F401657

General Info

Members Datasets Scaffolds Average Seq Length
312 180 624 423

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100109441|Ga0075431_1001094412
Length 439
Sequence MRRRDFVGQALGLLATLGPASRLLALDLAGAGARGVRPRAGWLLVPMDDAQSDHLKAYGLTYRSVQRGIRAEWLLNYRNGSFLIPADQATPRDAALSGISVEPLDDGAVLQIRAEIQSGNMDAIPLEKAPKVAVYVPPNAPPWDDAVTMALNYAGIQFEKIWDPEVLRDGLRKYDWLHLHHEDFTGQYSKFYLNYAGAPWLLDMVKQNTAMARTLGFATVPEEKKAVARAIAAYLERGGFLFAMCTATETLDLALAGQGVDIATDYADRTPMDPNASAKMHWDLALAFQNARLELNPSVPVFSDIDGHQVNSLDRRQPLGSFTLFNFSAKIDPVATMLVQNHRQVIPDFYGLTTSFTRRTLKPSVTVLADEPGAPWVKYIHGERGQGTWTFFGGHDPEDPQHQIGDPPTDLSLHPHSPGYRLILNNVLFPAAKKKELKT

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
86 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
163 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
164 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
170 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.62
Rhizosphere 90.38
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100109441 3300006847 Bacteria 2852
2 Ga0065715_10125963 3300005293 Bacteria 2118
3 Ga0070676_10004032 3300005328 Bacteria 7710
4 Ga0070666_10013884 3300005335 Bacteria 5118
5 Ga0070680_100025152 3300005336 Bacteria 4757
6 Ga0070680_100032145 3300005336 Bacteria 4222
7 Ga0070668_100002790 3300005347 Bacteria 12851
8 Ga0070671_100043830 3300005355 Bacteria 3718
9 Ga0070671_100056785 3300005355 Bacteria 3257
10 Ga0070674_100000296 3300005356 Bacteria 24401
11 Ga0070705_100006737 3300005440 Bacteria 5649
12 Ga0070705_100148725 3300005440 Bacteria 1551
13 Ga0070694_100028303 3300005444 Bacteria 3645
14 Ga0070694_100057131 3300005444 Bacteria 2652
15 Ga0070694_100072825 3300005444 Bacteria 2371
16 Ga0070708_100007302 3300005445 Bacteria 8845
17 Ga0070708_100043742 3300005445 Bacteria 3936
18 Ga0070681_10258777 3300005458 Bacteria 1652
19 Ga0070681_10258951 3300005458 Bacteria 1652
20 Ga0068867_100000592 3300005459 Bacteria 24008
21 Ga0070707_100007543 3300005468 Bacteria 10108
22 Ga0070707_100017822 3300005468 Bacteria 6675
23 Ga0070707_100020567 3300005468 Bacteria 6229
24 Ga0070698_100079454 3300005471 Bacteria 3277
25 Ga0070698_100126295 3300005471 Bacteria 2515
26 Ga0070699_100002748 3300005518 Bacteria 15694
27 Ga0070699_100003626 3300005518 Bacteria 13656
28 Ga0070699_100011949 3300005518 Bacteria 7494
29 Ga0070699_100020717 3300005518 Bacteria 5671
30 Ga0070679_100029853 3300005530 Bacteria 5380
31 Ga0070679_100092352 3300005530 Bacteria 3014
32 Ga0070697_100060563 3300005536 Bacteria 3086
33 Ga0070672_100032472 3300005543 Bacteria 3940
34 Ga0070695_100069263 3300005545 Bacteria 2305
35 Ga0070695_100140993 3300005545 Bacteria 1671
36 Ga0070696_100000307 3300005546 Bacteria 29662
37 Ga0070693_100013676 3300005547 Bacteria 4140
38 Ga0070665_100226889 3300005548 Bacteria 1868
39 Ga0070704_100007153 3300005549 Bacteria 6630
40 Ga0070664_100037262 3300005564 Bacteria 4088
41 Ga0070664_100073798 3300005564 Bacteria 2928
42 Ga0068857_100183461 3300005577 Bacteria 1904
43 Ga0068854_100001723 3300005578 Bacteria 13336
44 Ga0070702_100072717 3300005615 Bacteria 2035
45 Ga0068859_100064885 3300005617 Bacteria 3685
46 Ga0068859_100138317 3300005617 Bacteria 2509
47 Ga0068859_100331064 3300005617 Bacteria 1617
48 Ga0068864_100085679 3300005618 Bacteria 2770
49 Ga0068866_10001724 3300005718 Bacteria 9178
50 Ga0068861_100015890 3300005719 Bacteria 5316
51 Ga0068863_100024511 3300005841 Bacteria 5754
52 Ga0068863_100130126 3300005841 Bacteria 2403
53 Ga0068860_100139834 3300005843 Bacteria 2326
54 Ga0081455_10031377 3300005937 Bacteria 4809
55 Ga0081538_10022344 3300005981 Bacteria 4585
56 Ga0097621_100051053 3300006237 Bacteria 3364
57 Ga0075428_100009055 3300006844 Bacteria 11046
58 Ga0075428_100068651 3300006844 Bacteria 3877
59 Ga0075433_10016720 3300006852 Bacteria 6056
60 Ga0075434_100011303 3300006871 Bacteria 8410
61 Ga0075434_100219262 3300006871 Bacteria 1922
62 Ga0075429_100000885 3300006880 Bacteria 23658
63 Ga0068865_100003459 3300006881 Bacteria 9459
64 Ga0097620_100064885 3300006931 Bacteria 3685
65 Ga0097620_100138322 3300006931 Bacteria 2509
66 Ga0097620_100331060 3300006931 Bacteria 1617
67 Ga0105240_10120118 3300009093 Bacteria 3165
68 Ga0111539_10056159 3300009094 Bacteria 4680
69 Ga0114129_10010279 3300009147 Bacteria 13355
70 Ga0114129_10023189 3300009147 Bacteria 8803
71 Ga0114129_10149660 3300009147 Bacteria 3195
72 Ga0105243_10095642 3300009148 Bacteria 2455
73 Ga0105241_10017971 3300009174 Bacteria 5199
74 Ga0105242_10004083 3300009176 Bacteria 11349
75 Ga0105248_10010744 3300009177 Bacteria 10105
76 Ga0105248_10014269 3300009177 Bacteria 8746
77 Ga0105249_10091114 3300009553 Bacteria 2852
78 Ga0105249_10099764 3300009553 Bacteria 2729
79 Ga0105239_10022906 3300010375 Bacteria 6886
80 Ga0163162_10058006 3300013306 Bacteria 3900
81 Ga0157372_10331874 3300013307 Bacteria 1771
82 Ga0157375_10159797 3300013308 Bacteria 2395
83 Ga0157375_10313807 3300013308 Bacteria 1732
84 Ga0157375_10534654 3300013308 Bacteria 1335
85 Ga0163163_10012268 3300014325 Bacteria 7802
86 Ga0163163_10056314 3300014325 Bacteria 3886
87 Ga0157379_10023992 3300014968 Bacteria 5414
88 Ga0207642_10002156 3300025899 Bacteria 6102
89 Ga0207645_10007460 3300025907 Bacteria 7721
90 Ga0207643_10010124 3300025908 Bacteria 5070
91 Ga0207684_10006023 3300025910 Bacteria 11094
92 Ga0207654_10059322 3300025911 Bacteria 2231
93 Ga0207707_10016938 3300025912 Bacteria 6349
94 Ga0207707_10220203 3300025912 Unclassified 1652
95 Ga0207695_10101795 3300025913 Bacteria 2866
96 Ga0207646_10021299 3300025922 Bacteria 5991
97 Ga0207646_10033008 3300025922 Bacteria 4683
98 Ga0207644_10069179 3300025931 Bacteria 2577
99 Ga0207706_10001254 3300025933 Bacteria 25542
100 Ga0207686_10000353 3300025934 Bacteria 32695
101 Ga0207669_10001291 3300025937 Bacteria 10629
102 Ga0207691_10023244 3300025940 Bacteria 5836
103 Ga0207691_10057283 3300025940 Bacteria 3547
104 Ga0207711_10005254 3300025941 Bacteria 10978
105 Ga0207711_10140612 3300025941 Bacteria 2171
106 Ga0207661_10219914 3300025944 Bacteria 1678
107 Ga0207679_10029833 3300025945 Bacteria 3801
108 Ga0207679_10091154 3300025945 Bacteria 2358
109 Ga0207651_10042280 3300025960 Bacteria 3032
110 Ga0207668_10006948 3300025972 Bacteria 6717
111 Ga0207640_10039669 3300025981 Bacteria 2982
112 Ga0207678_10166668 3300026067 Bacteria 1881
113 Ga0207708_10164871 3300026075 Bacteria 1751
114 Ga0207641_10046372 3300026088 Bacteria 3663
115 Ga0207641_10115611 3300026088 Bacteria 2386
116 Ga0207648_10000067 3300026089 Bacteria 98265
117 Ga0207674_10102171 3300026116 Bacteria 2847
118 Ga0207675_100004295 3300026118 Bacteria 13772
119 Ga0207675_100006422 3300026118 Bacteria 11132
120 Ga0268264_10010207 3300028381 Bacteria 7773
121 Ga0307408_100011276 3300031548 Bacteria 5903
122 Ga0307408_100173141 3300031548 Bacteria 1725
123 Ga0316579_10006548 3300031691 Bacteria 4757
124 Ga0316579_10084873 3300031691 Bacteria 1510
125 Ga0316576_10030294 3300031727 Bacteria 3830
126 Ga0316578_10000802 3300031728 Bacteria 11651
127 Ga0307405_10012305 3300031731 Bacteria 4522
128 Ga0307405_10079458 3300031731 Bacteria 2138
129 Ga0307405_10084753 3300031731 Bacteria 2081
130 Ga0316577_10007299 3300031733 Bacteria 5897
131 Ga0307413_10002866 3300031824 Bacteria 7117
132 Ga0307413_10004862 3300031824 Bacteria 5906
133 Ga0307413_10021961 3300031824 Bacteria 3428
134 Ga0307410_10000273 3300031852 Bacteria 19870
135 Ga0307410_10009223 3300031852 Bacteria 5522
136 Ga0307410_10102656 3300031852 Bacteria 2052
137 Ga0307410_10163271 3300031852 Bacteria 1671
138 Ga0307406_10013024 3300031901 Bacteria 4755
139 Ga0307406_10038244 3300031901 Bacteria 2969
140 Ga0307407_10012575 3300031903 Unclassified 4074
141 Ga0307407_10041332 3300031903 Bacteria 2578
142 Ga0307409_100000352 3300031995 Bacteria 19112
143 Ga0307409_100012600 3300031995 Bacteria 5395
144 Ga0307409_100039809 3300031995 Bacteria 3492
145 Ga0307409_100135521 3300031995 Bacteria 2112
146 Ga0307409_100296153 3300031995 Bacteria 1503
147 Ga0307409_100319456 3300031995 Bacteria 1452
148 Ga0307416_100004442 3300032002 Bacteria 8453
149 Ga0307416_100041694 3300032002 Bacteria 3577
150 Ga0307416_100075145 3300032002 Bacteria 2826
151 Ga0307416_100220244 3300032002 Bacteria 1819
152 Ga0307414_10004257 3300032004 Bacteria 7763
153 Ga0307414_10037113 3300032004 Bacteria 3260
154 Ga0307414_10048100 3300032004 Bacteria 2940
155 Ga0307414_10120004 3300032004 Bacteria 2020
156 Ga0307411_10005697 3300032005 Bacteria 6152
157 Ga0307411_10012751 3300032005 Bacteria 4605
158 Ga0307411_10047713 3300032005 Bacteria 2770
159 Ga0307415_100012715 3300032126 Bacteria 4878
160 Ga0307415_100043362 3300032126 Bacteria 3001
161 Ga0307415_100056171 3300032126 Unclassified 2697
162 Ga0373941_0012706 3300035115 Bacteria 2208
163 Ga0316582_0031484 3300036647 Bacteria 3243
164 Ga0316582_0050020 3300036647 Bacteria 2646
165 Ga0316584_0072445 3300036712 Bacteria 2582
166 Ga0395899_0082198 3300037312 Bacteria 2343
167 Ga0395905_0007974 3300037471 Bacteria 10470
168 Ga0395905_0108020 3300037471 Bacteria 2612
169 Ga0395901_0004554 3300038443 Bacteria 13990
170 Ga0439448_0012536 3300042005 Bacteria 2538
171 Ga0450910_002534 3300042147 Bacteria 2401
172 Ga0451577_0003124 3300042876 Bacteria 18687
173 Ga0453683_0031212 3300044673 Bacteria 3367
174 Ga0453684_0333460 3300044712 Bacteria 1715
175 Ga0451576_0120922 3300045051 Bacteria 2726
176 Ga0495580_0125562 3300046472 Bacteria 1781
177 Ga0495582_0033954 3300046473 Bacteria 2805
178 Ga0495639_0054102 3300046475 Bacteria 1829
179 Ga0495662_0082238 3300046476 Bacteria 1567
180 Ga0495664_0110899 3300046477 Bacteria 1656
181 Ga0495594_0028181 3300046499 Bacteria 3029
182 Ga0495666_0003575 3300046526 Bacteria 7857
183 Ga0495640_0005351 3300046533 Bacteria 10209
184 Ga0495586_0004083 3300046535 Bacteria 7827
185 Ga0495634_0040838 3300046642 Bacteria 3152
186 Ga0495658_0012624 3300046683 Bacteria 4285
187 Ga0495624_0044971 3300046690 Bacteria 2813
188 Ga0495674_0086259 3300047319 Bacteria 2688
189 Ga0495676_0143967 3300047321 Bacteria 1705
190 Ga0495680_0108978 3300047322 Bacteria 2054
191 Ga0496101_0215952 3300048904 Bacteria 1487
192 Ga0496101_0297370 3300048904 Bacteria 1264
193 Ga0496102_0006173 3300048905 Bacteria 10218
194 Ga0496102_0236908 3300048905 Bacteria 1721
195 Ga0496103_0010278 3300048906 Bacteria 5535
196 Ga0496104_0009142 3300048907 Bacteria 8810
197 Ga0496105_0031831 3300048908 Bacteria 4326
198 Ga0496106_0012568 3300048909 Bacteria 6252
199 Ga0496106_0173592 3300048909 Bacteria 1709
200 Ga0496107_0076351 3300048910 Bacteria 2440
201 Ga0496108_0000253 3300048911 Bacteria 46587
202 Ga0496108_0006392 3300048911 Bacteria 9553
203 Ga0496108_0021189 3300048911 Bacteria 5342
204 Ga0496108_0027711 3300048911 Bacteria 4682
205 Ga0496109_0001579 3300048912 Bacteria 19017
206 Ga0496109_0004150 3300048912 Bacteria 12096
207 Ga0496109_0022112 3300048912 Bacteria 5628
208 Ga0496109_0119081 3300048912 Bacteria 2458
209 Ga0496110_0018793 3300048913 Bacteria 5802
210 Ga0496110_0129777 3300048913 Bacteria 2275
211 Ga0496111_0012967 3300048914 Bacteria 5658
212 Ga0496111_0022108 3300048914 Bacteria 4449
213 Ga0496111_0027493 3300048914 Bacteria 4024
214 Ga0496112_0000074 3300048915 Bacteria 65495
215 Ga0496112_0001634 3300048915 Bacteria 17366
216 Ga0496112_0039214 3300048915 Bacteria 4627
217 Ga0496112_0127431 3300048915 Bacteria 2516
218 Ga0496113_0032015 3300048916 Bacteria 3820
219 Ga0496114_0012334 3300048917 Bacteria 6840
220 Ga0496115_0010733 3300048918 Bacteria 6850
221 Ga0501033_0122575 3300049570 Bacteria 1885
222 Ga0501034_0003068 3300049571 Bacteria 19269
223 Ga0501034_0260033 3300049571 Bacteria 1679
224 Ga0501036_0081554 3300049572 Bacteria 2734
225 Ga0501036_0126617 3300049572 Bacteria 2157
226 Ga0501039_0163843 3300049575 Bacteria 1748
227 Ga0501040_0031007 3300049576 Bacteria 3613
228 Ga0501040_0046702 3300049576 Bacteria 2956
229 Ga0501040_0049636 3300049576 Bacteria 2869
230 Ga0501040_0197925 3300049576 Bacteria 1426
231 Ga0501041_0009422 3300049577 Bacteria 5757
232 Ga0501041_0023486 3300049577 Bacteria 3698
233 Ga0501042_0049919 3300049578 Bacteria 2985
234 Ga0501042_0088131 3300049578 Bacteria 2227
235 Ga0501046_0034266 3300049580 Bacteria 4099
236 Ga0501047_0104830 3300049581 Bacteria 2708
237 Ga0501048_0065928 3300049582 Bacteria 2560
238 Ga0501048_0167124 3300049582 Bacteria 1558
239 Ga0501067_0006122 3300049583 Bacteria 6670
240 Ga0501067_0034924 3300049583 Bacteria 2791
241 Ga0501067_0037892 3300049583 Bacteria 2677
242 Ga0501068_0000704 3300049584 Bacteria 17137
243 Ga0501068_0001076 3300049584 Bacteria 14444
244 Ga0501069_0001537 3300049585 Bacteria 11405
245 Ga0501069_0002393 3300049585 Bacteria 9522
246 Ga0501069_0088434 3300049585 Bacteria 1751
247 Ga0501070_0002262 3300049586 Bacteria 16923
248 Ga0501070_0003610 3300049586 Bacteria 13379
249 Ga0501070_0194579 3300049586 Bacteria 1666
250 Ga0501071_0000890 3300049587 Bacteria 16152
251 Ga0501071_0001725 3300049587 Bacteria 12835
252 Ga0501071_0069468 3300049587 Bacteria 2565
253 Ga0501072_0008191 3300049588 Bacteria 7935
254 Ga0501072_0054291 3300049588 Bacteria 3156
255 Ga0501073_0004504 3300049589 Bacteria 10468
256 Ga0501073_0011415 3300049589 Bacteria 6500
257 Ga0501074_0000166 3300049590 Bacteria 35222
258 Ga0501074_0004801 3300049590 Bacteria 9691
259 Ga0501074_0085331 3300049590 Bacteria 2263
260 Ga0501074_0110809 3300049590 Bacteria 1964
261 Ga0501075_0014165 3300049591 Bacteria 5713
262 Ga0501075_0039070 3300049591 Bacteria 3551
263 Ga0501075_0076916 3300049591 Bacteria 2525
264 Ga0501076_0013926 3300049592 Bacteria 6040
265 Ga0501076_0082549 3300049592 Bacteria 2580
266 Ga0501077_0001741 3300049593 Bacteria 13112
267 Ga0501249_008914 3300049679 Bacteria 2084
268 Ga0501258_001336 3300049687 Bacteria 1992
269 Ga0501229_002598 3300049706 Unclassified 2132
270 Ga0501079_0009840 3300049741 Bacteria 7253
271 Ga0501079_0013747 3300049741 Bacteria 6173
272 Ga0501080_0020963 3300049742 Bacteria 6047
273 Ga0501080_0032944 3300049742 Bacteria 4834
274 Ga0501080_0037649 3300049742 Bacteria 4517
275 Ga0501080_0201604 3300049742 Bacteria 1827
276 Ga0501081_0019391 3300049743 Bacteria 4529
277 Ga0501081_0091258 3300049743 Bacteria 2142
278 Ga0501081_0103561 3300049743 Bacteria 2014
279 Ga0501083_0002113 3300049744 Bacteria 13636
280 Ga0501083_0010358 3300049744 Bacteria 6563
281 Ga0501267_004032 3300049764 Bacteria 1354
282 Ga0501272_000569 3300049769 Bacteria 3278
283 nmdc:mga05p37_13271_c1 3300050507 Bacteria 9864
284 nmdc:mga05p37_152967_c1 3300050507 Bacteria 2820
285 nmdc:mga05p37_155004_c1 3300050507 Bacteria 2800
286 nmdc:mga09592_1153_c1 3300050508 Bacteria 21061
287 nmdc:mga06r32_1200_c1 3300050510 Bacteria 23329
288 nmdc:mga06r32_149362_c1 3300050510 Bacteria 2314
289 nmdc:mga06r32_401417_c1 3300050510 Bacteria 1353
290 nmdc:mga08y16_235798_c1 3300050511 Unclassified 1892
291 nmdc:mga0n895_10697_c1 3300050512 Bacteria 8128
292 nmdc:mga0n895_217586_c1 3300050512 Bacteria 1939
293 nmdc:mga0n895_221276_c1 3300050512 Bacteria 1922
294 nmdc:mga0n895_345086_c1 3300050512 Bacteria 1508
295 nmdc:mga0a205_22579_c1 3300050515 Bacteria 5962
296 nmdc:mga0a205_58516_c1 3300050515 Bacteria 3722
297 Ga0501084_0000647 3300054114 Bacteria 26529
298 Ga0501084_0001837 3300054114 Bacteria 16929
299 Ga0501084_0046581 3300054114 Bacteria 3633
300 Ga0501084_0074409 3300054114 Bacteria 2844
301 Ga0590071_014509 3300059421 Bacteria 1849
302 Ga0501082_0010624 3300060353 Bacteria 7924
303 Ga0501082_0018670 3300060353 Bacteria 5974
304 Ga0501082_0019557 3300060353 Bacteria 5840
305 Ga0501082_0035778 3300060353 Bacteria 4279
306 Ga0501082_0043409 3300060353 Bacteria 3877
307 Ga0501082_0058845 3300060353 Bacteria 3311
308 Ga0501082_0216869 3300060353 Bacteria 1665
309 Ga0530510_0021722 3300061734 Bacteria 4567
310 Ga0530510_0059193 3300061734 Bacteria 2771
311 Ga0530510_0099802 3300061734 Bacteria 2123
312 Ga0530510_0231075 3300061734 Unclassified 1376
313 Ga0075431_100109441
314 Ga0065715_10125963
315 Ga0070676_10004032
316 Ga0070666_10013884
317 Ga0070680_100025152
318 Ga0070680_100032145
319 Ga0070668_100002790
320 Ga0070671_100043830
321 Ga0070671_100056785
322 Ga0070674_100000296
323 Ga0070705_100006737
324 Ga0070705_100148725
325 Ga0070694_100028303
326 Ga0070694_100057131
327 Ga0070694_100072825
328 Ga0070708_100007302
329 Ga0070708_100043742
330 Ga0070681_10258777
331 Ga0070681_10258951
332 Ga0068867_100000592
333 Ga0070707_100007543
334 Ga0070707_100017822
335 Ga0070707_100020567
336 Ga0070698_100079454
337 Ga0070698_100126295
338 Ga0070699_100002748
339 Ga0070699_100003626
340 Ga0070699_100011949
341 Ga0070699_100020717
342 Ga0070679_100029853
343 Ga0070679_100092352
344 Ga0070697_100060563
345 Ga0070672_100032472
346 Ga0070695_100069263
347 Ga0070695_100140993
348 Ga0070696_100000307
349 Ga0070693_100013676
350 Ga0070665_100226889
351 Ga0070704_100007153
352 Ga0070664_100037262
353 Ga0070664_100073798
354 Ga0068857_100183461
355 Ga0068854_100001723
356 Ga0070702_100072717
357 Ga0068859_100064885
358 Ga0068859_100138317
359 Ga0068859_100331064
360 Ga0068864_100085679
361 Ga0068866_10001724
362 Ga0068861_100015890
363 Ga0068863_100024511
364 Ga0068863_100130126
365 Ga0068860_100139834
366 Ga0081455_10031377
367 Ga0081538_10022344
368 Ga0097621_100051053
369 Ga0075428_100009055
370 Ga0075428_100068651
371 Ga0075433_10016720
372 Ga0075434_100011303
373 Ga0075434_100219262
374 Ga0075429_100000885
375 Ga0068865_100003459
376 Ga0097620_100064885
377 Ga0097620_100138322
378 Ga0097620_100331060
379 Ga0105240_10120118
380 Ga0111539_10056159
381 Ga0114129_10010279
382 Ga0114129_10023189
383 Ga0114129_10149660
384 Ga0105243_10095642
385 Ga0105241_10017971
386 Ga0105242_10004083
387 Ga0105248_10010744
388 Ga0105248_10014269
389 Ga0105249_10091114
390 Ga0105249_10099764
391 Ga0105239_10022906
392 Ga0163162_10058006
393 Ga0157372_10331874
394 Ga0157375_10159797
395 Ga0157375_10313807
396 Ga0157375_10534654
397 Ga0163163_10012268
398 Ga0163163_10056314
399 Ga0157379_10023992
400 Ga0207642_10002156
401 Ga0207645_10007460
402 Ga0207643_10010124
403 Ga0207684_10006023
404 Ga0207654_10059322
405 Ga0207707_10016938
406 Ga0207707_10220203
407 Ga0207695_10101795
408 Ga0207646_10021299
409 Ga0207646_10033008
410 Ga0207644_10069179
411 Ga0207706_10001254
412 Ga0207686_10000353
413 Ga0207669_10001291
414 Ga0207691_10023244
415 Ga0207691_10057283
416 Ga0207711_10005254
417 Ga0207711_10140612
418 Ga0207661_10219914
419 Ga0207679_10029833
420 Ga0207679_10091154
421 Ga0207651_10042280
422 Ga0207668_10006948
423 Ga0207640_10039669
424 Ga0207678_10166668
425 Ga0207708_10164871
426 Ga0207641_10046372
427 Ga0207641_10115611
428 Ga0207648_10000067
429 Ga0207674_10102171
430 Ga0207675_100004295
431 Ga0207675_100006422
432 Ga0268264_10010207
433 Ga0307408_100011276
434 Ga0307408_100173141
435 Ga0316579_10006548
436 Ga0316579_10084873
437 Ga0316576_10030294
438 Ga0316578_10000802
439 Ga0307405_10012305
440 Ga0307405_10079458
441 Ga0307405_10084753
442 Ga0316577_10007299
443 Ga0307413_10002866
444 Ga0307413_10004862
445 Ga0307413_10021961
446 Ga0307410_10000273
447 Ga0307410_10009223
448 Ga0307410_10102656
449 Ga0307410_10163271
450 Ga0307406_10013024
451 Ga0307406_10038244
452 Ga0307407_10012575
453 Ga0307407_10041332
454 Ga0307409_100000352
455 Ga0307409_100012600
456 Ga0307409_100039809
457 Ga0307409_100135521
458 Ga0307409_100296153
459 Ga0307409_100319456
460 Ga0307416_100004442
461 Ga0307416_100041694
462 Ga0307416_100075145
463 Ga0307416_100220244
464 Ga0307414_10004257
465 Ga0307414_10037113
466 Ga0307414_10048100
467 Ga0307414_10120004
468 Ga0307411_10005697
469 Ga0307411_10012751
470 Ga0307411_10047713
471 Ga0307415_100012715
472 Ga0307415_100043362
473 Ga0307415_100056171
474 Ga0373941_0012706
475 Ga0316582_0031484
476 Ga0316582_0050020
477 Ga0316584_0072445
478 Ga0395899_0082198
479 Ga0395905_0007974
480 Ga0395905_0108020
481 Ga0395901_0004554
482 Ga0439448_0012536
483 Ga0450910_002534
484 Ga0451577_0003124
485 Ga0453683_0031212
486 Ga0453684_0333460
487 Ga0451576_0120922
488 Ga0495580_0125562
489 Ga0495582_0033954
490 Ga0495639_0054102
491 Ga0495662_0082238
492 Ga0495664_0110899
493 Ga0495594_0028181
494 Ga0495666_0003575
495 Ga0495640_0005351
496 Ga0495586_0004083
497 Ga0495634_0040838
498 Ga0495658_0012624
499 Ga0495624_0044971
500 Ga0495674_0086259
501 Ga0495676_0143967
502 Ga0495680_0108978
503 Ga0496101_0215952
504 Ga0496101_0297370
505 Ga0496102_0006173
506 Ga0496102_0236908
507 Ga0496103_0010278
508 Ga0496104_0009142
509 Ga0496105_0031831
510 Ga0496106_0012568
511 Ga0496106_0173592
512 Ga0496107_0076351
513 Ga0496108_0000253
514 Ga0496108_0006392
515 Ga0496108_0021189
516 Ga0496108_0027711
517 Ga0496109_0001579
518 Ga0496109_0004150
519 Ga0496109_0022112
520 Ga0496109_0119081
521 Ga0496110_0018793
522 Ga0496110_0129777
523 Ga0496111_0012967
524 Ga0496111_0022108
525 Ga0496111_0027493
526 Ga0496112_0000074
527 Ga0496112_0001634
528 Ga0496112_0039214
529 Ga0496112_0127431
530 Ga0496113_0032015
531 Ga0496114_0012334
532 Ga0496115_0010733
533 Ga0501033_0122575
534 Ga0501034_0003068
535 Ga0501034_0260033
536 Ga0501036_0081554
537 Ga0501036_0126617
538 Ga0501039_0163843
539 Ga0501040_0031007
540 Ga0501040_0046702
541 Ga0501040_0049636
542 Ga0501040_0197925
543 Ga0501041_0009422
544 Ga0501041_0023486
545 Ga0501042_0049919
546 Ga0501042_0088131
547 Ga0501046_0034266
548 Ga0501047_0104830
549 Ga0501048_0065928
550 Ga0501048_0167124
551 Ga0501067_0006122
552 Ga0501067_0034924
553 Ga0501067_0037892
554 Ga0501068_0000704
555 Ga0501068_0001076
556 Ga0501069_0001537
557 Ga0501069_0002393
558 Ga0501069_0088434
559 Ga0501070_0002262
560 Ga0501070_0003610
561 Ga0501070_0194579
562 Ga0501071_0000890
563 Ga0501071_0001725
564 Ga0501071_0069468
565 Ga0501072_0008191
566 Ga0501072_0054291
567 Ga0501073_0004504
568 Ga0501073_0011415
569 Ga0501074_0000166
570 Ga0501074_0004801
571 Ga0501074_0085331
572 Ga0501074_0110809
573 Ga0501075_0014165
574 Ga0501075_0039070
575 Ga0501075_0076916
576 Ga0501076_0013926
577 Ga0501076_0082549
578 Ga0501077_0001741
579 Ga0501249_008914
580 Ga0501258_001336
581 Ga0501229_002598
582 Ga0501079_0009840
583 Ga0501079_0013747
584 Ga0501080_0020963
585 Ga0501080_0032944
586 Ga0501080_0037649
587 Ga0501080_0201604
588 Ga0501081_0019391
589 Ga0501081_0091258
590 Ga0501081_0103561
591 Ga0501083_0002113
592 Ga0501083_0010358
593 Ga0501267_004032
594 Ga0501272_000569
595 nmdc:mga05p37_13271_c1
596 nmdc:mga05p37_152967_c1
597 nmdc:mga05p37_155004_c1
598 nmdc:mga09592_1153_c1
599 nmdc:mga06r32_1200_c1
600 nmdc:mga06r32_149362_c1
601 nmdc:mga06r32_401417_c1
602 nmdc:mga08y16_235798_c1
603 nmdc:mga0n895_10697_c1
604 nmdc:mga0n895_217586_c1
605 nmdc:mga0n895_221276_c1
606 nmdc:mga0n895_345086_c1
607 nmdc:mga0a205_22579_c1
608 nmdc:mga0a205_58516_c1
609 Ga0501084_0000647
610 Ga0501084_0001837
611 Ga0501084_0046581
612 Ga0501084_0074409
613 Ga0590071_014509
614 Ga0501082_0010624
615 Ga0501082_0018670
616 Ga0501082_0019557
617 Ga0501082_0035778
618 Ga0501082_0043409
619 Ga0501082_0058845
620 Ga0501082_0216869
621 Ga0530510_0021722
622 Ga0530510_0059193
623 Ga0530510_0099802
624 Ga0530510_0231075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3la0-assembly2.cif.gz_B crystal structure of uree from helicobacter pylori (metal of unknown identity bound) 0.7401 32 96
3tj8-assembly1.cif.gz_A crystal structure of helicobacter pylori uree bound to ni2+ 0.7096 32 92
6xeh-assembly1.cif.gz_A solution nmr structure of de novo designed rossmann 2x3 fold protein r2x3_168, northeast structural genomics consortium (nesg) target or386 0.6806 121 234
1gmu-assembly3.cif.gz_C structure of uree 0.6476 29 92
7e1b-assembly2.cif.gz_G crystal structure of vbrr-dna complex 0.6307 119 169
ID Description Score Start End Superfamily
af_Q2G2K8_76_149_3.30.70.790 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.6984 28 95 3.30.70.790
3ny0C02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;UreE, C-terminal domain 0.6857 32 92 3.30.70.790
af_Q4DUM3_2_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6453 123 152 3.40.30.10
5ljiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.6313 122 234 3.40.50.360
af_Q57908_264_436_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.622 198 238 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7X9PTZ0-F1-model_v4 deleted 0.9648 38 160
AF-A0A519RZM5-F1-model_v4 Asparagine synthetase B 0.9606 38 287
AF-A0A5D0IQ93-F1-model_v4 Asparagine synthetase B 0.956 116 251
AF-A0A382NKH8-F1-model_v4 Asparagine synthetase domain-containing protein 0.9483 38 221
AF-A0A519RZM5-F1-model_v4 Asparagine synthetase B 0.9459 38 287

Map