F401918

General Info

Members Datasets Scaffolds Average Seq Length
312 188 624 149

Family's Representative Sequence

Representative Sequence 3300053099|Ga0500654_070346|Ga0500654_070346_1004_1450
Length 133
Sequence MKIILTQEVSGLGTPGDIVEVKDGFGRNYLLPQGFAINWTKGGEKQVSSIKRARSQLEGLKVSLQARAGTGGRLFGSVTPSEVQQAVKSAGGPDLDRRRIELPGHIKAVGQYQVQVRLHADVTARFALTVVAS

Samples

Sample ID Description Type Environment
1 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2506783011 Frankia datiscae Dg1 Isolate Nodule
174 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
175 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
176 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
177 2517572101 Frankia sp. DC12 Isolate Nodule
178 2687453737 Frankia sp. BMG5.36 Isolate Nodule
179 2773857933 Frankia sp. BMG5.30 Isolate Nodule
180 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
181 2855683550 Micromonospora sp. RP3T Isolate Unclassified
182 2858868258 Micromonospora sp. MH33 Isolate Unclassified
183 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
184 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
185 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
186 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
187 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
188 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.46
Metatranscriptomes 6.41
Isolates 5.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 1.28
Rhizoplane 6.73
Rhizosphere 86.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500654_070346 3300053099 Bacteria 1711
2 Ga0058859_11789127 3300004798 Bacteria 668
3 Ga0070683_100000671 3300005329 Bacteria 24760
4 Ga0070683_100279683 3300005329 Bacteria 1587
5 Ga0070683_101119294 3300005329 Bacteria 756
6 Ga0070680_100486948 3300005336 Bacteria 1055
7 Ga0070682_100075744 3300005337 Bacteria 2165
8 Ga0070660_100379001 3300005339 Bacteria 1167
9 Ga0070660_100787078 3300005339 Bacteria 799
10 Ga0070691_10431461 3300005341 Bacteria 749
11 Ga0070671_100962770 3300005355 Bacteria 747
12 Ga0070673_101338849 3300005364 Bacteria 673
13 Ga0070709_10049772 3300005434 Bacteria 2622
14 Ga0070714_100990677 3300005435 Bacteria 818
15 Ga0070713_100571866 3300005436 Bacteria 1072
16 Ga0070681_10366937 3300005458 Bacteria 1350
17 Ga0070681_10384676 3300005458 Bacteria 1314
18 Ga0070681_10577949 3300005458 Bacteria 1037
19 Ga0070707_101641229 3300005468 Bacteria 610
20 Ga0070679_100279453 3300005530 Bacteria 1622
21 Ga0070684_100009197 3300005535 Bacteria 7773
22 Ga0070684_100111733 3300005535 Bacteria 2451
23 Ga0070695_100153989 3300005545 Bacteria 1607
24 Ga0070693_100532037 3300005547 Bacteria 839
25 Ga0070704_101229253 3300005549 Bacteria 684
26 Ga0068855_100040391 3300005563 Bacteria 5538
27 Ga0070664_100011115 3300005564 Bacteria 7299
28 Ga0070664_100032470 3300005564 Bacteria 4367
29 Ga0070664_100108631 3300005564 Bacteria 2419
30 Ga0070664_100251430 3300005564 Bacteria 1589
31 Ga0070664_100503517 3300005564 Bacteria 1116
32 Ga0068857_100037937 3300005577 Bacteria 4269
33 Ga0068857_100287046 3300005577 Bacteria 1514
34 Ga0068856_100105307 3300005614 Bacteria 2815
35 Ga0068864_100578990 3300005618 Bacteria 1087
36 Ga0068860_100488486 3300005843 Bacteria 1228
37 Ga0068860_101005789 3300005843 Bacteria 852
38 Ga0068862_100000328 3300005844 Bacteria 51688
39 Ga0068862_101550558 3300005844 Bacteria 669
40 Ga0081540_1004469 3300005983 Bacteria 10649
41 Ga0081539_10214556 3300005985 Bacteria 880
42 Ga0070712_100102741 3300006175 Bacteria 2118
43 Ga0097621_100417567 3300006237 Bacteria 1204
44 Ga0075428_100000567 3300006844 Bacteria 37710
45 Ga0075428_100022731 3300006844 Bacteria 6939
46 Ga0075428_100213375 3300006844 Bacteria 2085
47 Ga0075428_100307665 3300006844 Bacteria 1703
48 Ga0075428_100455862 3300006844 Bacteria 1369
49 Ga0075428_100658151 3300006844 Bacteria 1117
50 Ga0075430_100000705 3300006846 Bacteria 25484
51 Ga0075430_100063344 3300006846 Bacteria 3106
52 Ga0075430_100190738 3300006846 Bacteria 1703
53 Ga0075430_101042602 3300006846 Bacteria 674
54 Ga0075431_100011277 3300006847 Bacteria 9004
55 Ga0075431_100191399 3300006847 Bacteria 2096
56 Ga0075431_100348166 3300006847 Bacteria 1490
57 Ga0075431_100437261 3300006847 Bacteria 1305
58 Ga0075434_100912998 3300006871 Bacteria 893
59 Ga0075429_100003101 3300006880 Bacteria 14112
60 Ga0075429_100031838 3300006880 Bacteria 4584
61 Ga0075429_100100630 3300006880 Bacteria 2523
62 Ga0075429_100109137 3300006880 Bacteria 2419
63 Ga0097620_100000753 3300006931 Bacteria 32635
64 Ga0114129_10000749 3300009147 Bacteria 41270
65 Ga0114129_10031771 3300009147 Bacteria 7463
66 Ga0114129_10303113 3300009147 Bacteria 2128
67 Ga0114129_10667181 3300009147 Bacteria 1340
68 Ga0114129_10950509 3300009147 Bacteria 1085
69 Ga0105248_10000360 3300009177 Bacteria 53156
70 Ga0105248_10147447 3300009177 Bacteria 2655
71 Ga0105248_10280752 3300009177 Bacteria 1875
72 Ga0105238_10439485 3300009551 Bacteria 1301
73 Ga0105249_10097898 3300009553 Bacteria 2754
74 Ga0105249_13204747 3300009553 Bacteria 526
75 Ga0105239_10067402 3300010375 Bacteria 3932
76 Ga0157369_10028539 3300013105 Bacteria 6176
77 Ga0157369_10215420 3300013105 Bacteria 2011
78 Ga0157369_11234680 3300013105 Bacteria 762
79 Ga0157369_11356850 3300013105 Bacteria 724
80 Ga0157369_11432605 3300013105 Bacteria 703
81 Ga0163162_10652608 3300013306 Bacteria 1176
82 Ga0157372_10720071 3300013307 Bacteria 1161
83 Ga0157375_10025376 3300013308 Bacteria 5506
84 Ga0157375_11074013 3300013308 Bacteria 942
85 Ga0157375_11466668 3300013308 Bacteria 805
86 Ga0163163_10047532 3300014325 Bacteria 4219
87 Ga0163163_10058202 3300014325 Bacteria 3821
88 Ga0163163_10251941 3300014325 Bacteria 1816
89 Ga0163163_11199844 3300014325 Bacteria 821
90 Ga0157380_11048041 3300014326 Bacteria 852
91 Ga0157377_10357259 3300014745 Bacteria 982
92 Ga0157379_10165301 3300014968 Bacteria 1997
93 Ga0157379_10697719 3300014968 Bacteria 952
94 Ga0157376_10319640 3300014969 Bacteria 1475
95 Ga0157376_12279226 3300014969 Bacteria 581
96 Ga0197907_10196520 3300020069 Bacteria 1899
97 Ga0197907_10821178 3300020069 Bacteria 2521
98 Ga0206356_10483938 3300020070 Bacteria 605
99 Ga0206356_11301659 3300020070 Bacteria 1200
100 Ga0206356_11504836 3300020070 Bacteria 1277
101 Ga0206352_10253406 3300020078 Bacteria 1653
102 Ga0206352_10650796 3300020078 Bacteria 2778
103 Ga0206354_10058898 3300020081 Bacteria 3351
104 Ga0206354_10256116 3300020081 Bacteria 536
105 Ga0206353_10231304 3300020082 Bacteria 1534
106 Ga0206353_11241645 3300020082 Bacteria 1625
107 Ga0207685_10219533 3300025905 Bacteria 903
108 Ga0207699_10145223 3300025906 Bacteria 1563
109 Ga0207705_10032617 3300025909 Bacteria 3723
110 Ga0207705_10185080 3300025909 Bacteria 1573
111 Ga0207707_10073410 3300025912 Bacteria 2983
112 Ga0207693_10114953 3300025915 Bacteria 2112
113 Ga0207660_10097444 3300025917 Bacteria 2191
114 Ga0207657_10190023 3300025919 Bacteria 1657
115 Ga0207657_10343660 3300025919 Bacteria 1177
116 Ga0207649_10021271 3300025920 Bacteria 3732
117 Ga0207649_10828446 3300025920 Bacteria 723
118 Ga0207652_10059277 3300025921 Bacteria 3299
119 Ga0207664_10085985 3300025929 Bacteria 2568
120 Ga0207665_10929799 3300025939 Bacteria 690
121 Ga0207711_10000030 3300025941 Bacteria 206250
122 Ga0207711_10023082 3300025941 Bacteria 5209
123 Ga0207689_10133757 3300025942 Bacteria 2041
124 Ga0207661_10014920 3300025944 Bacteria 5703
125 Ga0207661_10024802 3300025944 Bacteria 4550
126 Ga0207661_10152123 3300025944 Bacteria 2001
127 Ga0207661_11126514 3300025944 Bacteria 722
128 Ga0207679_10024087 3300025945 Bacteria 4170
129 Ga0207679_10451706 3300025945 Bacteria 1140
130 Ga0207679_11046399 3300025945 Bacteria 748
131 Ga0207667_10205061 3300025949 Bacteria 2022
132 Ga0207667_11451871 3300025949 Bacteria 658
133 Ga0207651_11432995 3300025960 Bacteria 622
134 Ga0207712_10011310 3300025961 Bacteria 5682
135 Ga0207712_10981658 3300025961 Bacteria 749
136 Ga0207658_10331819 3300025986 Bacteria 1319
137 Ga0207703_10163661 3300026035 Bacteria 1950
138 Ga0207708_10135625 3300026075 Bacteria 1928
139 Ga0207708_10922950 3300026075 Bacteria 756
140 Ga0207702_10153313 3300026078 Bacteria 2098
141 Ga0207702_11292566 3300026078 Bacteria 724
142 Ga0207641_10030324 3300026088 Bacteria 4480
143 Ga0207641_11086431 3300026088 Bacteria 798
144 Ga0207641_11233282 3300026088 Bacteria 748
145 Ga0207676_10054723 3300026095 Bacteria 3128
146 Ga0207676_11123529 3300026095 Bacteria 777
147 Ga0207674_10026834 3300026116 Bacteria 6109
148 Ga0207674_10127742 3300026116 Bacteria 2507
149 Ga0207674_10474476 3300026116 Bacteria 1209
150 Ga0207674_10514049 3300026116 Bacteria 1157
151 Ga0207674_11439258 3300026116 Bacteria 658
152 Ga0207683_11883710 3300026121 Bacteria 547
153 Ga0268265_10000124 3300028380 Bacteria 96763
154 Ga0268265_11033138 3300028380 Bacteria 813
155 Ga0307515_10013680 3300028794 Bacteria 15122
156 Ga0265328_10020917 3300031239 Bacteria 2501
157 Ga0265327_10073441 3300031251 Bacteria 1706
158 Ga0307509_10512760 3300031507 Bacteria 882
159 Ga0307408_100050928 3300031548 Bacteria 2980
160 Ga0307405_10001693 3300031731 Bacteria 9401
161 Ga0307405_11636371 3300031731 Bacteria 569
162 Ga0307413_10066374 3300031824 Bacteria 2251
163 Ga0307410_10013407 3300031852 Bacteria 4782
164 Ga0307410_10964945 3300031852 Bacteria 733
165 Ga0326468_10008167 3300031889 Bacteria 1008
166 Ga0307406_10003851 3300031901 Bacteria 8165
167 Ga0307406_10301131 3300031901 Bacteria 1232
168 Ga0307407_10125963 3300031903 Bacteria 1631
169 Ga0307407_11635901 3300031903 Bacteria 512
170 Ga0307412_10026844 3300031911 Bacteria 3585
171 Ga0307409_100001290 3300031995 Bacteria 12143
172 Ga0307416_100001483 3300032002 Bacteria 12769
173 Ga0307416_100482539 3300032002 Bacteria 1300
174 Ga0307415_100000009 3300032126 Bacteria 90122
175 Ga0307415_100056747 3300032126 Bacteria 2687
176 Ga0307415_100098413 3300032126 Bacteria 2138
177 Ga0307415_100186866 3300032126 Bacteria 1631
178 Ga0373934_0328685 3300035086 Bacteria 635
179 Ga0373954_0049273 3300035118 Bacteria 1975
180 Ga0373927_0531450 3300035695 Bacteria 777
181 Ga0373937_0071164 3300036401 Bacteria 3208
182 Ga0395900_0081583 3300037418 Bacteria 3323
183 Ga0395898_0018250 3300037466 Bacteria 7156
184 Ga0395905_0150601 3300037471 Bacteria 2189
185 Ga0395901_0078838 3300038443 Bacteria 3439
186 Ga0466972_0326711 3300044658 Bacteria 717
187 Ga0466961_0001655 3300044693 Bacteria 13850
188 Ga0466961_0152282 3300044693 Bacteria 1443
189 Ga0466961_0252092 3300044693 Bacteria 1084
190 Ga0466963_0031849 3300044694 Bacteria 3410
191 Ga0466963_0250324 3300044694 Bacteria 1243
192 Ga0466963_1187469 3300044694 Bacteria 536
193 Ga0466957_0066155 3300044842 Bacteria 2227
194 Ga0466960_0773322 3300044901 Bacteria 580
195 Ga0466959_0034645 3300045049 Bacteria 3735
196 Ga0466958_0014721 3300045836 Bacteria 4467
197 Ga0466958_0058072 3300045836 Bacteria 2352
198 Ga0466958_0084253 3300045836 Bacteria 1960
199 Ga0466958_0128766 3300045836 Bacteria 1588
200 Ga0466958_0929760 3300045836 Bacteria 567
201 Ga0466967_0208730 3300045976 Bacteria 1852
202 Ga0466967_1196999 3300045976 Bacteria 757
203 Ga0495594_0048591 3300046499 Bacteria 2331
204 Ga0495635_0825134 3300046663 Bacteria 597
205 Ga0496100_0552439 3300048903 Bacteria 891
206 Ga0496102_0441532 3300048905 Bacteria 1221
207 Ga0496102_0694083 3300048905 Bacteria 941
208 Ga0496104_0027394 3300048907 Bacteria 5273
209 Ga0496104_0471662 3300048907 Bacteria 1166
210 Ga0496105_0094129 3300048908 Bacteria 2474
211 Ga0496105_0182976 3300048908 Bacteria 1715
212 Ga0496108_0030514 3300048911 Bacteria 4468
213 Ga0496108_0195627 3300048911 Bacteria 1753
214 Ga0496108_0303100 3300048911 Bacteria 1392
215 Ga0496109_0115424 3300048912 Bacteria 2498
216 Ga0496109_0409960 3300048912 Bacteria 1280
217 Ga0496110_0009034 3300048913 Bacteria 8044
218 Ga0496110_0152824 3300048913 Bacteria 2090
219 Ga0496110_0977743 3300048913 Bacteria 754
220 Ga0496111_0024656 3300048914 Bacteria 4239
221 Ga0496111_0173357 3300048914 Bacteria 1603
222 Ga0496112_0184817 3300048915 Bacteria 2048
223 Ga0496113_0016108 3300048916 Bacteria 5158
224 Ga0496113_0024250 3300048916 Bacteria 4309
225 Ga0496115_0271401 3300048918 Bacteria 1393
226 Ga0496117_0021418 3300048920 Bacteria 5230
227 Ga0496118_0010556 3300048921 Bacteria 9132
228 Ga0501306_013797 3300049127 Bacteria 1058
229 Ga0501310_049138 3300049130 Bacteria 606
230 Ga0501304_006092 3300049160 Bacteria 964
231 Ga0501316_047322 3300049532 Bacteria 612
232 Ga0501317_013426 3300049533 Bacteria 1024
233 Ga0501318_003024 3300049534 Bacteria 1511
234 Ga0501323_014935 3300049539 Bacteria 976
235 Ga0501031_0822313 3300049568 Bacteria 595
236 Ga0501034_0957085 3300049571 Bacteria 742
237 Ga0501038_0031333 3300049574 Bacteria 4700
238 Ga0501038_0061516 3300049574 Bacteria 3211
239 Ga0501038_0400521 3300049574 Bacteria 1062
240 Ga0501039_0263217 3300049575 Bacteria 1355
241 Ga0501040_0251790 3300049576 Bacteria 1260
242 Ga0501042_0010197 3300049578 Bacteria 6288
243 Ga0501047_0000076 3300049581 Bacteria 124949
244 Ga0501047_0084980 3300049581 Bacteria 3041
245 Ga0501047_0443047 3300049581 Bacteria 1128
246 Ga0501068_0167434 3300049584 Bacteria 1386
247 Ga0501070_0169806 3300049586 Bacteria 1797
248 Ga0501071_0273036 3300049587 Bacteria 1278
249 Ga0501072_0005866 3300049588 Bacteria 9356
250 Ga0501073_0294763 3300049589 Bacteria 1119
251 Ga0501073_0409433 3300049589 Bacteria 937
252 Ga0501075_0138727 3300049591 Bacteria 1852
253 Ga0501076_0124968 3300049592 Bacteria 2084
254 Ga0501077_0593062 3300049593 Bacteria 711
255 Ga0501225_0269617 3300049705 Bacteria 566
256 Ga0501079_0097090 3300049741 Bacteria 2284
257 Ga0501080_0561368 3300049742 Bacteria 1016
258 Ga0501081_0033780 3300049743 Bacteria 3477
259 Ga0501044_0331408 3300049823 Bacteria 1445
260 Ga0501044_0644722 3300049823 Bacteria 949
261 Ga0501045_0162919 3300049824 Bacteria 1660
262 nmdc:mga03n38_400914_c1 3300050490 Bacteria 755
263 nmdc:mga00v17_166428_c1 3300050491 Bacteria 1420
264 nmdc:mga05p37_1069204_c1 3300050507 Bacteria 849
265 nmdc:mga05p37_192583_c1 3300050507 Bacteria 2474
266 nmdc:mga05p37_23751_c1 3300050507 Bacteria 7445
267 nmdc:mga05p37_44725_c1 3300050507 Bacteria 5448
268 nmdc:mga09592_131_c3 3300050508 Bacteria 5354
269 nmdc:mga09592_1473820_c1 3300050508 Bacteria 554
270 nmdc:mga09592_158510_c1 3300050508 Bacteria 1954
271 nmdc:mga09592_48581_c1 3300050508 Bacteria 3577
272 nmdc:mga09592_872507_c1 3300050508 Bacteria 758
273 nmdc:mga0qj67_1241760_c1 3300050509 Bacteria 579
274 nmdc:mga0qj67_183_c2 3300050509 Bacteria 5879
275 nmdc:mga0qj67_238_c1 3300050509 Bacteria 37479
276 nmdc:mga0qj67_380442_c1 3300050509 Bacteria 1140
277 nmdc:mga0qj67_56113_c1 3300050509 Bacteria 3122
278 nmdc:mga0qj67_593980_c1 3300050509 Bacteria 886
279 nmdc:mga06r32_128937_c1 3300050510 Bacteria 2499
280 nmdc:mga06r32_333725_c1 3300050510 Bacteria 1501
281 nmdc:mga06r32_464112_c1 3300050510 Bacteria 1245
282 nmdc:mga06r32_705_c2 3300050510 Bacteria 5354
283 nmdc:mga06r32_872210_c1 3300050510 Bacteria 858
284 nmdc:mga06r32_905253_c1 3300050510 Bacteria 838
285 nmdc:mga0rr50_1864129_c1 3300050513 Bacteria 505
286 Ga0495601_0748068 3300053077 Bacteria 622
287 Ga0495619_0054886 3300053085 Bacteria 2638
288 Ga0500646_0216224 3300053090 Bacteria 663
289 Ga0500568_0005004 3300053139 Bacteria 6947
290 Ga0501084_0035726 3300054114 Bacteria 4154
291 Ga0587071_059312 3300060344 Bacteria 810
292 Ga0501082_0021145 3300060353 Bacteria 5612
293 Ga0466962_0059918 3300061719 Bacteria 1817
294 Ga0466962_0071643 3300061719 Bacteria 1656
295 Ga0466962_0102398 3300061719 Bacteria 1375
296 Ga0530510_0104401 3300061734 Bacteria 2073
297 2506869089 2506783011 Bacteria 5323186
298 2515495754 2515154088 Bacteria 5526283
299 2515721159 2515154129 Bacteria 5584369
300 2516084234 2515154202 Bacteria 5471270
301 2517761706 2517572101 Bacteria 6884336
302 2689963333 2687453737 Bacteria 11203906
303 2774901537 2773857933 Bacteria 5818019
304 2831938163 2831935698 Bacteria 5963223
305 2855689807 2855683550 Bacteria 7134265
306 2858870890 2858868258 Bacteria 7683772
307 2867509966 2867507094 Bacteria 6506033
308 2929226384 2929219909 Bacteria 6984360
309 2996222841 2996221748 Bacteria 6799777
310 3003003631 3002998708 Bacteria 11715108
311 8001789637 8001781756 Bacteria 9586736
312 8053951919 8053945823 Bacteria 8962862
313 Ga0500654_070346
314 Ga0058859_11789127
315 Ga0070683_100000671
316 Ga0070683_100279683
317 Ga0070683_101119294
318 Ga0070680_100486948
319 Ga0070682_100075744
320 Ga0070660_100379001
321 Ga0070660_100787078
322 Ga0070691_10431461
323 Ga0070671_100962770
324 Ga0070673_101338849
325 Ga0070709_10049772
326 Ga0070714_100990677
327 Ga0070713_100571866
328 Ga0070681_10366937
329 Ga0070681_10384676
330 Ga0070681_10577949
331 Ga0070707_101641229
332 Ga0070679_100279453
333 Ga0070684_100009197
334 Ga0070684_100111733
335 Ga0070695_100153989
336 Ga0070693_100532037
337 Ga0070704_101229253
338 Ga0068855_100040391
339 Ga0070664_100011115
340 Ga0070664_100032470
341 Ga0070664_100108631
342 Ga0070664_100251430
343 Ga0070664_100503517
344 Ga0068857_100037937
345 Ga0068857_100287046
346 Ga0068856_100105307
347 Ga0068864_100578990
348 Ga0068860_100488486
349 Ga0068860_101005789
350 Ga0068862_100000328
351 Ga0068862_101550558
352 Ga0081540_1004469
353 Ga0081539_10214556
354 Ga0070712_100102741
355 Ga0097621_100417567
356 Ga0075428_100000567
357 Ga0075428_100022731
358 Ga0075428_100213375
359 Ga0075428_100307665
360 Ga0075428_100455862
361 Ga0075428_100658151
362 Ga0075430_100000705
363 Ga0075430_100063344
364 Ga0075430_100190738
365 Ga0075430_101042602
366 Ga0075431_100011277
367 Ga0075431_100191399
368 Ga0075431_100348166
369 Ga0075431_100437261
370 Ga0075434_100912998
371 Ga0075429_100003101
372 Ga0075429_100031838
373 Ga0075429_100100630
374 Ga0075429_100109137
375 Ga0097620_100000753
376 Ga0114129_10000749
377 Ga0114129_10031771
378 Ga0114129_10303113
379 Ga0114129_10667181
380 Ga0114129_10950509
381 Ga0105248_10000360
382 Ga0105248_10147447
383 Ga0105248_10280752
384 Ga0105238_10439485
385 Ga0105249_10097898
386 Ga0105249_13204747
387 Ga0105239_10067402
388 Ga0157369_10028539
389 Ga0157369_10215420
390 Ga0157369_11234680
391 Ga0157369_11356850
392 Ga0157369_11432605
393 Ga0163162_10652608
394 Ga0157372_10720071
395 Ga0157375_10025376
396 Ga0157375_11074013
397 Ga0157375_11466668
398 Ga0163163_10047532
399 Ga0163163_10058202
400 Ga0163163_10251941
401 Ga0163163_11199844
402 Ga0157380_11048041
403 Ga0157377_10357259
404 Ga0157379_10165301
405 Ga0157379_10697719
406 Ga0157376_10319640
407 Ga0157376_12279226
408 Ga0197907_10196520
409 Ga0197907_10821178
410 Ga0206356_10483938
411 Ga0206356_11301659
412 Ga0206356_11504836
413 Ga0206352_10253406
414 Ga0206352_10650796
415 Ga0206354_10058898
416 Ga0206354_10256116
417 Ga0206353_10231304
418 Ga0206353_11241645
419 Ga0207685_10219533
420 Ga0207699_10145223
421 Ga0207705_10032617
422 Ga0207705_10185080
423 Ga0207707_10073410
424 Ga0207693_10114953
425 Ga0207660_10097444
426 Ga0207657_10190023
427 Ga0207657_10343660
428 Ga0207649_10021271
429 Ga0207649_10828446
430 Ga0207652_10059277
431 Ga0207664_10085985
432 Ga0207665_10929799
433 Ga0207711_10000030
434 Ga0207711_10023082
435 Ga0207689_10133757
436 Ga0207661_10014920
437 Ga0207661_10024802
438 Ga0207661_10152123
439 Ga0207661_11126514
440 Ga0207679_10024087
441 Ga0207679_10451706
442 Ga0207679_11046399
443 Ga0207667_10205061
444 Ga0207667_11451871
445 Ga0207651_11432995
446 Ga0207712_10011310
447 Ga0207712_10981658
448 Ga0207658_10331819
449 Ga0207703_10163661
450 Ga0207708_10135625
451 Ga0207708_10922950
452 Ga0207702_10153313
453 Ga0207702_11292566
454 Ga0207641_10030324
455 Ga0207641_11086431
456 Ga0207641_11233282
457 Ga0207676_10054723
458 Ga0207676_11123529
459 Ga0207674_10026834
460 Ga0207674_10127742
461 Ga0207674_10474476
462 Ga0207674_10514049
463 Ga0207674_11439258
464 Ga0207683_11883710
465 Ga0268265_10000124
466 Ga0268265_11033138
467 Ga0307515_10013680
468 Ga0265328_10020917
469 Ga0265327_10073441
470 Ga0307509_10512760
471 Ga0307408_100050928
472 Ga0307405_10001693
473 Ga0307405_11636371
474 Ga0307413_10066374
475 Ga0307410_10013407
476 Ga0307410_10964945
477 Ga0326468_10008167
478 Ga0307406_10003851
479 Ga0307406_10301131
480 Ga0307407_10125963
481 Ga0307407_11635901
482 Ga0307412_10026844
483 Ga0307409_100001290
484 Ga0307416_100001483
485 Ga0307416_100482539
486 Ga0307415_100000009
487 Ga0307415_100056747
488 Ga0307415_100098413
489 Ga0307415_100186866
490 Ga0373934_0328685
491 Ga0373954_0049273
492 Ga0373927_0531450
493 Ga0373937_0071164
494 Ga0395900_0081583
495 Ga0395898_0018250
496 Ga0395905_0150601
497 Ga0395901_0078838
498 Ga0466972_0326711
499 Ga0466961_0001655
500 Ga0466961_0152282
501 Ga0466961_0252092
502 Ga0466963_0031849
503 Ga0466963_0250324
504 Ga0466963_1187469
505 Ga0466957_0066155
506 Ga0466960_0773322
507 Ga0466959_0034645
508 Ga0466958_0014721
509 Ga0466958_0058072
510 Ga0466958_0084253
511 Ga0466958_0128766
512 Ga0466958_0929760
513 Ga0466967_0208730
514 Ga0466967_1196999
515 Ga0495594_0048591
516 Ga0495635_0825134
517 Ga0496100_0552439
518 Ga0496102_0441532
519 Ga0496102_0694083
520 Ga0496104_0027394
521 Ga0496104_0471662
522 Ga0496105_0094129
523 Ga0496105_0182976
524 Ga0496108_0030514
525 Ga0496108_0195627
526 Ga0496108_0303100
527 Ga0496109_0115424
528 Ga0496109_0409960
529 Ga0496110_0009034
530 Ga0496110_0152824
531 Ga0496110_0977743
532 Ga0496111_0024656
533 Ga0496111_0173357
534 Ga0496112_0184817
535 Ga0496113_0016108
536 Ga0496113_0024250
537 Ga0496115_0271401
538 Ga0496117_0021418
539 Ga0496118_0010556
540 Ga0501306_013797
541 Ga0501310_049138
542 Ga0501304_006092
543 Ga0501316_047322
544 Ga0501317_013426
545 Ga0501318_003024
546 Ga0501323_014935
547 Ga0501031_0822313
548 Ga0501034_0957085
549 Ga0501038_0031333
550 Ga0501038_0061516
551 Ga0501038_0400521
552 Ga0501039_0263217
553 Ga0501040_0251790
554 Ga0501042_0010197
555 Ga0501047_0000076
556 Ga0501047_0084980
557 Ga0501047_0443047
558 Ga0501068_0167434
559 Ga0501070_0169806
560 Ga0501071_0273036
561 Ga0501072_0005866
562 Ga0501073_0294763
563 Ga0501073_0409433
564 Ga0501075_0138727
565 Ga0501076_0124968
566 Ga0501077_0593062
567 Ga0501225_0269617
568 Ga0501079_0097090
569 Ga0501080_0561368
570 Ga0501081_0033780
571 Ga0501044_0331408
572 Ga0501044_0644722
573 Ga0501045_0162919
574 nmdc:mga03n38_400914_c1
575 nmdc:mga00v17_166428_c1
576 nmdc:mga05p37_1069204_c1
577 nmdc:mga05p37_192583_c1
578 nmdc:mga05p37_23751_c1
579 nmdc:mga05p37_44725_c1
580 nmdc:mga09592_131_c3
581 nmdc:mga09592_1473820_c1
582 nmdc:mga09592_158510_c1
583 nmdc:mga09592_48581_c1
584 nmdc:mga09592_872507_c1
585 nmdc:mga0qj67_1241760_c1
586 nmdc:mga0qj67_183_c2
587 nmdc:mga0qj67_238_c1
588 nmdc:mga0qj67_380442_c1
589 nmdc:mga0qj67_56113_c1
590 nmdc:mga0qj67_593980_c1
591 nmdc:mga06r32_128937_c1
592 nmdc:mga06r32_333725_c1
593 nmdc:mga06r32_464112_c1
594 nmdc:mga06r32_705_c2
595 nmdc:mga06r32_872210_c1
596 nmdc:mga06r32_905253_c1
597 nmdc:mga0rr50_1864129_c1
598 Ga0495601_0748068
599 Ga0495619_0054886
600 Ga0500646_0216224
601 Ga0500568_0005004
602 Ga0501084_0035726
603 Ga0587071_059312
604 Ga0501082_0021145
605 Ga0466962_0059918
606 Ga0466962_0071643
607 Ga0466962_0102398
608 Ga0530510_0104401
609 2506869089
610 2515495754
611 2515721159
612 2516084234
613 2517761706
614 2689963333
615 2774901537
616 2831938163
617 2855689807
618 2858870890
619 2867509966
620 2929226384
621 2996222841
622 3003003631
623 8001789637
624 8053951919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

1

47

0.97

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

48

132

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6y69-assembly1.cif.gz_H cryo-em structure of an escherichia coli 70s ribosome in complex with antibiotic tetracenomycinx 0.8894 72 148
6y69-assembly1.cif.gz_H cryo-em structure of an escherichia coli 70s ribosome in complex with antibiotic tetracenomycinx 0.8588 72 148
7pd3-assembly1.cif.gz_C structure of the human mitoribosomal large subunit in complex with nsun4.mterf4.gtpbp7 and malsu1.l0r8f8.mt-acp 0.8079 67 148
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 0.7955 1 40
8cgk-assembly1.cif.gz_h lincomycin and avilamycin bound to the 50s subunit 0.7938 1 40
ID Description Score Start End Superfamily
af_P9WH79_61_151_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9607 61 148 3.10.430.100
af_Q2G2T3_62_150_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9434 62 148 3.10.430.100
af_I1LR95_110_197_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9371 63 148 3.10.430.100
af_P9WH79_61_151_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9202 61 148 3.10.430.100
af_Q2G2T3_62_150_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9133 62 148 3.10.430.100
ID Description Score Start End GO Terms
AF-A0A353K5N8-F1-model_v4 deleted 0.9563 62 148
AF-A0A353K5N8-F1-model_v4 deleted 0.9458 62 148
AF-A0A7W0R2H7-F1-model_v4 50S ribosomal protein L9 0.931 63 149 GO:0003735
GO:0005840
GO:0006412
AF-A0A7K0SCK5-F1-model_v4 deleted 0.9294 64 148
AF-A0A7K0SCK5-F1-model_v4 deleted 0.9193 64 148

Map