEMVYDIFPRLAERRGQAAGTMSGGEQAMLAVGRALICDPKLVLIDEPSAGLAPAVVEDLLEVLLKVRELGLTMLLVEQNIRFGLRLSERACLLQKGRVVYSGSREDLDQERLAQYLGVGRLLSSDLSAGLDKPKRRSAPRRPKTKPQP

Samples

Sample ID Description Type Environment
1 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
117 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
118 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.64
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.64
Nodule 0
Rhizoplane 1.28
Rhizosphere 97.76
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10009843 3300003911 Bacteria 1811
2 Ga0070658_10000174 3300005327 Bacteria 56278
3 Ga0070658_10134989 3300005327 Bacteria 2058
4 Ga0070658_10513292 3300005327 Bacteria 1036
5 Ga0070676_10305282 3300005328 Bacteria 1080
6 Ga0070683_100117417 3300005329 Bacteria 2512
7 Ga0070660_100001756 3300005339 Bacteria 14874
8 Ga0070660_100297151 3300005339 Bacteria 1323
9 Ga0070660_100363486 3300005339 Bacteria 1193
10 Ga0070660_100392343 3300005339 Bacteria 1147
11 Ga0070689_100308892 3300005340 Bacteria 1318
12 Ga0070661_100009713 3300005344 Bacteria 6674
13 Ga0070668_100299785 3300005347 Unclassified 1348
14 Ga0070659_100000860 3300005366 Bacteria 22191
15 Ga0070659_100054762 3300005366 Bacteria 3143
16 Ga0070659_100149150 3300005366 Bacteria 1907
17 Ga0070659_100237910 3300005366 Bacteria 1506
18 Ga0070667_100106899 3300005367 Bacteria 2422
19 Ga0070709_10002505 3300005434 Bacteria 9942
20 Ga0070714_100014028 3300005435 Bacteria 6429
21 Ga0070714_100565055 3300005435 Bacteria 1090
22 Ga0070714_100821472 3300005435 Bacteria 901
23 Ga0070713_100003704 3300005436 Bacteria 10118
24 Ga0070710_10142504 3300005437 Bacteria 1471
25 Ga0070711_100024373 3300005439 Bacteria 3946
26 Ga0070694_100019254 3300005444 Bacteria 4340
27 Ga0070708_100007089 3300005445 Bacteria 8944
28 Ga0070708_100136696 3300005445 Bacteria 2271
29 Ga0070663_100037215 3300005455 Bacteria 3386
30 Ga0070662_100000609 3300005457 Bacteria 21833
31 Ga0070681_10017286 3300005458 Bacteria 7208
32 Ga0070681_10515940 3300005458 Bacteria 1108
33 Ga0068867_100139038 3300005459 Bacteria 1896
34 Ga0070706_100086991 3300005467 Bacteria 2896
35 Ga0070706_100092110 3300005467 Bacteria 2812
36 Ga0070707_100021234 3300005468 Bacteria 6137
37 Ga0070707_100041632 3300005468 Bacteria 4398
38 Ga0070698_100006586 3300005471 Bacteria 12593
39 Ga0070699_100027034 3300005518 Bacteria 4949
40 Ga0070699_100867411 3300005518 Bacteria 826
41 Ga0070679_100028535 3300005530 Bacteria 5503
42 Ga0070679_100043561 3300005530 Bacteria 4470
43 Ga0070679_100048731 3300005530 Bacteria 4220
44 Ga0070679_100089138 3300005530 Bacteria 3072
45 Ga0070684_100667665 3300005535 Bacteria 968
46 Ga0070697_100023704 3300005536 Bacteria 4883
47 Ga0068853_100007581 3300005539 Bacteria 8691
48 Ga0070695_100013747 3300005545 Bacteria 4865
49 Ga0070696_100003209 3300005546 Bacteria 10887
50 Ga0068855_100000661 3300005563 Bacteria 42196
51 Ga0068855_100269804 3300005563 Bacteria 1892
52 Ga0070664_100002475 3300005564 Bacteria 14875
53 Ga0068857_100252217 3300005577 Bacteria 1618
54 Ga0068856_100001862 3300005614 Bacteria 22019
55 Ga0068859_100514546 3300005617 Bacteria 1292
56 Ga0068858_100013832 3300005842 Bacteria 7616
57 Ga0081455_10001419 3300005937 Bacteria 29668
58 Ga0081455_10005497 3300005937 Bacteria 13890
59 Ga0081455_10039032 3300005937 Bacteria 4200
60 Ga0075432_10010554 3300006058 Bacteria 3137
61 Ga0075427_10000669 3300006194 Bacteria 4076
62 Ga0075366_10015884 3300006195 Bacteria 4321
63 Ga0075428_100056705 3300006844 Bacteria 4290
64 Ga0075430_100000070 3300006846 Bacteria 55805
65 Ga0075431_100019547 3300006847 Bacteria 6909
66 Ga0075431_100061949 3300006847 Bacteria 3860
67 Ga0075433_10004877 3300006852 Bacteria 10495
68 Ga0075434_100039312 3300006871 Bacteria 4687
69 Ga0075429_100036239 3300006880 Bacteria 4290
70 Ga0068865_100246384 3300006881 Bacteria 1408
71 Ga0075436_100000428 3300006914 Bacteria 26958
72 Ga0097620_100514468 3300006931 Bacteria 1292
73 Ga0075435_100106281 3300007076 Bacteria 2330
74 Ga0105240_10411177 3300009093 Unclassified 1522
75 Ga0111539_10003613 3300009094 Bacteria 20380
76 Ga0111539_10444803 3300009094 Bacteria 1509
77 Ga0114129_10005426 3300009147 Bacteria 18011
78 Ga0105242_10093100 3300009176 Bacteria 2540
79 Ga0105242_10209309 3300009176 Bacteria 1737
80 Ga0105242_10642708 3300009176 Unclassified 1031
81 Ga0105237_10030254 3300009545 Bacteria 5501
82 Ga0105249_10884011 3300009553 Bacteria 960
83 Ga0105246_10787802 3300011119 Bacteria 842
84 Ga0157373_10003405 3300013100 Bacteria 12029
85 Ga0157373_10046911 3300013100 Bacteria 3082
86 Ga0157373_10126964 3300013100 Bacteria 1794
87 Ga0157371_10001755 3300013102 Bacteria 21981
88 Ga0157371_10158450 3300013102 Bacteria 1616
89 Ga0157370_10013710 3300013104 Bacteria 8334
90 Ga0157370_10018157 3300013104 Bacteria 7079
91 Ga0157370_10038268 3300013104 Bacteria 4641
92 Ga0157370_10187116 3300013104 Bacteria 1922
93 Ga0157370_10294878 3300013104 Bacteria 1498
94 Ga0157369_10000279 3300013105 Bacteria 68845
95 Ga0157369_10001689 3300013105 Bacteria 26944
96 Ga0157369_10060371 3300013105 Bacteria 4089
97 Ga0157369_10074222 3300013105 Bacteria 3648
98 Ga0157369_10101909 3300013105 Bacteria 3060
99 Ga0157369_10272286 3300013105 Unclassified 1764
100 Ga0157369_10361342 3300013105 Bacteria 1507
101 Ga0157369_10815294 3300013105 Unclassified 959
102 Ga0157378_10394447 3300013297 Bacteria 1362
103 Ga0157372_10002010 3300013307 Bacteria 22098
104 Ga0157372_10016594 3300013307 Bacteria 7902
105 Ga0157372_10040480 3300013307 Bacteria 5148
106 Ga0157372_10390705 3300013307 Bacteria 1621
107 Ga0157372_10392741 3300013307 Bacteria 1617
108 Ga0157372_10705247 3300013307 Bacteria 1174
109 Ga0206353_10473421 3300020082 Bacteria 2698
110 Ga0206353_11156606 3300020082 Bacteria 1779
111 Ga0207692_10175944 3300025898 Bacteria 1243
112 Ga0207699_10005990 3300025906 Bacteria 5851
113 Ga0207645_10165404 3300025907 Bacteria 1448
114 Ga0207705_10000240 3300025909 Bacteria 54242
115 Ga0207705_10007944 3300025909 Bacteria 7786
116 Ga0207705_10055288 3300025909 Bacteria 2862
117 Ga0207705_10168885 3300025909 Bacteria 1646
118 Ga0207705_10258909 3300025909 Bacteria 1328
119 Ga0207684_10000570 3300025910 Bacteria 44869
120 Ga0207684_10076131 3300025910 Bacteria 2852
121 Ga0207707_10014384 3300025912 Bacteria 6893
122 Ga0207707_10053634 3300025912 Bacteria 3510
123 Ga0207707_10144848 3300025912 Bacteria 2077
124 Ga0207707_10430539 3300025912 Unclassified 1130
125 Ga0207660_10136224 3300025917 Bacteria 1874
126 Ga0207657_10004565 3300025919 Bacteria 14642
127 Ga0207657_10081223 3300025919 Bacteria 2723
128 Ga0207657_10085360 3300025919 Bacteria 2644
129 Ga0207657_10192070 3300025919 Bacteria 1646
130 Ga0207657_10307458 3300025919 Bacteria 1255
131 Ga0207649_10222052 3300025920 Bacteria 1346
132 Ga0207652_10016443 3300025921 Bacteria 6042
133 Ga0207652_10017166 3300025921 Bacteria 5921
134 Ga0207652_10046760 3300025921 Bacteria 3694
135 Ga0207652_10181457 3300025921 Bacteria 1892
136 Ga0207652_10219830 3300025921 Bacteria 1712
137 Ga0207652_10442384 3300025921 Bacteria 1172
138 Ga0207652_10448462 3300025921 Bacteria 1163
139 Ga0207646_10000408 3300025922 Bacteria 57610
140 Ga0207646_10095361 3300025922 Bacteria 2665
141 Ga0207681_10107605 3300025923 Bacteria 2023
142 Ga0207694_10125216 3300025924 Bacteria 2055
143 Ga0207700_10447891 3300025928 Bacteria 1137
144 Ga0207700_10506125 3300025928 Bacteria 1069
145 Ga0207664_10096197 3300025929 Bacteria 2437
146 Ga0207664_10137250 3300025929 Bacteria 2065
147 Ga0207664_10279467 3300025929 Bacteria 1465
148 Ga0207664_10677813 3300025929 Bacteria 927
149 Ga0207690_10000663 3300025932 Bacteria 22031
150 Ga0207706_10001672 3300025933 Bacteria 21909
151 Ga0207706_10073369 3300025933 Bacteria 3009
152 Ga0207686_10141488 3300025934 Unclassified 1664
153 Ga0207686_10449725 3300025934 Bacteria 991
154 Ga0207665_10370504 3300025939 Bacteria 1085
155 Ga0207661_10031846 3300025944 Bacteria 4079
156 Ga0207661_10083107 3300025944 Bacteria 2649
157 Ga0207661_10353257 3300025944 Bacteria 1327
158 Ga0207679_10000959 3300025945 Bacteria 18517
159 Ga0207667_10003354 3300025949 Bacteria 19763
160 Ga0207667_10043495 3300025949 Bacteria 4766
161 Ga0207667_10230893 3300025949 Bacteria 1895
162 Ga0207667_10431579 3300025949 Unclassified 1340
163 Ga0207639_10009310 3300026041 Bacteria 6771
164 Ga0207678_10009891 3300026067 Bacteria 8372
165 Ga0207708_10024310 3300026075 Bacteria 4582
166 Ga0207702_10003515 3300026078 Bacteria 14284
167 Ga0207648_10016339 3300026089 Bacteria 6785
168 Ga0207648_10023091 3300026089 Bacteria 5579
169 Ga0207675_100412859 3300026118 Unclassified 1332
170 Ga0209967_1017508 3300027364 Bacteria 1034
171 Ga0209984_1001169 3300027424 Bacteria 2812
172 Ga0209995_1000516 3300027471 Bacteria 5870
173 Ga0209968_1002255 3300027526 Bacteria 2914
174 Ga0209999_1015951 3300027543 Bacteria 1367
175 Ga0209982_1007251 3300027552 Bacteria 1620
176 Ga0210002_1001793 3300027617 Bacteria 3059
177 Ga0209983_1000050 3300027665 Bacteria 17529
178 Ga0209971_1000011 3300027682 Bacteria 74088
179 Ga0209966_1000380 3300027695 Bacteria 13475
180 Ga0209974_10000045 3300027876 Bacteria 30820
181 Ga0207428_10000075 3300027907 Bacteria 137887
182 Ga0268265_10208906 3300028380 Bacteria 1700
183 Ga0265325_10000034 3300031241 Bacteria 99371
184 Ga0265313_10007713 3300031595 Bacteria 7286
185 Ga0307416_100927362 3300032002 Bacteria 972
186 Ga0373948_0057450 3300034817 Bacteria 848
187 Ga0395898_0047842 3300037466 Bacteria 4195
188 Ga0395898_0317846 3300037466 Bacteria 1485
189 Ga0395901_0142910 3300038443 Bacteria 2515
190 Ga0395901_0261693 3300038443 Bacteria 1800
191 Ga0436365_1285164 3300039437 Bacteria 916
192 Ga0451577_0082728 3300042876 Bacteria 2863
193 Ga0451577_0159641 3300042876 Bacteria 2030
194 Ga0451577_0285799 3300042876 Bacteria 1495
195 Ga0451577_0584601 3300042876 Bacteria 1014
196 Ga0453683_0049482 3300044673 Bacteria 2634
197 Ga0453683_0167657 3300044673 Bacteria 1391
198 Ga0466966_0075117 3300044684 Bacteria 2112
199 Ga0466961_0011050 3300044693 Bacteria 5770
200 Ga0466961_0197411 3300044693 Bacteria 1245
201 Ga0466963_0023745 3300044694 Bacteria 3898
202 Ga0466963_0435519 3300044694 Bacteria 925
203 Ga0453684_0093692 3300044712 Bacteria 3698
204 Ga0466959_0105238 3300045049 Bacteria 2018
205 Ga0466959_0305679 3300045049 Bacteria 1089
206 Ga0451576_0177287 3300045051 Bacteria 2225
207 Ga0466958_0039174 3300045836 Bacteria 2846
208 Ga0466958_0396388 3300045836 Bacteria 891
209 Ga0496102_0566649 3300048905 Bacteria 1058
210 Ga0496103_0116126 3300048906 Bacteria 1702
211 Ga0496106_0011782 3300048909 Bacteria 6454
212 Ga0496112_0211405 3300048915 Bacteria 1897
213 Ga0501032_0269402 3300049569 Bacteria 1103
214 Ga0501033_0069771 3300049570 Bacteria 2583
215 Ga0501033_0302110 3300049570 Bacteria 1126
216 Ga0501034_0003159 3300049571 Bacteria 18942
217 Ga0501034_0005470 3300049571 Bacteria 13871
218 Ga0501034_0255146 3300049571 Bacteria 1697
219 Ga0501034_0665817 3300049571 Bacteria 941
220 Ga0501034_0886909 3300049571 Bacteria 780
221 Ga0501036_0306242 3300049572 Bacteria 1328
222 Ga0501036_0312550 3300049572 Bacteria 1313
223 Ga0501037_0034926 3300049573 Bacteria 3708
224 Ga0501038_0047311 3300049574 Bacteria 3726
225 Ga0501038_0369359 3300049574 Bacteria 1114
226 Ga0501039_0058157 3300049575 Bacteria 2994
227 Ga0501039_0181106 3300049575 Bacteria 1657
228 Ga0501039_0263170 3300049575 Bacteria 1355
229 Ga0501040_0001379 3300049576 Bacteria 15333
230 Ga0501040_0116455 3300049576 Bacteria 1872
231 Ga0501041_0004828 3300049577 Bacteria 7834
232 Ga0501041_0066792 3300049577 Bacteria 2204
233 Ga0501042_0008914 3300049578 Bacteria 6655
234 Ga0501043_0136862 3300049579 Bacteria 1918
235 Ga0501046_0001576 3300049580 Bacteria 21809
236 Ga0501047_0004644 3300049581 Bacteria 12926
237 Ga0501047_0017810 3300049581 Bacteria 6805
238 Ga0501047_0180540 3300049581 Bacteria 1977
239 Ga0501047_0482294 3300049581 Bacteria 1067
240 Ga0501048_0041210 3300049582 Bacteria 3308
241 Ga0501068_0041689 3300049584 Bacteria 2759
242 Ga0501068_0193717 3300049584 Bacteria 1288
243 Ga0501068_0224712 3300049584 Bacteria 1193
244 Ga0501069_0004283 3300049585 Bacteria 7376
245 Ga0501069_0018089 3300049585 Bacteria 3802
246 Ga0501070_0035938 3300049586 Bacteria 4137
247 Ga0501070_0096940 3300049586 Bacteria 2439
248 Ga0501070_0188115 3300049586 Bacteria 1697
249 Ga0501070_0244220 3300049586 Bacteria 1469
250 Ga0501070_0255050 3300049586 Bacteria 1434
251 Ga0501070_0713238 3300049586 Bacteria 792
252 Ga0501071_0029585 3300049587 Bacteria 3867
253 Ga0501071_0038277 3300049587 Bacteria 3427
254 Ga0501071_0234256 3300049587 Bacteria 1384
255 Ga0501072_0006406 3300049588 Bacteria 8970
256 Ga0501073_0000327 3300049589 Bacteria 31946
257 Ga0501073_0044988 3300049589 Bacteria 3111
258 Ga0501074_0001824 3300049590 Bacteria 14583
259 Ga0501074_0003510 3300049590 Bacteria 11128
260 Ga0501074_0107394 3300049590 Bacteria 1998
261 Ga0501074_0138963 3300049590 Bacteria 1738
262 Ga0501075_0010442 3300049591 Bacteria 6525
263 Ga0501075_0124223 3300049591 Bacteria 1965
264 Ga0501075_0183485 3300049591 Bacteria 1596
265 Ga0501075_0386359 3300049591 Bacteria 1067
266 Ga0501076_0002188 3300049592 Bacteria 13381
267 Ga0501076_0122967 3300049592 Bacteria 2102
268 Ga0501076_0192101 3300049592 Bacteria 1666
269 Ga0501077_0005453 3300049593 Bacteria 7742
270 Ga0501077_0368958 3300049593 Bacteria 917
271 Ga0501079_0000914 3300049741 Bacteria 20276
272 Ga0501079_0256420 3300049741 Bacteria 1367
273 Ga0501079_0280077 3300049741 Bacteria 1304
274 Ga0501079_0502004 3300049741 Bacteria 954
275 Ga0501080_0006066 3300049742 Bacteria 10834
276 Ga0501080_0169221 3300049742 Bacteria 2016
277 Ga0501080_0369401 3300049742 Bacteria 1293
278 Ga0501080_0774691 3300049742 Bacteria 842
279 Ga0501080_0802246 3300049742 Bacteria 825
280 Ga0501081_0044915 3300049743 Bacteria 3034
281 Ga0501081_0051085 3300049743 Bacteria 2850
282 Ga0501083_0002026 3300049744 Bacteria 13941
283 Ga0501083_0188655 3300049744 Bacteria 1345
284 Ga0501035_0065139 3300049822 Bacteria 3237
285 Ga0501035_0078356 3300049822 Bacteria 2919
286 Ga0501035_0598594 3300049822 Bacteria 898
287 Ga0501044_0054809 3300049823 Bacteria 4096
288 Ga0501044_0388101 3300049823 Bacteria 1310
289 Ga0501045_0002112 3300049824 Bacteria 13449
290 nmdc:mga0k408_6820_c1 3300050493 Bacteria 2981
291 nmdc:mga05p37_32_c1 3300050507 Bacteria 112982
292 nmdc:mga05p37_489561_c1 3300050507 Bacteria 1414
293 nmdc:mga09592_3106_c1 3300050508 Bacteria 13485
294 nmdc:mga0qj67_1076_c1 3300050509 Bacteria 18902
295 nmdc:mga06r32_1900_c1 3300050510 Bacteria 18601
296 nmdc:mga06r32_235671_c1 3300050510 Bacteria 1818
297 nmdc:mga08y16_13186_c2 3300050511 Bacteria 4290
298 nmdc:mga08y16_711278_c1 3300050511 Bacteria 1003
299 nmdc:mga0n895_1533_c1 3300050512 Bacteria 17365
300 nmdc:mga0rr50_21901_c1 3300050513 Bacteria 4374
301 nmdc:mga08x19_261_c1 3300050514 Bacteria 40081
302 nmdc:mga0a205_3714_c1 3300050515 Bacteria 13666
303 Ga0501084_0006749 3300054114 Bacteria 9436
304 Ga0501084_0244871 3300054114 Bacteria 1513
305 Ga0501084_0251851 3300054114 Bacteria 1491
306 Ga0501084_0589477 3300054114 Bacteria 939
307 Ga0501082_0005093 3300060353 Bacteria 11450
308 Ga0501082_0073406 3300060353 Bacteria 2947
309 Ga0501082_0121293 3300060353 Bacteria 2266
310 Ga0530510_0024408 3300061734 Bacteria 4313
311 Ga0530510_0103629 3300061734 Bacteria 2081
312 Ga0530510_0161514 3300061734 Bacteria 1657

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10000174 Ga0070658_100001743 208
2 3300025909 Ga0207705_10000240 Ga0207705_100002403 208
3 3300025917 Ga0207660_10136224 Ga0207660_101362242 208
4 3300013105 Ga0157369_10272286 Ga0157369_102722862 209
5 3300044694 Ga0466963_0023745 Ga0466963_0023745_1518_2321 225
6 3300005535 Ga0070684_100667665 Ga0070684_1006676652 230
7 3300020082 Ga0206353_10473421 Ga0206353_104734213 230
8 3300005327 Ga0070658_10513292 Ga0070658_105132921 231
9 3300005339 Ga0070660_100392343 Ga0070660_1003923432 231
10 3300005435 Ga0070714_100565055 Ga0070714_1005650551 231
11 3300005937 Ga0081455_10039032 Ga0081455_100390323 231
12 3300009093 Ga0105240_10411177 Ga0105240_104111773 231
13 3300009176 Ga0105242_10093100 Ga0105242_100931002 231
14 3300009545 Ga0105237_10030254 Ga0105237_100302542 231
15 3300013104 Ga0157370_10187116 Ga0157370_101871162 231
16 3300013105 Ga0157369_10101909 Ga0157369_101019092 231
17 3300013297 Ga0157378_10394447 Ga0157378_103944472 231
18 3300013307 Ga0157372_10392741 Ga0157372_103927411 231
19 3300025909 Ga0207705_10258909 Ga0207705_102589092 231
20 3300025919 Ga0207657_10192070 Ga0207657_101920701 231
21 3300025929 Ga0207664_10677813 Ga0207664_106778132 231
22 3300025949 Ga0207667_10230893 Ga0207667_102308932 231
23 3300049741 Ga0501079_0280077 Ga0501079_0280077_505_1206 231
24 3300054114 Ga0501084_0589477 Ga0501084_0589477_31_732 231
25 3300005367 Ga0070667_100106899 Ga0070667_1001068993 232
26 3300013105 Ga0157369_10060371 Ga0157369_100603712 232
27 3300013307 Ga0157372_10705247 Ga0157372_107052472 232
28 3300025939 Ga0207665_10370504 Ga0207665_103705042 232
29 3300025944 Ga0207661_10083107 Ga0207661_100831072 232
30 3300044693 Ga0466961_0197411 Ga0466961_0197411_255_1064 232
31 3300045049 Ga0466959_0305679 Ga0466959_0305679_84_893 232
32 iso_pu_bacteria 2887375801 2887376694 232
33 3300005366 Ga0070659_100149150 Ga0070659_1001491502 233
34 3300005444 Ga0070694_100019254 Ga0070694_1000192542 233
35 3300005445 Ga0070708_100007089 Ga0070708_1000070891 233
36 3300005458 Ga0070681_10017286 Ga0070681_100172862 233
37 3300005458 Ga0070681_10515940 Ga0070681_105159402 233
38 3300005467 Ga0070706_100086991 Ga0070706_1000869912 233
39 3300005468 Ga0070707_100021234 Ga0070707_1000212346 233
40 3300005468 Ga0070707_100041632 Ga0070707_1000416322 233
41 3300005471 Ga0070698_100006586 Ga0070698_1000065869 233
42 3300005518 Ga0070699_100867411 Ga0070699_1008674111 233
43 3300005530 Ga0070679_100048731 Ga0070679_1000487312 233
44 3300005536 Ga0070697_100023704 Ga0070697_1000237045 233
45 3300005545 Ga0070695_100013747 Ga0070695_1000137473 233
46 3300005577 Ga0068857_100252217 Ga0068857_1002522172 233
47 3300005937 Ga0081455_10005497 Ga0081455_100054973 233
48 3300006847 Ga0075431_100061949 Ga0075431_1000619492 233
49 3300006914 Ga0075436_100000428 Ga0075436_10000042811 233
50 3300009094 Ga0111539_10444803 Ga0111539_104448032 233
51 3300011119 Ga0105246_10787802 Ga0105246_107878022 233
52 3300013102 Ga0157371_10158450 Ga0157371_101584502 233
53 3300013105 Ga0157369_10000279 Ga0157369_1000027963 233
54 3300013105 Ga0157369_10001689 Ga0157369_1000168919 233
55 3300013307 Ga0157372_10390705 Ga0157372_103907052 233
56 3300020082 Ga0206353_11156606 Ga0206353_111566061 233
57 3300025909 Ga0207705_10007944 Ga0207705_100079442 233
58 3300025909 Ga0207705_10168885 Ga0207705_101688852 233
59 3300025910 Ga0207684_10000570 Ga0207684_100005708 233
60 3300025912 Ga0207707_10014384 Ga0207707_100143842 233
61 3300025912 Ga0207707_10053634 Ga0207707_100536342 233
62 3300025912 Ga0207707_10430539 Ga0207707_104305392 233
63 3300025921 Ga0207652_10016443 Ga0207652_100164436 233
64 3300025921 Ga0207652_10017166 Ga0207652_100171664 233
65 3300025922 Ga0207646_10000408 Ga0207646_1000040850 233
66 3300025922 Ga0207646_10095361 Ga0207646_100953611 233
67 3300025923 Ga0207681_10107605 Ga0207681_101076052 233
68 3300025929 Ga0207664_10137250 Ga0207664_101372502 233
69 3300025933 Ga0207706_10073369 Ga0207706_100733692 233
70 3300025944 Ga0207661_10353257 Ga0207661_103532572 233
71 3300025949 Ga0207667_10431579 Ga0207667_104315792 233
72 3300027364 Ga0209967_1017508 Ga0209967_10175081 233
73 3300027424 Ga0209984_1001169 Ga0209984_10011693 233
74 3300027471 Ga0209995_1000516 Ga0209995_10005166 233
75 3300027526 Ga0209968_1002255 Ga0209968_10022552 233
76 3300027543 Ga0209999_1015951 Ga0209999_10159512 233
77 3300027552 Ga0209982_1007251 Ga0209982_10072512 233
78 3300027617 Ga0210002_1001793 Ga0210002_10017932 233
79 3300027665 Ga0209983_1000050 Ga0209983_100005016 233
80 3300027682 Ga0209971_1000011 Ga0209971_100001110 233
81 3300027695 Ga0209966_1000380 Ga0209966_10003809 233
82 3300027876 Ga0209974_10000045 Ga0209974_1000004529 233
83 3300028380 Ga0268265_10208906 Ga0268265_102089062 233
84 3300034817 Ga0373948_0057450 Ga0373948_0057450_41_745 233
85 3300037466 Ga0395898_0047842 Ga0395898_0047842_2945_3727 233
86 3300038443 Ga0395901_0261693 Ga0395901_0261693_656_1438 233
87 3300042876 Ga0451577_0082728 Ga0451577_0082728_1869_2573 233
88 3300042876 Ga0451577_0584601 Ga0451577_0584601_169_873 233
89 3300044673 Ga0453683_0049482 Ga0453683_0049482_419_1123 233
90 3300044684 Ga0466966_0075117 Ga0466966_0075117_145_963 233
91 3300044694 Ga0466963_0435519 Ga0466963_0435519_54_866 233
92 3300044712 Ga0453684_0093692 Ga0453684_0093692_1496_2200 233
93 3300045049 Ga0466959_0105238 Ga0466959_0105238_341_1135 233
94 3300045051 Ga0451576_0177287 Ga0451576_0177287_312_1016 233
95 3300045836 Ga0466958_0039174 Ga0466958_0039174_1288_2106 233
96 3300049570 Ga0501033_0069771 Ga0501033_0069771_382_1086 233
97 3300049574 Ga0501038_0369359 Ga0501038_0369359_326_1030 233
98 3300049575 Ga0501039_0058157 Ga0501039_0058157_2119_2823 233
99 3300049576 Ga0501040_0001379 Ga0501040_0001379_6585_7289 233
100 3300049577 Ga0501041_0004828 Ga0501041_0004828_3453_4157 233
101 3300049578 Ga0501042_0008914 Ga0501042_0008914_192_896 233
102 3300049580 Ga0501046_0001576 Ga0501046_0001576_18699_19403 233
103 3300049581 Ga0501047_0017810 Ga0501047_0017810_4423_5127 233
104 3300049582 Ga0501048_0041210 Ga0501048_0041210_206_910 233
105 3300049584 Ga0501068_0041689 Ga0501068_0041689_245_949 233
106 3300049584 Ga0501068_0193717 Ga0501068_0193717_309_1013 233
107 3300049587 Ga0501071_0038277 Ga0501071_0038277_551_1255 233
108 3300049587 Ga0501071_0234256 Ga0501071_0234256_524_1228 233
109 3300049589 Ga0501073_0044988 Ga0501073_0044988_1719_2423 233
110 3300049590 Ga0501074_0001824 Ga0501074_0001824_8543_9247 233
111 3300049590 Ga0501074_0138963 Ga0501074_0138963_185_889 233
112 3300049591 Ga0501075_0010442 Ga0501075_0010442_413_1117 233
113 3300049591 Ga0501075_0124223 Ga0501075_0124223_717_1421 233
114 3300049591 Ga0501075_0183485 Ga0501075_0183485_456_1160 233
115 3300049591 Ga0501075_0386359 Ga0501075_0386359_74_778 233
116 3300049592 Ga0501076_0002188 Ga0501076_0002188_8537_9241 233
117 3300049592 Ga0501076_0122967 Ga0501076_0122967_1169_1873 233
118 3300049592 Ga0501076_0192101 Ga0501076_0192101_479_1183 233
119 3300049593 Ga0501077_0005453 Ga0501077_0005453_5375_6079 233
120 3300049593 Ga0501077_0368958 Ga0501077_0368958_117_821 233
121 3300049741 Ga0501079_0000914 Ga0501079_0000914_14557_15261 233
122 3300049741 Ga0501079_0256420 Ga0501079_0256420_471_1175 233
123 3300049741 Ga0501079_0502004 Ga0501079_0502004_141_845 233
124 3300049742 Ga0501080_0169221 Ga0501080_0169221_237_941 233
125 3300049743 Ga0501081_0044915 Ga0501081_0044915_880_1584 233
126 3300049743 Ga0501081_0051085 Ga0501081_0051085_83_787 233
127 3300049744 Ga0501083_0002026 Ga0501083_0002026_4808_5512 233
128 3300049822 Ga0501035_0065139 Ga0501035_0065139_1164_1868 233
129 3300049824 Ga0501045_0002112 Ga0501045_0002112_6577_7281 233
130 3300050507 nmdc:mga05p37_489561_c1 nmdc:mga05p37_489561_c1_291_995 233
131 3300050510 nmdc:mga06r32_235671_c1 nmdc:mga06r32_235671_c1_719_1423 233
132 3300050511 nmdc:mga08y16_711278_c1 nmdc:mga08y16_711278_c1_246_950 233
133 3300050514 nmdc:mga08x19_261_c1 nmdc:mga08x19_261_c1_11380_12087 233
134 3300054114 Ga0501084_0006749 Ga0501084_0006749_1449_2153 233
135 3300054114 Ga0501084_0244871 Ga0501084_0244871_438_1142 233
136 3300054114 Ga0501084_0251851 Ga0501084_0251851_411_1115 233
137 3300060353 Ga0501082_0005093 Ga0501082_0005093_8468_9172 233
138 3300060353 Ga0501082_0073406 Ga0501082_0073406_1813_2517 233
139 3300061734 Ga0530510_0024408 Ga0530510_0024408_2733_3437 233
140 3300061734 Ga0530510_0103629 Ga0530510_0103629_1165_1869 233
141 3300061734 Ga0530510_0161514 Ga0530510_0161514_234_938 233
142 3300005329 Ga0070683_100117417 Ga0070683_1001174172 234
143 3300005445 Ga0070708_100136696 Ga0070708_1001366962 234
144 3300005467 Ga0070706_100092110 Ga0070706_1000921103 234
145 3300013105 Ga0157369_10074222 Ga0157369_100742223 234
146 3300025910 Ga0207684_10076131 Ga0207684_100761313 234
147 3300025929 Ga0207664_10279467 Ga0207664_102794671 234
148 3300025944 Ga0207661_10031846 Ga0207661_100318463 234
149 3300044693 Ga0466961_0011050 Ga0466961_0011050_4379_5203 234
150 3300005347 Ga0070668_100299785 Ga0070668_1002997852 235
151 3300005459 Ga0068867_100139038 Ga0068867_1001390383 235
152 3300005842 Ga0068858_100013832 Ga0068858_1000138329 235
153 3300025934 Ga0207686_10141488 Ga0207686_101414882 235
154 3300026089 Ga0207648_10023091 Ga0207648_100230915 235
155 3300026118 Ga0207675_100412859 Ga0207675_1004128592 235
156 3300032002 Ga0307416_100927362 Ga0307416_1009273621 235
157 3300049575 Ga0501039_0181106 Ga0501039_0181106_727_1434 235
158 3300049576 Ga0501040_0116455 Ga0501040_0116455_992_1699 235
159 3300049577 Ga0501041_0066792 Ga0501041_0066792_590_1297 235
160 3300003911 JGI25405J52794_10009843 JGI25405J52794_100098432 236
161 3300005327 Ga0070658_10134989 Ga0070658_101349892 236
162 3300005328 Ga0070676_10305282 Ga0070676_103052822 236
163 3300005339 Ga0070660_100001756 Ga0070660_1000017569 236
164 3300005339 Ga0070660_100297151 Ga0070660_1002971512 236
165 3300005339 Ga0070660_100363486 Ga0070660_1003634861 236
166 3300005340 Ga0070689_100308892 Ga0070689_1003088921 236
167 3300005344 Ga0070661_100009713 Ga0070661_1000097133 236
168 3300005366 Ga0070659_100000860 Ga0070659_10000086018 236
169 3300005366 Ga0070659_100054762 Ga0070659_1000547621 236
170 3300005366 Ga0070659_100237910 Ga0070659_1002379102 236
171 3300005434 Ga0070709_10002505 Ga0070709_100025052 236
172 3300005435 Ga0070714_100014028 Ga0070714_1000140281 236
173 3300005435 Ga0070714_100821472 Ga0070714_1008214721 236
174 3300005436 Ga0070713_100003704 Ga0070713_10000370411 236
175 3300005437 Ga0070710_10142504 Ga0070710_101425042 236
176 3300005439 Ga0070711_100024373 Ga0070711_1000243732 236
177 3300005455 Ga0070663_100037215 Ga0070663_1000372153 236
178 3300005457 Ga0070662_100000609 Ga0070662_10000060917 236
179 3300005518 Ga0070699_100027034 Ga0070699_1000270342 236
180 3300005530 Ga0070679_100028535 Ga0070679_1000285352 236
181 3300005530 Ga0070679_100043561 Ga0070679_1000435614 236
182 3300005530 Ga0070679_100089138 Ga0070679_1000891383 236
183 3300005539 Ga0068853_100007581 Ga0068853_1000075818 236
184 3300005546 Ga0070696_100003209 Ga0070696_1000032098 236
185 3300005563 Ga0068855_100000661 Ga0068855_10000066135 236
186 3300005563 Ga0068855_100269804 Ga0068855_1002698043 236
187 3300005564 Ga0070664_100002475 Ga0070664_10000247511 236
188 3300005614 Ga0068856_100001862 Ga0068856_1000018628 236
189 3300005617 Ga0068859_100514546 Ga0068859_1005145462 236
190 3300005937 Ga0081455_10001419 Ga0081455_100014196 236
191 3300006058 Ga0075432_10010554 Ga0075432_100105543 236
192 3300006194 Ga0075427_10000669 Ga0075427_100006693 236
193 3300006195 Ga0075366_10015884 Ga0075366_100158845 236
194 3300006844 Ga0075428_100056705 Ga0075428_1000567052 236
195 3300006846 Ga0075430_100000070 Ga0075430_1000000707 236
196 3300006847 Ga0075431_100019547 Ga0075431_1000195477 236
197 3300006852 Ga0075433_10004877 Ga0075433_100048776 236
198 3300006871 Ga0075434_100039312 Ga0075434_1000393122 236
199 3300006880 Ga0075429_100036239 Ga0075429_1000362392 236
200 3300006881 Ga0068865_100246384 Ga0068865_1002463842 236
201 3300006931 Ga0097620_100514468 Ga0097620_1005144682 236
202 3300007076 Ga0075435_100106281 Ga0075435_1001062812 236
203 3300009094 Ga0111539_10003613 Ga0111539_100036132 236
204 3300009147 Ga0114129_10005426 Ga0114129_100054262 236
205 3300009176 Ga0105242_10209309 Ga0105242_102093092 236
206 3300009176 Ga0105242_10642708 Ga0105242_106427082 236
207 3300009553 Ga0105249_10884011 Ga0105249_108840111 236
208 3300013100 Ga0157373_10003405 Ga0157373_1000340512 236
209 3300013100 Ga0157373_10046911 Ga0157373_100469113 236
210 3300013100 Ga0157373_10126964 Ga0157373_101269642 236
211 3300013102 Ga0157371_10001755 Ga0157371_100017557 236
212 3300013104 Ga0157370_10013710 Ga0157370_100137104 236
213 3300013104 Ga0157370_10018157 Ga0157370_100181578 236
214 3300013104 Ga0157370_10038268 Ga0157370_100382686 236
215 3300013104 Ga0157370_10294878 Ga0157370_102948782 236
216 3300013105 Ga0157369_10361342 Ga0157369_103613422 236
217 3300013105 Ga0157369_10815294 Ga0157369_108152942 236
218 3300013307 Ga0157372_10002010 Ga0157372_1000201017 236
219 3300013307 Ga0157372_10016594 Ga0157372_100165946 236
220 3300013307 Ga0157372_10040480 Ga0157372_100404804 236
221 3300025898 Ga0207692_10175944 Ga0207692_101759442 236
222 3300025906 Ga0207699_10005990 Ga0207699_100059906 236
223 3300025907 Ga0207645_10165404 Ga0207645_101654042 236
224 3300025909 Ga0207705_10055288 Ga0207705_100552882 236
225 3300025912 Ga0207707_10144848 Ga0207707_101448482 236
226 3300025919 Ga0207657_10004565 Ga0207657_100045658 236
227 3300025919 Ga0207657_10081223 Ga0207657_100812232 236
228 3300025919 Ga0207657_10085360 Ga0207657_100853602 236
229 3300025919 Ga0207657_10307458 Ga0207657_103074582 236
230 3300025920 Ga0207649_10222052 Ga0207649_102220521 236
231 3300025921 Ga0207652_10046760 Ga0207652_100467603 236
232 3300025921 Ga0207652_10181457 Ga0207652_101814572 236
233 3300025921 Ga0207652_10219830 Ga0207652_102198303 236
234 3300025921 Ga0207652_10442384 Ga0207652_104423842 236
235 3300025921 Ga0207652_10448462 Ga0207652_104484622 236
236 3300025924 Ga0207694_10125216 Ga0207694_101252162 236
237 3300025928 Ga0207700_10447891 Ga0207700_104478912 236
238 3300025928 Ga0207700_10506125 Ga0207700_105061251 236
239 3300025929 Ga0207664_10096197 Ga0207664_100961973 236
240 3300025932 Ga0207690_10000663 Ga0207690_100006638 236
241 3300025933 Ga0207706_10001672 Ga0207706_100016728 236
242 3300025934 Ga0207686_10449725 Ga0207686_104497252 236
243 3300025945 Ga0207679_10000959 Ga0207679_1000095915 236
244 3300025949 Ga0207667_10003354 Ga0207667_100033545 236
245 3300025949 Ga0207667_10043495 Ga0207667_100434955 236
246 3300026041 Ga0207639_10009310 Ga0207639_100093103 236
247 3300026067 Ga0207678_10009891 Ga0207678_100098913 236
248 3300026075 Ga0207708_10024310 Ga0207708_100243104 236
249 3300026078 Ga0207702_10003515 Ga0207702_1000351512 236
250 3300026089 Ga0207648_10016339 Ga0207648_100163394 236
251 3300027907 Ga0207428_10000075 Ga0207428_1000007538 236
252 3300031241 Ga0265325_10000034 Ga0265325_1000003416 236
253 3300031595 Ga0265313_10007713 Ga0265313_100077135 236
254 3300037466 Ga0395898_0317846 Ga0395898_0317846_534_1244 236
255 3300038443 Ga0395901_0142910 Ga0395901_0142910_1213_1923 236
256 3300039437 Ga0436365_1285164 Ga0436365_1285164_66_779 236
257 3300042876 Ga0451577_0159641 Ga0451577_0159641_573_1295 236
258 3300042876 Ga0451577_0285799 Ga0451577_0285799_621_1331 236
259 3300044673 Ga0453683_0167657 Ga0453683_0167657_648_1367 236
260 3300045836 Ga0466958_0396388 Ga0466958_0396388_35_751 236
261 3300048905 Ga0496102_0566649 Ga0496102_0566649_228_947 236
262 3300048906 Ga0496103_0116126 Ga0496103_0116126_367_1086 236
263 3300048909 Ga0496106_0011782 Ga0496106_0011782_3347_4066 236
264 3300048915 Ga0496112_0211405 Ga0496112_0211405_276_992 236
265 3300049569 Ga0501032_0269402 Ga0501032_0269402_314_1024 236
266 3300049570 Ga0501033_0302110 Ga0501033_0302110_245_955 236
267 3300049571 Ga0501034_0003159 Ga0501034_0003159_8888_9613 236
268 3300049571 Ga0501034_0005470 Ga0501034_0005470_7323_8048 236
269 3300049571 Ga0501034_0255146 Ga0501034_0255146_314_1024 236
270 3300049571 Ga0501034_0665817 Ga0501034_0665817_172_882 236
271 3300049571 Ga0501034_0886909 Ga0501034_0886909_60_770 236
272 3300049572 Ga0501036_0306242 Ga0501036_0306242_79_789 236
273 3300049572 Ga0501036_0312550 Ga0501036_0312550_540_1250 236
274 3300049573 Ga0501037_0034926 Ga0501037_0034926_1804_2514 236
275 3300049574 Ga0501038_0047311 Ga0501038_0047311_1804_2514 236
276 3300049575 Ga0501039_0263170 Ga0501039_0263170_106_816 236
277 3300049579 Ga0501043_0136862 Ga0501043_0136862_44_754 236
278 3300049581 Ga0501047_0004644 Ga0501047_0004644_3230_3949 236
279 3300049581 Ga0501047_0180540 Ga0501047_0180540_418_1137 236
280 3300049581 Ga0501047_0482294 Ga0501047_0482294_44_754 236
281 3300049584 Ga0501068_0224712 Ga0501068_0224712_172_882 236
282 3300049585 Ga0501069_0004283 Ga0501069_0004283_5681_6400 236
283 3300049585 Ga0501069_0018089 Ga0501069_0018089_2290_3003 236
284 3300049586 Ga0501070_0035938 Ga0501070_0035938_3113_3832 236
285 3300049586 Ga0501070_0096940 Ga0501070_0096940_1416_2126 236
286 3300049586 Ga0501070_0188115 Ga0501070_0188115_674_1384 236
287 3300049586 Ga0501070_0244220 Ga0501070_0244220_25_738 236
288 3300049586 Ga0501070_0255050 Ga0501070_0255050_629_1342 236
289 3300049586 Ga0501070_0713238 Ga0501070_0713238_60_770 236
290 3300049587 Ga0501071_0029585 Ga0501071_0029585_77_787 236
291 3300049588 Ga0501072_0006406 Ga0501072_0006406_610_1335 236
292 3300049589 Ga0501073_0000327 Ga0501073_0000327_21138_21857 236
293 3300049590 Ga0501074_0003510 Ga0501074_0003510_1444_2163 236
294 3300049590 Ga0501074_0107394 Ga0501074_0107394_897_1610 236
295 3300049742 Ga0501080_0006066 Ga0501080_0006066_7237_7956 236
296 3300049742 Ga0501080_0369401 Ga0501080_0369401_44_754 236
297 3300049742 Ga0501080_0774691 Ga0501080_0774691_16_735 236
298 3300049742 Ga0501080_0802246 Ga0501080_0802246_56_766 236
299 3300049744 Ga0501083_0188655 Ga0501083_0188655_540_1250 236
300 3300049822 Ga0501035_0078356 Ga0501035_0078356_78_788 236
301 3300049822 Ga0501035_0598594 Ga0501035_0598594_150_860 236
302 3300049823 Ga0501044_0054809 Ga0501044_0054809_673_1383 236
303 3300049823 Ga0501044_0388101 Ga0501044_0388101_429_1139 236
304 3300050493 nmdc:mga0k408_6820_c1 nmdc:mga0k408_6820_c1_191_901 236
305 3300050507 nmdc:mga05p37_32_c1 nmdc:mga05p37_32_c1_83733_84446 236
306 3300050508 nmdc:mga09592_3106_c1 nmdc:mga09592_3106_c1_4826_5539 236
307 3300050509 nmdc:mga0qj67_1076_c1 nmdc:mga0qj67_1076_c1_2813_3526 236
308 3300050510 nmdc:mga06r32_1900_c1 nmdc:mga06r32_1900_c1_6450_7163 236
309 3300050511 nmdc:mga08y16_13186_c2 nmdc:mga08y16_13186_c2_702_1415 236
310 3300050512 nmdc:mga0n895_1533_c1 nmdc:mga0n895_1533_c1_14578_15291 236
311 3300050513 nmdc:mga0rr50_21901_c1 nmdc:mga0rr50_21901_c1_2887_3600 236
312 3300050515 nmdc:mga0a205_3714_c1 nmdc:mga0a205_3714_c1_2941_3654 236
313 3300060353 Ga0501082_0121293 Ga0501082_0121293_355_1074 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

185

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9557 1 236
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9518 1 236
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9444 4 224
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9369 4 224
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.9286 4 224
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9718 1 236 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9677 1 236 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 5 236 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.95 5 236 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9441 2 68 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382XKN7-F1-model_v4 ABC transporter domain-containing protein 0.9791 7 217 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A351AAV7-F1-model_v4 ABC transporter ATP-binding protein 0.9786 10 196 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A536ECH0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9785 5 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A381SD12-F1-model_v4 ABC transporter domain-containing protein 0.9766 27 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A399EYD5-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivF 0.9748 5 236 GO:0005524
GO:0015658
GO:0015807
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map