F401557
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 312 | 191 | 312 | 117 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100264475|Ga0068868_1002644752 |
| Length | 127 |
| Sequence | MRVWQHARMDAGLIVVPPGKGHRVGNVEFLARSADTPRFTFGIIEIVPGRVLESHVHAGEDDAFYILEGEMTFTSGDRTVRAPPGTFVLAPEGVQHGFRNDGDVPVRMLNLHAPAGFDLRIGLPPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 145 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 146 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 147 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 148 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 149 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 150 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 167 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 170 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 179 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 180 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 181 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 182 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 189 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 190 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 191 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.68 |
| Metatranscriptomes | 0.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 92.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F6ESG4R02HPQQC | 2088090002 | Bacteria | 507 |
| 2 | rootL2_10026344 | 3300003322 | Bacteria | 2869 |
| 3 | JGI25407J50210_10016686 | 3300003373 | Bacteria | 1903 |
| 4 | Ga0070683_101033983 | 3300005329 | Bacteria | 789 |
| 5 | Ga0068869_100371828 | 3300005334 | Bacteria | 1170 |
| 6 | Ga0070680_100002138 | 3300005336 | Bacteria | 14605 |
| 7 | Ga0070682_100057628 | 3300005337 | Bacteria | 2448 |
| 8 | Ga0070682_100978539 | 3300005337 | Bacteria | 701 |
| 9 | Ga0068868_100016665 | 3300005338 | Bacteria | 5463 |
| 10 | Ga0068868_100056117 | 3300005338 | Bacteria | 3109 |
| 11 | Ga0068868_100183818 | 3300005338 | Bacteria | 1735 |
| 12 | Ga0068868_100264475 | 3300005338 | Bacteria | 1452 |
| 13 | Ga0068868_100377654 | 3300005338 | Bacteria | 1219 |
| 14 | Ga0070660_101523399 | 3300005339 | Bacteria | 569 |
| 15 | Ga0070689_100309316 | 3300005340 | Bacteria | 1317 |
| 16 | Ga0070689_100627996 | 3300005340 | Bacteria | 933 |
| 17 | Ga0070691_10021422 | 3300005341 | Bacteria | 2991 |
| 18 | Ga0070661_100413118 | 3300005344 | Bacteria | 1069 |
| 19 | Ga0070661_101054732 | 3300005344 | Bacteria | 676 |
| 20 | Ga0070692_10094898 | 3300005345 | Bacteria | 1627 |
| 21 | Ga0070692_10127545 | 3300005345 | Unclassified | 1426 |
| 22 | Ga0070692_10159838 | 3300005345 | Bacteria | 1290 |
| 23 | Ga0070692_10404059 | 3300005345 | Bacteria | 863 |
| 24 | Ga0070668_100951128 | 3300005347 | Bacteria | 770 |
| 25 | Ga0070669_100165783 | 3300005353 | Bacteria | 1720 |
| 26 | Ga0070671_101828312 | 3300005355 | Bacteria | 540 |
| 27 | Ga0070673_100951664 | 3300005364 | Bacteria | 798 |
| 28 | Ga0070659_100023334 | 3300005366 | Bacteria | 4733 |
| 29 | Ga0070659_100072204 | 3300005366 | Bacteria | 2746 |
| 30 | Ga0070700_100166086 | 3300005441 | Bacteria | 1524 |
| 31 | Ga0070694_101006616 | 3300005444 | Bacteria | 692 |
| 32 | Ga0070663_100086929 | 3300005455 | Bacteria | 2310 |
| 33 | Ga0070663_101155835 | 3300005455 | Bacteria | 679 |
| 34 | Ga0070678_100383170 | 3300005456 | Bacteria | 1217 |
| 35 | Ga0070662_100249707 | 3300005457 | Bacteria | 1426 |
| 36 | Ga0070681_10271795 | 3300005458 | Bacteria | 1606 |
| 37 | Ga0070681_12032437 | 3300005458 | Unclassified | 503 |
| 38 | Ga0068867_100447395 | 3300005459 | Bacteria | 1100 |
| 39 | Ga0070685_10303913 | 3300005466 | Bacteria | 1076 |
| 40 | Ga0070685_10761168 | 3300005466 | Bacteria | 711 |
| 41 | Ga0070685_10948260 | 3300005466 | Bacteria | 643 |
| 42 | Ga0070707_100205994 | 3300005468 | Bacteria | 1917 |
| 43 | Ga0070698_100067052 | 3300005471 | Bacteria | 3610 |
| 44 | Ga0070699_100064957 | 3300005518 | Bacteria | 3166 |
| 45 | Ga0070684_100020878 | 3300005535 | Bacteria | 5436 |
| 46 | Ga0070684_100212385 | 3300005535 | Bacteria | 1764 |
| 47 | Ga0070684_100463433 | 3300005535 | Bacteria | 1172 |
| 48 | Ga0068853_101385560 | 3300005539 | Bacteria | 680 |
| 49 | Ga0070672_100874107 | 3300005543 | Bacteria | 793 |
| 50 | Ga0070686_100271378 | 3300005544 | Unclassified | 1247 |
| 51 | Ga0070704_100376756 | 3300005549 | Bacteria | 1204 |
| 52 | Ga0068855_100211362 | 3300005563 | Unclassified | 2180 |
| 53 | Ga0070664_100074866 | 3300005564 | Bacteria | 2906 |
| 54 | Ga0070664_100167131 | 3300005564 | Bacteria | 1949 |
| 55 | Ga0070664_100260380 | 3300005564 | Bacteria | 1561 |
| 56 | Ga0070664_101657454 | 3300005564 | Bacteria | 606 |
| 57 | Ga0068854_100257648 | 3300005578 | Bacteria | 1396 |
| 58 | Ga0068854_100827991 | 3300005578 | Bacteria | 809 |
| 59 | Ga0068854_100942799 | 3300005578 | Bacteria | 761 |
| 60 | Ga0068856_100266460 | 3300005614 | Bacteria | 1729 |
| 61 | Ga0070702_100015965 | 3300005615 | Bacteria | 3846 |
| 62 | Ga0070702_100862308 | 3300005615 | Bacteria | 706 |
| 63 | Ga0068852_100199108 | 3300005616 | Bacteria | 1895 |
| 64 | Ga0068852_100510097 | 3300005616 | Bacteria | 1199 |
| 65 | Ga0068859_100223734 | 3300005617 | Bacteria | 1970 |
| 66 | Ga0068859_102851758 | 3300005617 | Bacteria | 530 |
| 67 | Ga0068864_100093366 | 3300005618 | Bacteria | 2658 |
| 68 | Ga0068864_100993867 | 3300005618 | Bacteria | 832 |
| 69 | Ga0068864_101822888 | 3300005618 | Bacteria | 614 |
| 70 | Ga0068866_10020041 | 3300005718 | Bacteria | 3057 |
| 71 | Ga0068866_10718280 | 3300005718 | Bacteria | 687 |
| 72 | Ga0068861_100027140 | 3300005719 | Bacteria | 4168 |
| 73 | Ga0068861_101881577 | 3300005719 | Bacteria | 595 |
| 74 | Ga0068851_10195038 | 3300005834 | Bacteria | 1128 |
| 75 | Ga0068851_10276990 | 3300005834 | Bacteria | 958 |
| 76 | Ga0068851_10925877 | 3300005834 | Bacteria | 547 |
| 77 | Ga0068863_100084822 | 3300005841 | Unclassified | 3002 |
| 78 | Ga0068863_102519351 | 3300005841 | Bacteria | 524 |
| 79 | Ga0068858_101056671 | 3300005842 | Bacteria | 796 |
| 80 | Ga0068862_100373860 | 3300005844 | Bacteria | 1327 |
| 81 | Ga0068862_101883802 | 3300005844 | Unclassified | 608 |
| 82 | Ga0081455_10654068 | 3300005937 | Unclassified | 676 |
| 83 | Ga0081538_10002012 | 3300005981 | Bacteria | 20319 |
| 84 | Ga0081539_10193278 | 3300005985 | Bacteria | 946 |
| 85 | Ga0075365_10123711 | 3300006038 | Bacteria | 1786 |
| 86 | Ga0075365_10938739 | 3300006038 | Bacteria | 610 |
| 87 | Ga0075364_10085171 | 3300006051 | Bacteria | 2093 |
| 88 | Ga0075432_10224079 | 3300006058 | Unclassified | 753 |
| 89 | Ga0070712_100038776 | 3300006175 | Bacteria | 3258 |
| 90 | Ga0075431_100004212 | 3300006847 | Bacteria | 14081 |
| 91 | Ga0075433_10267782 | 3300006852 | Bacteria | 1514 |
| 92 | Ga0075433_10764295 | 3300006852 | Bacteria | 845 |
| 93 | Ga0075434_100049372 | 3300006871 | Bacteria | 4178 |
| 94 | Ga0075429_100302960 | 3300006880 | Bacteria | 1399 |
| 95 | Ga0068865_100056884 | 3300006881 | Bacteria | 2726 |
| 96 | Ga0068865_100259286 | 3300006881 | Bacteria | 1376 |
| 97 | Ga0068865_100308518 | 3300006881 | Bacteria | 1269 |
| 98 | Ga0097620_100223739 | 3300006931 | Bacteria | 1970 |
| 99 | Ga0097620_102850200 | 3300006931 | Bacteria | 530 |
| 100 | Ga0075435_100055368 | 3300007076 | Bacteria | 3203 |
| 101 | Ga0075435_100136907 | 3300007076 | Bacteria | 2052 |
| 102 | Ga0105240_10252581 | 3300009093 | Bacteria | 2038 |
| 103 | Ga0105240_11148629 | 3300009093 | Bacteria | 824 |
| 104 | Ga0111539_10006799 | 3300009094 | Bacteria | 14713 |
| 105 | Ga0111539_10173087 | 3300009094 | Unclassified | 2522 |
| 106 | Ga0111539_10244158 | 3300009094 | Bacteria | 2091 |
| 107 | Ga0111539_10547531 | 3300009094 | Bacteria | 1348 |
| 108 | Ga0111539_11893744 | 3300009094 | Bacteria | 691 |
| 109 | Ga0111539_12947806 | 3300009094 | Unclassified | 550 |
| 110 | Ga0105245_10014855 | 3300009098 | Bacteria | 6782 |
| 111 | Ga0105245_10367184 | 3300009098 | Bacteria | 1430 |
| 112 | Ga0105245_11252783 | 3300009098 | Bacteria | 790 |
| 113 | Ga0105245_11612548 | 3300009098 | Bacteria | 701 |
| 114 | Ga0105245_12311289 | 3300009098 | Bacteria | 591 |
| 115 | Ga0105247_10259511 | 3300009101 | Bacteria | 1191 |
| 116 | Ga0114129_10016828 | 3300009147 | Bacteria | 10410 |
| 117 | Ga0114129_11402296 | 3300009147 | Bacteria | 862 |
| 118 | Ga0114129_12605565 | 3300009147 | Bacteria | 603 |
| 119 | Ga0105243_10057292 | 3300009148 | Bacteria | 3102 |
| 120 | Ga0105243_10842200 | 3300009148 | Bacteria | 907 |
| 121 | Ga0105243_10953872 | 3300009148 | Bacteria | 857 |
| 122 | Ga0105243_13116363 | 3300009148 | Bacteria | 502 |
| 123 | Ga0105242_10991382 | 3300009176 | Bacteria | 847 |
| 124 | Ga0105248_10210756 | 3300009177 | Unclassified | 2189 |
| 125 | Ga0105237_10246105 | 3300009545 | Bacteria | 1790 |
| 126 | Ga0105238_10051452 | 3300009551 | Bacteria | 4143 |
| 127 | Ga0105238_10472793 | 3300009551 | Unclassified | 1252 |
| 128 | Ga0105249_10101794 | 3300009553 | Bacteria | 2702 |
| 129 | Ga0105249_11898498 | 3300009553 | Bacteria | 668 |
| 130 | Ga0105239_10574567 | 3300010375 | Bacteria | 1285 |
| 131 | Ga0105246_10044847 | 3300011119 | Bacteria | 3007 |
| 132 | Ga0157370_10014384 | 3300013104 | Bacteria | 8092 |
| 133 | Ga0157374_10959970 | 3300013296 | Bacteria | 873 |
| 134 | Ga0157378_10492739 | 3300013297 | Bacteria | 1223 |
| 135 | Ga0157378_11820842 | 3300013297 | Unclassified | 657 |
| 136 | Ga0157378_12056495 | 3300013297 | Bacteria | 621 |
| 137 | Ga0157372_10087629 | 3300013307 | Bacteria | 3532 |
| 138 | Ga0157372_10671554 | 3300013307 | Bacteria | 1206 |
| 139 | Ga0157372_11267825 | 3300013307 | Bacteria | 851 |
| 140 | Ga0157372_13071204 | 3300013307 | Bacteria | 533 |
| 141 | Ga0157375_10015012 | 3300013308 | Bacteria | 6928 |
| 142 | Ga0157375_10069748 | 3300013308 | Bacteria | 3522 |
| 143 | Ga0157375_10758583 | 3300013308 | Bacteria | 1121 |
| 144 | Ga0157375_10960909 | 3300013308 | Bacteria | 996 |
| 145 | Ga0163163_10497643 | 3300014325 | Bacteria | 1281 |
| 146 | Ga0163163_12207914 | 3300014325 | Unclassified | 610 |
| 147 | Ga0157380_10209859 | 3300014326 | Unclassified | 1734 |
| 148 | Ga0157380_10370201 | 3300014326 | Bacteria | 1348 |
| 149 | Ga0157377_10017886 | 3300014745 | Bacteria | 3676 |
| 150 | Ga0157377_10068406 | 3300014745 | Bacteria | 2046 |
| 151 | Ga0157377_10082851 | 3300014745 | Bacteria | 1878 |
| 152 | Ga0157379_10507621 | 3300014968 | Bacteria | 1118 |
| 153 | Ga0157379_10540361 | 3300014968 | Bacteria | 1083 |
| 154 | Ga0224712_10085670 | 3300022467 | Bacteria | 1310 |
| 155 | Ga0207642_10130910 | 3300025899 | Bacteria | 1309 |
| 156 | Ga0207642_10188691 | 3300025899 | Bacteria | 1129 |
| 157 | Ga0207688_10054537 | 3300025901 | Bacteria | 2243 |
| 158 | Ga0207643_10929127 | 3300025908 | Bacteria | 563 |
| 159 | Ga0207654_10410951 | 3300025911 | Unclassified | 943 |
| 160 | Ga0207707_10043296 | 3300025912 | Bacteria | 3927 |
| 161 | Ga0207695_10284513 | 3300025913 | Bacteria | 1547 |
| 162 | Ga0207693_10396866 | 3300025915 | Unclassified | 1078 |
| 163 | Ga0207660_10018987 | 3300025917 | Bacteria | 4592 |
| 164 | Ga0207662_10017159 | 3300025918 | Bacteria | 4093 |
| 165 | Ga0207662_10116225 | 3300025918 | Bacteria | 1673 |
| 166 | Ga0207657_10010006 | 3300025919 | Bacteria | 9488 |
| 167 | Ga0207649_10321967 | 3300025920 | Bacteria | 1136 |
| 168 | Ga0207652_10049112 | 3300025921 | Bacteria | 3610 |
| 169 | Ga0207681_10062312 | 3300025923 | Bacteria | 2568 |
| 170 | Ga0207694_10035149 | 3300025924 | Bacteria | 3844 |
| 171 | Ga0207650_10717320 | 3300025925 | Bacteria | 845 |
| 172 | Ga0207687_10059876 | 3300025927 | Bacteria | 2684 |
| 173 | Ga0207687_10386230 | 3300025927 | Bacteria | 1148 |
| 174 | Ga0207687_10469028 | 3300025927 | Bacteria | 1047 |
| 175 | Ga0207687_10977578 | 3300025927 | Bacteria | 726 |
| 176 | Ga0207690_10354977 | 3300025932 | Bacteria | 1160 |
| 177 | Ga0207690_10375916 | 3300025932 | Bacteria | 1128 |
| 178 | Ga0207690_11322296 | 3300025932 | Unclassified | 602 |
| 179 | Ga0207706_10203248 | 3300025933 | Bacteria | 1737 |
| 180 | Ga0207706_10219296 | 3300025933 | Bacteria | 1666 |
| 181 | Ga0207686_10096420 | 3300025934 | Bacteria | 1965 |
| 182 | Ga0207709_10367173 | 3300025935 | Bacteria | 1091 |
| 183 | Ga0207670_10401679 | 3300025936 | Bacteria | 1096 |
| 184 | Ga0207670_10594215 | 3300025936 | Bacteria | 908 |
| 185 | Ga0207704_10150406 | 3300025938 | Bacteria | 1642 |
| 186 | Ga0207711_10363252 | 3300025941 | Bacteria | 1341 |
| 187 | Ga0207689_10190480 | 3300025942 | Bacteria | 1692 |
| 188 | Ga0207689_10335648 | 3300025942 | Bacteria | 1255 |
| 189 | Ga0207661_10011837 | 3300025944 | Bacteria | 6335 |
| 190 | Ga0207679_10149655 | 3300025945 | Bacteria | 1898 |
| 191 | Ga0207679_10356945 | 3300025945 | Bacteria | 1276 |
| 192 | Ga0207679_11403643 | 3300025945 | Unclassified | 641 |
| 193 | Ga0207712_10058344 | 3300025961 | Bacteria | 2727 |
| 194 | Ga0207640_10709704 | 3300025981 | Bacteria | 863 |
| 195 | Ga0207640_10746268 | 3300025981 | Bacteria | 843 |
| 196 | Ga0207658_10957079 | 3300025986 | Bacteria | 781 |
| 197 | Ga0207677_10106767 | 3300026023 | Bacteria | 2075 |
| 198 | Ga0207677_10143429 | 3300026023 | Bacteria | 1832 |
| 199 | Ga0207677_10787422 | 3300026023 | Bacteria | 850 |
| 200 | Ga0207677_11220815 | 3300026023 | Bacteria | 689 |
| 201 | Ga0207677_11487688 | 3300026023 | Bacteria | 625 |
| 202 | Ga0207639_10860634 | 3300026041 | Bacteria | 846 |
| 203 | Ga0207678_10218425 | 3300026067 | Bacteria | 1631 |
| 204 | Ga0207678_10323106 | 3300026067 | Bacteria | 1328 |
| 205 | Ga0207678_10405828 | 3300026067 | Unclassified | 1180 |
| 206 | Ga0207678_10494734 | 3300026067 | Bacteria | 1065 |
| 207 | Ga0207708_10013156 | 3300026075 | Bacteria | 6175 |
| 208 | Ga0207702_10053204 | 3300026078 | Bacteria | 3427 |
| 209 | Ga0207702_10340050 | 3300026078 | Bacteria | 1434 |
| 210 | Ga0207702_10997380 | 3300026078 | Bacteria | 831 |
| 211 | Ga0207702_12437302 | 3300026078 | Bacteria | 510 |
| 212 | Ga0207641_10080334 | 3300026088 | Unclassified | 2829 |
| 213 | Ga0207648_10291218 | 3300026089 | Bacteria | 1462 |
| 214 | Ga0207648_10443606 | 3300026089 | Bacteria | 1181 |
| 215 | Ga0207648_10666640 | 3300026089 | Bacteria | 962 |
| 216 | Ga0207676_10727768 | 3300026095 | Bacteria | 963 |
| 217 | Ga0207674_10780812 | 3300026116 | Unclassified | 922 |
| 218 | Ga0207675_100793786 | 3300026118 | Unclassified | 960 |
| 219 | Ga0207683_10356870 | 3300026121 | Bacteria | 1342 |
| 220 | Ga0207698_10668540 | 3300026142 | Bacteria | 1031 |
| 221 | Ga0207698_10933278 | 3300026142 | Bacteria | 876 |
| 222 | Ga0207698_11130218 | 3300026142 | Bacteria | 796 |
| 223 | Ga0207698_11252025 | 3300026142 | Bacteria | 756 |
| 224 | Ga0207428_10025745 | 3300027907 | Bacteria | 4920 |
| 225 | Ga0207428_10177430 | 3300027907 | Unclassified | 1611 |
| 226 | Ga0207428_10918415 | 3300027907 | Bacteria | 618 |
| 227 | Ga0268265_10256850 | 3300028380 | Bacteria | 1551 |
| 228 | Ga0268265_11823414 | 3300028380 | Unclassified | 615 |
| 229 | Ga0307408_100550745 | 3300031548 | Bacteria | 1018 |
| 230 | Ga0307405_10602891 | 3300031731 | Bacteria | 896 |
| 231 | Ga0307413_10713292 | 3300031824 | Bacteria | 834 |
| 232 | Ga0307410_10404797 | 3300031852 | Bacteria | 1103 |
| 233 | Ga0307410_10964940 | 3300031852 | Bacteria | 733 |
| 234 | Ga0307406_10075615 | 3300031901 | Bacteria | 2222 |
| 235 | Ga0307406_10233951 | 3300031901 | Bacteria | 1374 |
| 236 | Ga0307406_10241846 | 3300031901 | Bacteria | 1354 |
| 237 | Ga0307406_10321097 | 3300031901 | Bacteria | 1198 |
| 238 | Ga0307407_10036295 | 3300031903 | Bacteria | 2715 |
| 239 | Ga0307412_10051243 | 3300031911 | Bacteria | 2727 |
| 240 | Ga0307409_100117814 | 3300031995 | Bacteria | 2242 |
| 241 | Ga0307409_100560120 | 3300031995 | Bacteria | 1123 |
| 242 | Ga0307409_100667800 | 3300031995 | Unclassified | 1035 |
| 243 | Ga0307409_101367667 | 3300031995 | Bacteria | 734 |
| 244 | Ga0307416_100031632 | 3300032002 | Bacteria | 3986 |
| 245 | Ga0307414_10205996 | 3300032004 | Bacteria | 1604 |
| 246 | Ga0307411_10030739 | 3300032005 | Bacteria | 3296 |
| 247 | Ga0307411_10365388 | 3300032005 | Unclassified | 1182 |
| 248 | Ga0307411_11000052 | 3300032005 | Bacteria | 749 |
| 249 | Ga0307411_11550540 | 3300032005 | Bacteria | 610 |
| 250 | Ga0395898_1068573 | 3300037466 | Bacteria | 741 |
| 251 | Ga0395901_0268017 | 3300038443 | Bacteria | 1777 |
| 252 | Ga0439447_044405 | 3300041407 | Bacteria | 1075 |
| 253 | Ga0439461_0112893 | 3300041410 | Bacteria | 672 |
| 254 | Ga0439461_0233041 | 3300041410 | Bacteria | 506 |
| 255 | Ga0439465_0165308 | 3300041413 | Bacteria | 795 |
| 256 | Ga0451833_1257202 | 3300041491 | Bacteria | 597 |
| 257 | Ga0451855_1523054 | 3300041511 | Bacteria | 586 |
| 258 | Ga0451853_1611964 | 3300041512 | Bacteria | 608 |
| 259 | Ga0439433_0147392 | 3300041999 | Bacteria | 604 |
| 260 | Ga0450907_003500 | 3300042146 | Bacteria | 2796 |
| 261 | Ga0439446_0109632 | 3300042156 | Bacteria | 879 |
| 262 | Ga0466961_0193848 | 3300044693 | Bacteria | 1259 |
| 263 | Ga0466963_0146480 | 3300044694 | Bacteria | 1639 |
| 264 | Ga0466963_0246653 | 3300044694 | Bacteria | 1253 |
| 265 | Ga0466970_0078911 | 3300044765 | Bacteria | 1777 |
| 266 | Ga0466960_0180930 | 3300044901 | Bacteria | 1143 |
| 267 | Ga0466960_0297071 | 3300044901 | Unclassified | 909 |
| 268 | Ga0466958_0320760 | 3300045836 | Bacteria | 996 |
| 269 | Ga0466967_0164073 | 3300045976 | Bacteria | 2087 |
| 270 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 271 | Ga0495605_0404431 | 3300046474 | Unclassified | 567 |
| 272 | Ga0495610_0360094 | 3300046512 | Bacteria | 546 |
| 273 | Ga0495643_0271958 | 3300046522 | Bacteria | 783 |
| 274 | Ga0495668_0332295 | 3300046616 | Bacteria | 834 |
| 275 | Ga0495659_0205421 | 3300046664 | Bacteria | 809 |
| 276 | Ga0495626_0333983 | 3300048091 | Bacteria | 594 |
| 277 | Ga0496100_0462031 | 3300048903 | Bacteria | 974 |
| 278 | Ga0496102_0305268 | 3300048905 | Bacteria | 1500 |
| 279 | Ga0496107_0141492 | 3300048910 | Bacteria | 1778 |
| 280 | Ga0496108_0715535 | 3300048911 | Bacteria | 868 |
| 281 | Ga0496109_1040447 | 3300048912 | Bacteria | 756 |
| 282 | Ga0496109_1428720 | 3300048912 | Bacteria | 627 |
| 283 | Ga0496110_0174425 | 3300048913 | Unclassified | 1951 |
| 284 | Ga0496111_0288160 | 3300048914 | Bacteria | 1218 |
| 285 | Ga0496113_0552506 | 3300048916 | Unclassified | 923 |
| 286 | Ga0496114_0147452 | 3300048917 | Bacteria | 2040 |
| 287 | Ga0501048_0492749 | 3300049582 | Unclassified | 879 |
| 288 | Ga0501069_0218242 | 3300049585 | Bacteria | 1108 |
| 289 | Ga0501071_0364561 | 3300049587 | Unclassified | 1101 |
| 290 | Ga0501075_0293862 | 3300049591 | Bacteria | 1238 |
| 291 | Ga0501077_0793371 | 3300049593 | Unclassified | 609 |
| 292 | Ga0501209_156477 | 3300049656 | Bacteria | 688 |
| 293 | nmdc:mga03n38_757825_c1 | 3300050490 | Bacteria | 563 |
| 294 | nmdc:mga00v17_404338_c1 | 3300050491 | Unclassified | 887 |
| 295 | nmdc:mga0yw44_3453_c1 | 3300050492 | Bacteria | 7017 |
| 296 | nmdc:mga0yw44_352044_c1 | 3300050492 | Bacteria | 991 |
| 297 | nmdc:mga09592_290233_c1 | 3300050508 | Bacteria | 1418 |
| 298 | nmdc:mga06r32_6524_c1 | 3300050510 | Bacteria | 10484 |
| 299 | nmdc:mga08y16_1165026_c1 | 3300050511 | Bacteria | 743 |
| 300 | nmdc:mga08y16_142697_c1 | 3300050511 | Unclassified | 2490 |
| 301 | nmdc:mga08y16_231196_c1 | 3300050511 | Bacteria | 1912 |
| 302 | nmdc:mga08y16_4772_c1 | 3300050511 | Bacteria | 14144 |
| 303 | nmdc:mga08y16_631418_c1 | 3300050511 | Bacteria | 1077 |
| 304 | nmdc:mga0n895_4179_c1 | 3300050512 | Bacteria | 11792 |
| 305 | nmdc:mga0rr50_209745_c1 | 3300050513 | Bacteria | 1604 |
| 306 | nmdc:mga0rr50_55959_c1 | 3300050513 | Bacteria | 2945 |
| 307 | nmdc:mga0a205_177652_c1 | 3300050515 | Bacteria | 2024 |
| 308 | nmdc:mga0a205_658055_c1 | 3300050515 | Bacteria | 899 |
| 309 | Ga0500572_305844 | 3300053111 | Bacteria | 511 |
| 310 | Ga0590071_020594 | 3300059421 | Bacteria | 1553 |
| 311 | Ga0590074_040247 | 3300059423 | Bacteria | 840 |
| 312 | Ga0590077_040660 | 3300059426 | Bacteria | 1032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050491 | nmdc:mga00v17_404338_c1 | nmdc:mga00v17_404338_c1_561_869 | 86 |
| 2 | 3300050492 | nmdc:mga0yw44_3453_c1 | nmdc:mga0yw44_3453_c1_5923_6231 | 86 |
| 3 | 3300005344 | Ga0070661_101054732 | Ga0070661_1010547322 | 98 |
| 4 | 3300014968 | Ga0157379_10540361 | Ga0157379_105403613 | 98 |
| 5 | 3300026078 | Ga0207702_12437302 | Ga0207702_124373021 | 98 |
| 6 | 3300006038 | Ga0075365_10123711 | Ga0075365_101237113 | 100 |
| 7 | 3300006051 | Ga0075364_10085171 | Ga0075364_100851713 | 100 |
| 8 | 3300005334 | Ga0068869_100371828 | Ga0068869_1003718282 | 102 |
| 9 | 3300005338 | Ga0068868_100183818 | Ga0068868_1001838182 | 102 |
| 10 | 3300005339 | Ga0070660_101523399 | Ga0070660_1015233991 | 102 |
| 11 | 3300005340 | Ga0070689_100627996 | Ga0070689_1006279962 | 102 |
| 12 | 3300005353 | Ga0070669_100165783 | Ga0070669_1001657833 | 102 |
| 13 | 3300005366 | Ga0070659_100072204 | Ga0070659_1000722041 | 102 |
| 14 | 3300005578 | Ga0068854_100257648 | Ga0068854_1002576482 | 102 |
| 15 | 3300005615 | Ga0070702_100015965 | Ga0070702_1000159653 | 102 |
| 16 | 3300005616 | Ga0068852_100199108 | Ga0068852_1001991083 | 102 |
| 17 | 3300005719 | Ga0068861_100027140 | Ga0068861_1000271402 | 102 |
| 18 | 3300005842 | Ga0068858_101056671 | Ga0068858_1010566712 | 102 |
| 19 | 3300005844 | Ga0068862_100373860 | Ga0068862_1003738602 | 102 |
| 20 | 3300006881 | Ga0068865_100259286 | Ga0068865_1002592862 | 102 |
| 21 | 3300009093 | Ga0105240_11148629 | Ga0105240_111486291 | 102 |
| 22 | 3300009098 | Ga0105245_11252783 | Ga0105245_112527832 | 102 |
| 23 | 3300010375 | Ga0105239_10574567 | Ga0105239_105745671 | 102 |
| 24 | 3300013296 | Ga0157374_10959970 | Ga0157374_109599702 | 102 |
| 25 | 3300013297 | Ga0157378_10492739 | Ga0157378_104927392 | 102 |
| 26 | 3300013308 | Ga0157375_10069748 | Ga0157375_100697483 | 102 |
| 27 | 3300014326 | Ga0157380_10370201 | Ga0157380_103702012 | 102 |
| 28 | 3300014745 | Ga0157377_10082851 | Ga0157377_100828512 | 102 |
| 29 | 3300025918 | Ga0207662_10116225 | Ga0207662_101162252 | 102 |
| 30 | 3300025923 | Ga0207681_10062312 | Ga0207681_100623125 | 102 |
| 31 | 3300025927 | Ga0207687_10059876 | Ga0207687_100598764 | 102 |
| 32 | 3300025932 | Ga0207690_10354977 | Ga0207690_103549772 | 102 |
| 33 | 3300025933 | Ga0207706_10219296 | Ga0207706_102192962 | 102 |
| 34 | 3300025936 | Ga0207670_10594215 | Ga0207670_105942152 | 102 |
| 35 | 3300025938 | Ga0207704_10150406 | Ga0207704_101504063 | 102 |
| 36 | 3300025942 | Ga0207689_10190480 | Ga0207689_101904802 | 102 |
| 37 | 3300025961 | Ga0207712_10058344 | Ga0207712_100583442 | 102 |
| 38 | 3300026023 | Ga0207677_10787422 | Ga0207677_107874222 | 102 |
| 39 | 3300026089 | Ga0207648_10443606 | Ga0207648_104436063 | 102 |
| 40 | 3300026142 | Ga0207698_10933278 | Ga0207698_109332782 | 102 |
| 41 | 3300028380 | Ga0268265_10256850 | Ga0268265_102568504 | 102 |
| 42 | 3300048903 | Ga0496100_0462031 | Ga0496100_0462031_75_443 | 102 |
| 43 | 3300048910 | Ga0496107_0141492 | Ga0496107_0141492_160_528 | 102 |
| 44 | 3300050511 | nmdc:mga08y16_1165026_c1 | nmdc:mga08y16_1165026_c1_303_671 | 102 |
| 45 | 3300037466 | Ga0395898_1068573 | Ga0395898_1068573_15_362 | 104 |
| 46 | 3300005564 | Ga0070664_100074866 | Ga0070664_1000748664 | 106 |
| 47 | 3300005444 | Ga0070694_101006616 | Ga0070694_1010066161 | 108 |
| 48 | 3300005468 | Ga0070707_100205994 | Ga0070707_1002059943 | 108 |
| 49 | 3300005471 | Ga0070698_100067052 | Ga0070698_1000670521 | 108 |
| 50 | 3300005518 | Ga0070699_100064957 | Ga0070699_1000649573 | 108 |
| 51 | 3300009147 | Ga0114129_12605565 | Ga0114129_126055652 | 108 |
| 52 | 3300025911 | Ga0207654_10410951 | Ga0207654_104109512 | 108 |
| 53 | 3300026142 | Ga0207698_11130218 | Ga0207698_111302182 | 108 |
| 54 | 3300031852 | Ga0307410_10964940 | Ga0307410_109649401 | 108 |
| 55 | 3300031995 | Ga0307409_100117814 | Ga0307409_1001178142 | 108 |
| 56 | 3300032005 | Ga0307411_11550540 | Ga0307411_115505402 | 108 |
| 57 | 3300041410 | Ga0439461_0112893 | Ga0439461_0112893_167_514 | 108 |
| 58 | 3300041410 | Ga0439461_0233041 | Ga0439461_0233041_67_414 | 108 |
| 59 | 3300041413 | Ga0439465_0165308 | Ga0439465_0165308_230_577 | 108 |
| 60 | 3300042146 | Ga0450907_003500 | Ga0450907_003500_2262_2618 | 108 |
| 61 | 3300042156 | Ga0439446_0109632 | Ga0439446_0109632_108_455 | 108 |
| 62 | 3300049582 | Ga0501048_0492749 | Ga0501048_0492749_427_783 | 108 |
| 63 | 3300049591 | Ga0501075_0293862 | Ga0501075_0293862_138_494 | 108 |
| 64 | 3300049593 | Ga0501077_0793371 | Ga0501077_0793371_206_562 | 108 |
| 65 | 3300049656 | Ga0501209_156477 | Ga0501209_156477_30_386 | 108 |
| 66 | 3300059421 | Ga0590071_020594 | Ga0590071_020594_246_596 | 108 |
| 67 | 3300059423 | Ga0590074_040247 | Ga0590074_040247_135_485 | 108 |
| 68 | 3300059426 | Ga0590077_040660 | Ga0590077_040660_410_760 | 108 |
| 69 | 3300005345 | Ga0070692_10404059 | Ga0070692_104040592 | 109 |
| 70 | 3300005347 | Ga0070668_100951128 | Ga0070668_1009511282 | 109 |
| 71 | 3300005364 | Ga0070673_100951664 | Ga0070673_1009516641 | 109 |
| 72 | 3300005455 | Ga0070663_101155835 | Ga0070663_1011558352 | 109 |
| 73 | 3300005457 | Ga0070662_100249707 | Ga0070662_1002497072 | 109 |
| 74 | 3300005564 | Ga0070664_100167131 | Ga0070664_1001671313 | 109 |
| 75 | 3300005578 | Ga0068854_100942799 | Ga0068854_1009427992 | 109 |
| 76 | 3300005985 | Ga0081539_10193278 | Ga0081539_101932782 | 109 |
| 77 | 3300007076 | Ga0075435_100136907 | Ga0075435_1001369072 | 109 |
| 78 | 3300009094 | Ga0111539_10244158 | Ga0111539_102441582 | 109 |
| 79 | 3300009094 | Ga0111539_11893744 | Ga0111539_118937442 | 109 |
| 80 | 3300009094 | Ga0111539_12947806 | Ga0111539_129478061 | 109 |
| 81 | 3300025933 | Ga0207706_10203248 | Ga0207706_102032482 | 109 |
| 82 | 3300025942 | Ga0207689_10335648 | Ga0207689_103356482 | 109 |
| 83 | 3300025945 | Ga0207679_10356945 | Ga0207679_103569452 | 109 |
| 84 | 3300025981 | Ga0207640_10709704 | Ga0207640_107097042 | 109 |
| 85 | 3300026067 | Ga0207678_10494734 | Ga0207678_104947341 | 109 |
| 86 | 3300041407 | Ga0439447_044405 | Ga0439447_044405_68_424 | 109 |
| 87 | 3300041511 | Ga0451855_1523054 | Ga0451855_1523054_98_451 | 109 |
| 88 | 3300041999 | Ga0439433_0147392 | Ga0439433_0147392_145_501 | 109 |
| 89 | 3300045976 | Ga0466967_0164073 | Ga0466967_0164073_551_898 | 109 |
| 90 | 3300046474 | Ga0495605_0404431 | Ga0495605_0404431_156_506 | 109 |
| 91 | 3300048091 | Ga0495626_0333983 | Ga0495626_0333983_41_394 | 109 |
| 92 | 3300048917 | Ga0496114_0147452 | Ga0496114_0147452_978_1334 | 109 |
| 93 | 3300050490 | nmdc:mga03n38_757825_c1 | nmdc:mga03n38_757825_c1_72_425 | 109 |
| 94 | 3300050511 | nmdc:mga08y16_631418_c1 | nmdc:mga08y16_631418_c1_657_1004 | 109 |
| 95 | 3300050513 | nmdc:mga0rr50_209745_c1 | nmdc:mga0rr50_209745_c1_847_1197 | 109 |
| 96 | 2088090002 | CNA_F6ESG4R02HPQQC | CNA_00985120 | 110 |
| 97 | 3300003322 | rootL2_10026344 | rootL2_100263442 | 110 |
| 98 | 3300003373 | JGI25407J50210_10016686 | JGI25407J50210_100166862 | 110 |
| 99 | 3300005329 | Ga0070683_101033983 | Ga0070683_1010339832 | 110 |
| 100 | 3300005336 | Ga0070680_100002138 | Ga0070680_1000021386 | 110 |
| 101 | 3300005337 | Ga0070682_100057628 | Ga0070682_1000576283 | 110 |
| 102 | 3300005337 | Ga0070682_100978539 | Ga0070682_1009785391 | 110 |
| 103 | 3300005338 | Ga0068868_100016665 | Ga0068868_1000166655 | 110 |
| 104 | 3300005338 | Ga0068868_100056117 | Ga0068868_1000561173 | 110 |
| 105 | 3300005338 | Ga0068868_100264475 | Ga0068868_1002644752 | 110 |
| 106 | 3300005338 | Ga0068868_100377654 | Ga0068868_1003776542 | 110 |
| 107 | 3300005340 | Ga0070689_100309316 | Ga0070689_1003093162 | 110 |
| 108 | 3300005341 | Ga0070691_10021422 | Ga0070691_100214222 | 110 |
| 109 | 3300005344 | Ga0070661_100413118 | Ga0070661_1004131182 | 110 |
| 110 | 3300005345 | Ga0070692_10094898 | Ga0070692_100948981 | 110 |
| 111 | 3300005345 | Ga0070692_10127545 | Ga0070692_101275453 | 110 |
| 112 | 3300005345 | Ga0070692_10159838 | Ga0070692_101598382 | 110 |
| 113 | 3300005355 | Ga0070671_101828312 | Ga0070671_1018283121 | 110 |
| 114 | 3300005366 | Ga0070659_100023334 | Ga0070659_1000233344 | 110 |
| 115 | 3300005441 | Ga0070700_100166086 | Ga0070700_1001660863 | 110 |
| 116 | 3300005455 | Ga0070663_100086929 | Ga0070663_1000869292 | 110 |
| 117 | 3300005456 | Ga0070678_100383170 | Ga0070678_1003831702 | 110 |
| 118 | 3300005458 | Ga0070681_10271795 | Ga0070681_102717953 | 110 |
| 119 | 3300005458 | Ga0070681_12032437 | Ga0070681_120324371 | 110 |
| 120 | 3300005459 | Ga0068867_100447395 | Ga0068867_1004473951 | 110 |
| 121 | 3300005466 | Ga0070685_10303913 | Ga0070685_103039132 | 110 |
| 122 | 3300005466 | Ga0070685_10761168 | Ga0070685_107611682 | 110 |
| 123 | 3300005466 | Ga0070685_10948260 | Ga0070685_109482602 | 110 |
| 124 | 3300005535 | Ga0070684_100020878 | Ga0070684_1000208785 | 110 |
| 125 | 3300005535 | Ga0070684_100212385 | Ga0070684_1002123852 | 110 |
| 126 | 3300005535 | Ga0070684_100463433 | Ga0070684_1004634332 | 110 |
| 127 | 3300005539 | Ga0068853_101385560 | Ga0068853_1013855602 | 110 |
| 128 | 3300005543 | Ga0070672_100874107 | Ga0070672_1008741072 | 110 |
| 129 | 3300005544 | Ga0070686_100271378 | Ga0070686_1002713783 | 110 |
| 130 | 3300005549 | Ga0070704_100376756 | Ga0070704_1003767562 | 110 |
| 131 | 3300005563 | Ga0068855_100211362 | Ga0068855_1002113623 | 110 |
| 132 | 3300005564 | Ga0070664_100260380 | Ga0070664_1002603802 | 110 |
| 133 | 3300005564 | Ga0070664_101657454 | Ga0070664_1016574542 | 110 |
| 134 | 3300005578 | Ga0068854_100827991 | Ga0068854_1008279911 | 110 |
| 135 | 3300005614 | Ga0068856_100266460 | Ga0068856_1002664602 | 110 |
| 136 | 3300005615 | Ga0070702_100862308 | Ga0070702_1008623082 | 110 |
| 137 | 3300005616 | Ga0068852_100510097 | Ga0068852_1005100972 | 110 |
| 138 | 3300005617 | Ga0068859_100223734 | Ga0068859_1002237343 | 110 |
| 139 | 3300005617 | Ga0068859_102851758 | Ga0068859_1028517581 | 110 |
| 140 | 3300005618 | Ga0068864_100093366 | Ga0068864_1000933662 | 110 |
| 141 | 3300005618 | Ga0068864_100993867 | Ga0068864_1009938672 | 110 |
| 142 | 3300005618 | Ga0068864_101822888 | Ga0068864_1018228881 | 110 |
| 143 | 3300005718 | Ga0068866_10020041 | Ga0068866_100200413 | 110 |
| 144 | 3300005718 | Ga0068866_10718280 | Ga0068866_107182802 | 110 |
| 145 | 3300005719 | Ga0068861_101881577 | Ga0068861_1018815772 | 110 |
| 146 | 3300005834 | Ga0068851_10195038 | Ga0068851_101950381 | 110 |
| 147 | 3300005834 | Ga0068851_10276990 | Ga0068851_102769902 | 110 |
| 148 | 3300005834 | Ga0068851_10925877 | Ga0068851_109258771 | 110 |
| 149 | 3300005841 | Ga0068863_100084822 | Ga0068863_1000848224 | 110 |
| 150 | 3300005841 | Ga0068863_102519351 | Ga0068863_1025193511 | 110 |
| 151 | 3300005844 | Ga0068862_101883802 | Ga0068862_1018838021 | 110 |
| 152 | 3300005937 | Ga0081455_10654068 | Ga0081455_106540682 | 110 |
| 153 | 3300005981 | Ga0081538_10002012 | Ga0081538_1000201210 | 110 |
| 154 | 3300006038 | Ga0075365_10938739 | Ga0075365_109387392 | 110 |
| 155 | 3300006058 | Ga0075432_10224079 | Ga0075432_102240792 | 110 |
| 156 | 3300006175 | Ga0070712_100038776 | Ga0070712_1000387765 | 110 |
| 157 | 3300006847 | Ga0075431_100004212 | Ga0075431_10000421217 | 110 |
| 158 | 3300006852 | Ga0075433_10267782 | Ga0075433_102677822 | 110 |
| 159 | 3300006852 | Ga0075433_10764295 | Ga0075433_107642952 | 110 |
| 160 | 3300006871 | Ga0075434_100049372 | Ga0075434_1000493724 | 110 |
| 161 | 3300006880 | Ga0075429_100302960 | Ga0075429_1003029602 | 110 |
| 162 | 3300006881 | Ga0068865_100056884 | Ga0068865_1000568843 | 110 |
| 163 | 3300006881 | Ga0068865_100308518 | Ga0068865_1003085182 | 110 |
| 164 | 3300006931 | Ga0097620_100223739 | Ga0097620_1002237393 | 110 |
| 165 | 3300006931 | Ga0097620_102850200 | Ga0097620_1028502001 | 110 |
| 166 | 3300007076 | Ga0075435_100055368 | Ga0075435_1000553682 | 110 |
| 167 | 3300009093 | Ga0105240_10252581 | Ga0105240_102525813 | 110 |
| 168 | 3300009094 | Ga0111539_10006799 | Ga0111539_100067996 | 110 |
| 169 | 3300009094 | Ga0111539_10173087 | Ga0111539_101730872 | 110 |
| 170 | 3300009094 | Ga0111539_10547531 | Ga0111539_105475312 | 110 |
| 171 | 3300009098 | Ga0105245_10014855 | Ga0105245_100148555 | 110 |
| 172 | 3300009098 | Ga0105245_10367184 | Ga0105245_103671842 | 110 |
| 173 | 3300009098 | Ga0105245_11612548 | Ga0105245_116125481 | 110 |
| 174 | 3300009098 | Ga0105245_12311289 | Ga0105245_123112892 | 110 |
| 175 | 3300009101 | Ga0105247_10259511 | Ga0105247_102595112 | 110 |
| 176 | 3300009147 | Ga0114129_10016828 | Ga0114129_100168285 | 110 |
| 177 | 3300009147 | Ga0114129_11402296 | Ga0114129_114022961 | 110 |
| 178 | 3300009148 | Ga0105243_10057292 | Ga0105243_100572923 | 110 |
| 179 | 3300009148 | Ga0105243_10842200 | Ga0105243_108422002 | 110 |
| 180 | 3300009148 | Ga0105243_10953872 | Ga0105243_109538722 | 110 |
| 181 | 3300009148 | Ga0105243_13116363 | Ga0105243_131163632 | 110 |
| 182 | 3300009176 | Ga0105242_10991382 | Ga0105242_109913822 | 110 |
| 183 | 3300009177 | Ga0105248_10210756 | Ga0105248_102107562 | 110 |
| 184 | 3300009545 | Ga0105237_10246105 | Ga0105237_102461052 | 110 |
| 185 | 3300009551 | Ga0105238_10051452 | Ga0105238_100514524 | 110 |
| 186 | 3300009551 | Ga0105238_10472793 | Ga0105238_104727932 | 110 |
| 187 | 3300009553 | Ga0105249_10101794 | Ga0105249_101017941 | 110 |
| 188 | 3300009553 | Ga0105249_11898498 | Ga0105249_118984982 | 110 |
| 189 | 3300011119 | Ga0105246_10044847 | Ga0105246_100448474 | 110 |
| 190 | 3300013104 | Ga0157370_10014384 | Ga0157370_100143847 | 110 |
| 191 | 3300013297 | Ga0157378_11820842 | Ga0157378_118208421 | 110 |
| 192 | 3300013297 | Ga0157378_12056495 | Ga0157378_120564951 | 110 |
| 193 | 3300013307 | Ga0157372_10087629 | Ga0157372_100876294 | 110 |
| 194 | 3300013307 | Ga0157372_10671554 | Ga0157372_106715542 | 110 |
| 195 | 3300013307 | Ga0157372_11267825 | Ga0157372_112678252 | 110 |
| 196 | 3300013307 | Ga0157372_13071204 | Ga0157372_130712041 | 110 |
| 197 | 3300013308 | Ga0157375_10015012 | Ga0157375_100150127 | 110 |
| 198 | 3300013308 | Ga0157375_10758583 | Ga0157375_107585832 | 110 |
| 199 | 3300013308 | Ga0157375_10960909 | Ga0157375_109609092 | 110 |
| 200 | 3300014325 | Ga0163163_10497643 | Ga0163163_104976432 | 110 |
| 201 | 3300014325 | Ga0163163_12207914 | Ga0163163_122079142 | 110 |
| 202 | 3300014326 | Ga0157380_10209859 | Ga0157380_102098592 | 110 |
| 203 | 3300014745 | Ga0157377_10017886 | Ga0157377_100178864 | 110 |
| 204 | 3300014745 | Ga0157377_10068406 | Ga0157377_100684062 | 110 |
| 205 | 3300014968 | Ga0157379_10507621 | Ga0157379_105076212 | 110 |
| 206 | 3300022467 | Ga0224712_10085670 | Ga0224712_100856703 | 110 |
| 207 | 3300025899 | Ga0207642_10130910 | Ga0207642_101309102 | 110 |
| 208 | 3300025899 | Ga0207642_10188691 | Ga0207642_101886912 | 110 |
| 209 | 3300025901 | Ga0207688_10054537 | Ga0207688_100545373 | 110 |
| 210 | 3300025908 | Ga0207643_10929127 | Ga0207643_109291272 | 110 |
| 211 | 3300025912 | Ga0207707_10043296 | Ga0207707_100432963 | 110 |
| 212 | 3300025913 | Ga0207695_10284513 | Ga0207695_102845132 | 110 |
| 213 | 3300025915 | Ga0207693_10396866 | Ga0207693_103968662 | 110 |
| 214 | 3300025917 | Ga0207660_10018987 | Ga0207660_100189874 | 110 |
| 215 | 3300025918 | Ga0207662_10017159 | Ga0207662_100171593 | 110 |
| 216 | 3300025919 | Ga0207657_10010006 | Ga0207657_100100064 | 110 |
| 217 | 3300025920 | Ga0207649_10321967 | Ga0207649_103219672 | 110 |
| 218 | 3300025921 | Ga0207652_10049112 | Ga0207652_100491124 | 110 |
| 219 | 3300025924 | Ga0207694_10035149 | Ga0207694_100351493 | 110 |
| 220 | 3300025925 | Ga0207650_10717320 | Ga0207650_107173201 | 110 |
| 221 | 3300025927 | Ga0207687_10386230 | Ga0207687_103862302 | 110 |
| 222 | 3300025927 | Ga0207687_10469028 | Ga0207687_104690282 | 110 |
| 223 | 3300025927 | Ga0207687_10977578 | Ga0207687_109775782 | 110 |
| 224 | 3300025932 | Ga0207690_10375916 | Ga0207690_103759162 | 110 |
| 225 | 3300025932 | Ga0207690_11322296 | Ga0207690_113222962 | 110 |
| 226 | 3300025934 | Ga0207686_10096420 | Ga0207686_100964202 | 110 |
| 227 | 3300025935 | Ga0207709_10367173 | Ga0207709_103671732 | 110 |
| 228 | 3300025936 | Ga0207670_10401679 | Ga0207670_104016791 | 110 |
| 229 | 3300025941 | Ga0207711_10363252 | Ga0207711_103632522 | 110 |
| 230 | 3300025944 | Ga0207661_10011837 | Ga0207661_100118373 | 110 |
| 231 | 3300025945 | Ga0207679_10149655 | Ga0207679_101496553 | 110 |
| 232 | 3300025945 | Ga0207679_11403643 | Ga0207679_114036431 | 110 |
| 233 | 3300025981 | Ga0207640_10746268 | Ga0207640_107462682 | 110 |
| 234 | 3300025986 | Ga0207658_10957079 | Ga0207658_109570792 | 110 |
| 235 | 3300026023 | Ga0207677_10106767 | Ga0207677_101067672 | 110 |
| 236 | 3300026023 | Ga0207677_10143429 | Ga0207677_101434292 | 110 |
| 237 | 3300026023 | Ga0207677_11220815 | Ga0207677_112208151 | 110 |
| 238 | 3300026023 | Ga0207677_11487688 | Ga0207677_114876882 | 110 |
| 239 | 3300026041 | Ga0207639_10860634 | Ga0207639_108606342 | 110 |
| 240 | 3300026067 | Ga0207678_10218425 | Ga0207678_102184252 | 110 |
| 241 | 3300026067 | Ga0207678_10323106 | Ga0207678_103231062 | 110 |
| 242 | 3300026067 | Ga0207678_10405828 | Ga0207678_104058282 | 110 |
| 243 | 3300026075 | Ga0207708_10013156 | Ga0207708_100131563 | 110 |
| 244 | 3300026078 | Ga0207702_10053204 | Ga0207702_100532044 | 110 |
| 245 | 3300026078 | Ga0207702_10340050 | Ga0207702_103400502 | 110 |
| 246 | 3300026078 | Ga0207702_10997380 | Ga0207702_109973802 | 110 |
| 247 | 3300026088 | Ga0207641_10080334 | Ga0207641_100803343 | 110 |
| 248 | 3300026089 | Ga0207648_10291218 | Ga0207648_102912182 | 110 |
| 249 | 3300026089 | Ga0207648_10666640 | Ga0207648_106666402 | 110 |
| 250 | 3300026095 | Ga0207676_10727768 | Ga0207676_107277682 | 110 |
| 251 | 3300026116 | Ga0207674_10780812 | Ga0207674_107808121 | 110 |
| 252 | 3300026118 | Ga0207675_100793786 | Ga0207675_1007937862 | 110 |
| 253 | 3300026121 | Ga0207683_10356870 | Ga0207683_103568703 | 110 |
| 254 | 3300026142 | Ga0207698_10668540 | Ga0207698_106685402 | 110 |
| 255 | 3300026142 | Ga0207698_11252025 | Ga0207698_112520252 | 110 |
| 256 | 3300027907 | Ga0207428_10025745 | Ga0207428_100257452 | 110 |
| 257 | 3300027907 | Ga0207428_10177430 | Ga0207428_101774302 | 110 |
| 258 | 3300027907 | Ga0207428_10918415 | Ga0207428_109184152 | 110 |
| 259 | 3300028380 | Ga0268265_11823414 | Ga0268265_118234142 | 110 |
| 260 | 3300031548 | Ga0307408_100550745 | Ga0307408_1005507453 | 110 |
| 261 | 3300031731 | Ga0307405_10602891 | Ga0307405_106028912 | 110 |
| 262 | 3300031824 | Ga0307413_10713292 | Ga0307413_107132922 | 110 |
| 263 | 3300031852 | Ga0307410_10404797 | Ga0307410_104047972 | 110 |
| 264 | 3300031901 | Ga0307406_10075615 | Ga0307406_100756152 | 110 |
| 265 | 3300031901 | Ga0307406_10233951 | Ga0307406_102339511 | 110 |
| 266 | 3300031901 | Ga0307406_10241846 | Ga0307406_102418462 | 110 |
| 267 | 3300031901 | Ga0307406_10321097 | Ga0307406_103210973 | 110 |
| 268 | 3300031903 | Ga0307407_10036295 | Ga0307407_100362952 | 110 |
| 269 | 3300031911 | Ga0307412_10051243 | Ga0307412_100512433 | 110 |
| 270 | 3300031995 | Ga0307409_100560120 | Ga0307409_1005601202 | 110 |
| 271 | 3300031995 | Ga0307409_100667800 | Ga0307409_1006678002 | 110 |
| 272 | 3300031995 | Ga0307409_101367667 | Ga0307409_1013676672 | 110 |
| 273 | 3300032002 | Ga0307416_100031632 | Ga0307416_1000316324 | 110 |
| 274 | 3300032004 | Ga0307414_10205996 | Ga0307414_102059962 | 110 |
| 275 | 3300032005 | Ga0307411_10030739 | Ga0307411_100307393 | 110 |
| 276 | 3300032005 | Ga0307411_10365388 | Ga0307411_103653882 | 110 |
| 277 | 3300032005 | Ga0307411_11000052 | Ga0307411_110000521 | 110 |
| 278 | 3300038443 | Ga0395901_0268017 | Ga0395901_0268017_1103_1459 | 110 |
| 279 | 3300041491 | Ga0451833_1257202 | Ga0451833_1257202_21_374 | 110 |
| 280 | 3300041512 | Ga0451853_1611964 | Ga0451853_1611964_236_595 | 110 |
| 281 | 3300044693 | Ga0466961_0193848 | Ga0466961_0193848_774_1124 | 110 |
| 282 | 3300044694 | Ga0466963_0146480 | Ga0466963_0146480_330_683 | 110 |
| 283 | 3300044694 | Ga0466963_0246653 | Ga0466963_0246653_142_492 | 110 |
| 284 | 3300044765 | Ga0466970_0078911 | Ga0466970_0078911_243_593 | 110 |
| 285 | 3300044901 | Ga0466960_0180930 | Ga0466960_0180930_310_660 | 110 |
| 286 | 3300044901 | Ga0466960_0297071 | Ga0466960_0297071_227_583 | 110 |
| 287 | 3300045836 | Ga0466958_0320760 | Ga0466958_0320760_490_840 | 110 |
| 288 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_269097_269459 | 110 |
| 289 | 3300046512 | Ga0495610_0360094 | Ga0495610_0360094_132_488 | 110 |
| 290 | 3300046522 | Ga0495643_0271958 | Ga0495643_0271958_94_450 | 110 |
| 291 | 3300046616 | Ga0495668_0332295 | Ga0495668_0332295_384_740 | 110 |
| 292 | 3300046664 | Ga0495659_0205421 | Ga0495659_0205421_387_758 | 110 |
| 293 | 3300048905 | Ga0496102_0305268 | Ga0496102_0305268_74_457 | 110 |
| 294 | 3300048911 | Ga0496108_0715535 | Ga0496108_0715535_417_773 | 110 |
| 295 | 3300048912 | Ga0496109_1040447 | Ga0496109_1040447_140_496 | 110 |
| 296 | 3300048912 | Ga0496109_1428720 | Ga0496109_1428720_219_602 | 110 |
| 297 | 3300048913 | Ga0496110_0174425 | Ga0496110_0174425_310_663 | 110 |
| 298 | 3300048914 | Ga0496111_0288160 | Ga0496111_0288160_835_1191 | 110 |
| 299 | 3300048916 | Ga0496113_0552506 | Ga0496113_0552506_231_584 | 110 |
| 300 | 3300049585 | Ga0501069_0218242 | Ga0501069_0218242_550_906 | 110 |
| 301 | 3300049587 | Ga0501071_0364561 | Ga0501071_0364561_556_918 | 110 |
| 302 | 3300050492 | nmdc:mga0yw44_352044_c1 | nmdc:mga0yw44_352044_c1_147_503 | 110 |
| 303 | 3300050508 | nmdc:mga09592_290233_c1 | nmdc:mga09592_290233_c1_576_935 | 110 |
| 304 | 3300050510 | nmdc:mga06r32_6524_c1 | nmdc:mga06r32_6524_c1_1620_1979 | 110 |
| 305 | 3300050511 | nmdc:mga08y16_142697_c1 | nmdc:mga08y16_142697_c1_1144_1506 | 110 |
| 306 | 3300050511 | nmdc:mga08y16_231196_c1 | nmdc:mga08y16_231196_c1_1012_1368 | 110 |
| 307 | 3300050511 | nmdc:mga08y16_4772_c1 | nmdc:mga08y16_4772_c1_6854_7213 | 110 |
| 308 | 3300050512 | nmdc:mga0n895_4179_c1 | nmdc:mga0n895_4179_c1_2082_2441 | 110 |
| 309 | 3300050513 | nmdc:mga0rr50_55959_c1 | nmdc:mga0rr50_55959_c1_2016_2375 | 110 |
| 310 | 3300050515 | nmdc:mga0a205_177652_c1 | nmdc:mga0a205_177652_c1_863_1222 | 110 |
| 311 | 3300050515 | nmdc:mga0a205_658055_c1 | nmdc:mga0a205_658055_c1_120_482 | 110 |
| 312 | 3300053111 | Ga0500572_305844 | Ga0500572_305844_53_412 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l2h-assembly1.cif.gz_D | crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution | 0.8158 | 30 | 99 |
| 5wse-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i | 0.8002 | 30 | 98 |
| 8hjx-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58e mutant) in copper (cu) substituted form | 0.7946 | 30 | 98 |
| 8hjy-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form | 0.7933 | 30 | 98 |
| 5wsd-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459) in apo form | 0.7892 | 30 | 98 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l2hD01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8036 | 32 | 99 | 2.60.120.10 |
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7654 | 29 | 98 | 2.60.120.10 |
| af_Q8MLZ3_588_721_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7563 | 31 | 97 | 2.60.120.10 |
| 1sfnA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7545 | 30 | 99 | 2.60.120.10 |
| af_E7FAC3_1039_1126_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.7506 | 30 | 99 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X3RLZ5-F1-model_v4 | Cupin domain-containing protein | 0.8058 | 31 | 98 |
|
| AF-A0A225X785-F1-model_v4 | deleted | 0.7987 | 28 | 98 |
|
| AF-A0A6H0HBG2-F1-model_v4 | Cupin domain protein | 0.7941 | 30 | 98 |
GO:0004475
GO:0005976 GO:0009298 |
| AF-A0A1V5GFF6-F1-model_v4 | Cupin domain protein | 0.7916 | 30 | 98 |
|
| AF-A0A7Y2FUU9-F1-model_v4 | Cupin domain-containing protein | 0.7883 | 28 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar