F401557

General Info

Members Datasets Scaffolds Average Seq Length
312 191 312 117

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100264475|Ga0068868_1002644752
Length 127
Sequence MRVWQHARMDAGLIVVPPGKGHRVGNVEFLARSADTPRFTFGIIEIVPGRVLESHVHAGEDDAFYILEGEMTFTSGDRTVRAPPGTFVLAPEGVQHGFRNDGDVPVRMLNLHAPAGFDLRIGLPPGR

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
189 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
190 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 3.21
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 1.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02HPQQC 2088090002 Bacteria 507
2 rootL2_10026344 3300003322 Bacteria 2869
3 JGI25407J50210_10016686 3300003373 Bacteria 1903
4 Ga0070683_101033983 3300005329 Bacteria 789
5 Ga0068869_100371828 3300005334 Bacteria 1170
6 Ga0070680_100002138 3300005336 Bacteria 14605
7 Ga0070682_100057628 3300005337 Bacteria 2448
8 Ga0070682_100978539 3300005337 Bacteria 701
9 Ga0068868_100016665 3300005338 Bacteria 5463
10 Ga0068868_100056117 3300005338 Bacteria 3109
11 Ga0068868_100183818 3300005338 Bacteria 1735
12 Ga0068868_100264475 3300005338 Bacteria 1452
13 Ga0068868_100377654 3300005338 Bacteria 1219
14 Ga0070660_101523399 3300005339 Bacteria 569
15 Ga0070689_100309316 3300005340 Bacteria 1317
16 Ga0070689_100627996 3300005340 Bacteria 933
17 Ga0070691_10021422 3300005341 Bacteria 2991
18 Ga0070661_100413118 3300005344 Bacteria 1069
19 Ga0070661_101054732 3300005344 Bacteria 676
20 Ga0070692_10094898 3300005345 Bacteria 1627
21 Ga0070692_10127545 3300005345 Unclassified 1426
22 Ga0070692_10159838 3300005345 Bacteria 1290
23 Ga0070692_10404059 3300005345 Bacteria 863
24 Ga0070668_100951128 3300005347 Bacteria 770
25 Ga0070669_100165783 3300005353 Bacteria 1720
26 Ga0070671_101828312 3300005355 Bacteria 540
27 Ga0070673_100951664 3300005364 Bacteria 798
28 Ga0070659_100023334 3300005366 Bacteria 4733
29 Ga0070659_100072204 3300005366 Bacteria 2746
30 Ga0070700_100166086 3300005441 Bacteria 1524
31 Ga0070694_101006616 3300005444 Bacteria 692
32 Ga0070663_100086929 3300005455 Bacteria 2310
33 Ga0070663_101155835 3300005455 Bacteria 679
34 Ga0070678_100383170 3300005456 Bacteria 1217
35 Ga0070662_100249707 3300005457 Bacteria 1426
36 Ga0070681_10271795 3300005458 Bacteria 1606
37 Ga0070681_12032437 3300005458 Unclassified 503
38 Ga0068867_100447395 3300005459 Bacteria 1100
39 Ga0070685_10303913 3300005466 Bacteria 1076
40 Ga0070685_10761168 3300005466 Bacteria 711
41 Ga0070685_10948260 3300005466 Bacteria 643
42 Ga0070707_100205994 3300005468 Bacteria 1917
43 Ga0070698_100067052 3300005471 Bacteria 3610
44 Ga0070699_100064957 3300005518 Bacteria 3166
45 Ga0070684_100020878 3300005535 Bacteria 5436
46 Ga0070684_100212385 3300005535 Bacteria 1764
47 Ga0070684_100463433 3300005535 Bacteria 1172
48 Ga0068853_101385560 3300005539 Bacteria 680
49 Ga0070672_100874107 3300005543 Bacteria 793
50 Ga0070686_100271378 3300005544 Unclassified 1247
51 Ga0070704_100376756 3300005549 Bacteria 1204
52 Ga0068855_100211362 3300005563 Unclassified 2180
53 Ga0070664_100074866 3300005564 Bacteria 2906
54 Ga0070664_100167131 3300005564 Bacteria 1949
55 Ga0070664_100260380 3300005564 Bacteria 1561
56 Ga0070664_101657454 3300005564 Bacteria 606
57 Ga0068854_100257648 3300005578 Bacteria 1396
58 Ga0068854_100827991 3300005578 Bacteria 809
59 Ga0068854_100942799 3300005578 Bacteria 761
60 Ga0068856_100266460 3300005614 Bacteria 1729
61 Ga0070702_100015965 3300005615 Bacteria 3846
62 Ga0070702_100862308 3300005615 Bacteria 706
63 Ga0068852_100199108 3300005616 Bacteria 1895
64 Ga0068852_100510097 3300005616 Bacteria 1199
65 Ga0068859_100223734 3300005617 Bacteria 1970
66 Ga0068859_102851758 3300005617 Bacteria 530
67 Ga0068864_100093366 3300005618 Bacteria 2658
68 Ga0068864_100993867 3300005618 Bacteria 832
69 Ga0068864_101822888 3300005618 Bacteria 614
70 Ga0068866_10020041 3300005718 Bacteria 3057
71 Ga0068866_10718280 3300005718 Bacteria 687
72 Ga0068861_100027140 3300005719 Bacteria 4168
73 Ga0068861_101881577 3300005719 Bacteria 595
74 Ga0068851_10195038 3300005834 Bacteria 1128
75 Ga0068851_10276990 3300005834 Bacteria 958
76 Ga0068851_10925877 3300005834 Bacteria 547
77 Ga0068863_100084822 3300005841 Unclassified 3002
78 Ga0068863_102519351 3300005841 Bacteria 524
79 Ga0068858_101056671 3300005842 Bacteria 796
80 Ga0068862_100373860 3300005844 Bacteria 1327
81 Ga0068862_101883802 3300005844 Unclassified 608
82 Ga0081455_10654068 3300005937 Unclassified 676
83 Ga0081538_10002012 3300005981 Bacteria 20319
84 Ga0081539_10193278 3300005985 Bacteria 946
85 Ga0075365_10123711 3300006038 Bacteria 1786
86 Ga0075365_10938739 3300006038 Bacteria 610
87 Ga0075364_10085171 3300006051 Bacteria 2093
88 Ga0075432_10224079 3300006058 Unclassified 753
89 Ga0070712_100038776 3300006175 Bacteria 3258
90 Ga0075431_100004212 3300006847 Bacteria 14081
91 Ga0075433_10267782 3300006852 Bacteria 1514
92 Ga0075433_10764295 3300006852 Bacteria 845
93 Ga0075434_100049372 3300006871 Bacteria 4178
94 Ga0075429_100302960 3300006880 Bacteria 1399
95 Ga0068865_100056884 3300006881 Bacteria 2726
96 Ga0068865_100259286 3300006881 Bacteria 1376
97 Ga0068865_100308518 3300006881 Bacteria 1269
98 Ga0097620_100223739 3300006931 Bacteria 1970
99 Ga0097620_102850200 3300006931 Bacteria 530
100 Ga0075435_100055368 3300007076 Bacteria 3203
101 Ga0075435_100136907 3300007076 Bacteria 2052
102 Ga0105240_10252581 3300009093 Bacteria 2038
103 Ga0105240_11148629 3300009093 Bacteria 824
104 Ga0111539_10006799 3300009094 Bacteria 14713
105 Ga0111539_10173087 3300009094 Unclassified 2522
106 Ga0111539_10244158 3300009094 Bacteria 2091
107 Ga0111539_10547531 3300009094 Bacteria 1348
108 Ga0111539_11893744 3300009094 Bacteria 691
109 Ga0111539_12947806 3300009094 Unclassified 550
110 Ga0105245_10014855 3300009098 Bacteria 6782
111 Ga0105245_10367184 3300009098 Bacteria 1430
112 Ga0105245_11252783 3300009098 Bacteria 790
113 Ga0105245_11612548 3300009098 Bacteria 701
114 Ga0105245_12311289 3300009098 Bacteria 591
115 Ga0105247_10259511 3300009101 Bacteria 1191
116 Ga0114129_10016828 3300009147 Bacteria 10410
117 Ga0114129_11402296 3300009147 Bacteria 862
118 Ga0114129_12605565 3300009147 Bacteria 603
119 Ga0105243_10057292 3300009148 Bacteria 3102
120 Ga0105243_10842200 3300009148 Bacteria 907
121 Ga0105243_10953872 3300009148 Bacteria 857
122 Ga0105243_13116363 3300009148 Bacteria 502
123 Ga0105242_10991382 3300009176 Bacteria 847
124 Ga0105248_10210756 3300009177 Unclassified 2189
125 Ga0105237_10246105 3300009545 Bacteria 1790
126 Ga0105238_10051452 3300009551 Bacteria 4143
127 Ga0105238_10472793 3300009551 Unclassified 1252
128 Ga0105249_10101794 3300009553 Bacteria 2702
129 Ga0105249_11898498 3300009553 Bacteria 668
130 Ga0105239_10574567 3300010375 Bacteria 1285
131 Ga0105246_10044847 3300011119 Bacteria 3007
132 Ga0157370_10014384 3300013104 Bacteria 8092
133 Ga0157374_10959970 3300013296 Bacteria 873
134 Ga0157378_10492739 3300013297 Bacteria 1223
135 Ga0157378_11820842 3300013297 Unclassified 657
136 Ga0157378_12056495 3300013297 Bacteria 621
137 Ga0157372_10087629 3300013307 Bacteria 3532
138 Ga0157372_10671554 3300013307 Bacteria 1206
139 Ga0157372_11267825 3300013307 Bacteria 851
140 Ga0157372_13071204 3300013307 Bacteria 533
141 Ga0157375_10015012 3300013308 Bacteria 6928
142 Ga0157375_10069748 3300013308 Bacteria 3522
143 Ga0157375_10758583 3300013308 Bacteria 1121
144 Ga0157375_10960909 3300013308 Bacteria 996
145 Ga0163163_10497643 3300014325 Bacteria 1281
146 Ga0163163_12207914 3300014325 Unclassified 610
147 Ga0157380_10209859 3300014326 Unclassified 1734
148 Ga0157380_10370201 3300014326 Bacteria 1348
149 Ga0157377_10017886 3300014745 Bacteria 3676
150 Ga0157377_10068406 3300014745 Bacteria 2046
151 Ga0157377_10082851 3300014745 Bacteria 1878
152 Ga0157379_10507621 3300014968 Bacteria 1118
153 Ga0157379_10540361 3300014968 Bacteria 1083
154 Ga0224712_10085670 3300022467 Bacteria 1310
155 Ga0207642_10130910 3300025899 Bacteria 1309
156 Ga0207642_10188691 3300025899 Bacteria 1129
157 Ga0207688_10054537 3300025901 Bacteria 2243
158 Ga0207643_10929127 3300025908 Bacteria 563
159 Ga0207654_10410951 3300025911 Unclassified 943
160 Ga0207707_10043296 3300025912 Bacteria 3927
161 Ga0207695_10284513 3300025913 Bacteria 1547
162 Ga0207693_10396866 3300025915 Unclassified 1078
163 Ga0207660_10018987 3300025917 Bacteria 4592
164 Ga0207662_10017159 3300025918 Bacteria 4093
165 Ga0207662_10116225 3300025918 Bacteria 1673
166 Ga0207657_10010006 3300025919 Bacteria 9488
167 Ga0207649_10321967 3300025920 Bacteria 1136
168 Ga0207652_10049112 3300025921 Bacteria 3610
169 Ga0207681_10062312 3300025923 Bacteria 2568
170 Ga0207694_10035149 3300025924 Bacteria 3844
171 Ga0207650_10717320 3300025925 Bacteria 845
172 Ga0207687_10059876 3300025927 Bacteria 2684
173 Ga0207687_10386230 3300025927 Bacteria 1148
174 Ga0207687_10469028 3300025927 Bacteria 1047
175 Ga0207687_10977578 3300025927 Bacteria 726
176 Ga0207690_10354977 3300025932 Bacteria 1160
177 Ga0207690_10375916 3300025932 Bacteria 1128
178 Ga0207690_11322296 3300025932 Unclassified 602
179 Ga0207706_10203248 3300025933 Bacteria 1737
180 Ga0207706_10219296 3300025933 Bacteria 1666
181 Ga0207686_10096420 3300025934 Bacteria 1965
182 Ga0207709_10367173 3300025935 Bacteria 1091
183 Ga0207670_10401679 3300025936 Bacteria 1096
184 Ga0207670_10594215 3300025936 Bacteria 908
185 Ga0207704_10150406 3300025938 Bacteria 1642
186 Ga0207711_10363252 3300025941 Bacteria 1341
187 Ga0207689_10190480 3300025942 Bacteria 1692
188 Ga0207689_10335648 3300025942 Bacteria 1255
189 Ga0207661_10011837 3300025944 Bacteria 6335
190 Ga0207679_10149655 3300025945 Bacteria 1898
191 Ga0207679_10356945 3300025945 Bacteria 1276
192 Ga0207679_11403643 3300025945 Unclassified 641
193 Ga0207712_10058344 3300025961 Bacteria 2727
194 Ga0207640_10709704 3300025981 Bacteria 863
195 Ga0207640_10746268 3300025981 Bacteria 843
196 Ga0207658_10957079 3300025986 Bacteria 781
197 Ga0207677_10106767 3300026023 Bacteria 2075
198 Ga0207677_10143429 3300026023 Bacteria 1832
199 Ga0207677_10787422 3300026023 Bacteria 850
200 Ga0207677_11220815 3300026023 Bacteria 689
201 Ga0207677_11487688 3300026023 Bacteria 625
202 Ga0207639_10860634 3300026041 Bacteria 846
203 Ga0207678_10218425 3300026067 Bacteria 1631
204 Ga0207678_10323106 3300026067 Bacteria 1328
205 Ga0207678_10405828 3300026067 Unclassified 1180
206 Ga0207678_10494734 3300026067 Bacteria 1065
207 Ga0207708_10013156 3300026075 Bacteria 6175
208 Ga0207702_10053204 3300026078 Bacteria 3427
209 Ga0207702_10340050 3300026078 Bacteria 1434
210 Ga0207702_10997380 3300026078 Bacteria 831
211 Ga0207702_12437302 3300026078 Bacteria 510
212 Ga0207641_10080334 3300026088 Unclassified 2829
213 Ga0207648_10291218 3300026089 Bacteria 1462
214 Ga0207648_10443606 3300026089 Bacteria 1181
215 Ga0207648_10666640 3300026089 Bacteria 962
216 Ga0207676_10727768 3300026095 Bacteria 963
217 Ga0207674_10780812 3300026116 Unclassified 922
218 Ga0207675_100793786 3300026118 Unclassified 960
219 Ga0207683_10356870 3300026121 Bacteria 1342
220 Ga0207698_10668540 3300026142 Bacteria 1031
221 Ga0207698_10933278 3300026142 Bacteria 876
222 Ga0207698_11130218 3300026142 Bacteria 796
223 Ga0207698_11252025 3300026142 Bacteria 756
224 Ga0207428_10025745 3300027907 Bacteria 4920
225 Ga0207428_10177430 3300027907 Unclassified 1611
226 Ga0207428_10918415 3300027907 Bacteria 618
227 Ga0268265_10256850 3300028380 Bacteria 1551
228 Ga0268265_11823414 3300028380 Unclassified 615
229 Ga0307408_100550745 3300031548 Bacteria 1018
230 Ga0307405_10602891 3300031731 Bacteria 896
231 Ga0307413_10713292 3300031824 Bacteria 834
232 Ga0307410_10404797 3300031852 Bacteria 1103
233 Ga0307410_10964940 3300031852 Bacteria 733
234 Ga0307406_10075615 3300031901 Bacteria 2222
235 Ga0307406_10233951 3300031901 Bacteria 1374
236 Ga0307406_10241846 3300031901 Bacteria 1354
237 Ga0307406_10321097 3300031901 Bacteria 1198
238 Ga0307407_10036295 3300031903 Bacteria 2715
239 Ga0307412_10051243 3300031911 Bacteria 2727
240 Ga0307409_100117814 3300031995 Bacteria 2242
241 Ga0307409_100560120 3300031995 Bacteria 1123
242 Ga0307409_100667800 3300031995 Unclassified 1035
243 Ga0307409_101367667 3300031995 Bacteria 734
244 Ga0307416_100031632 3300032002 Bacteria 3986
245 Ga0307414_10205996 3300032004 Bacteria 1604
246 Ga0307411_10030739 3300032005 Bacteria 3296
247 Ga0307411_10365388 3300032005 Unclassified 1182
248 Ga0307411_11000052 3300032005 Bacteria 749
249 Ga0307411_11550540 3300032005 Bacteria 610
250 Ga0395898_1068573 3300037466 Bacteria 741
251 Ga0395901_0268017 3300038443 Bacteria 1777
252 Ga0439447_044405 3300041407 Bacteria 1075
253 Ga0439461_0112893 3300041410 Bacteria 672
254 Ga0439461_0233041 3300041410 Bacteria 506
255 Ga0439465_0165308 3300041413 Bacteria 795
256 Ga0451833_1257202 3300041491 Bacteria 597
257 Ga0451855_1523054 3300041511 Bacteria 586
258 Ga0451853_1611964 3300041512 Bacteria 608
259 Ga0439433_0147392 3300041999 Bacteria 604
260 Ga0450907_003500 3300042146 Bacteria 2796
261 Ga0439446_0109632 3300042156 Bacteria 879
262 Ga0466961_0193848 3300044693 Bacteria 1259
263 Ga0466963_0146480 3300044694 Bacteria 1639
264 Ga0466963_0246653 3300044694 Bacteria 1253
265 Ga0466970_0078911 3300044765 Bacteria 1777
266 Ga0466960_0180930 3300044901 Bacteria 1143
267 Ga0466960_0297071 3300044901 Unclassified 909
268 Ga0466958_0320760 3300045836 Bacteria 996
269 Ga0466967_0164073 3300045976 Bacteria 2087
270 Ga0495650_0000035 3300046471 Bacteria 403799
271 Ga0495605_0404431 3300046474 Unclassified 567
272 Ga0495610_0360094 3300046512 Bacteria 546
273 Ga0495643_0271958 3300046522 Bacteria 783
274 Ga0495668_0332295 3300046616 Bacteria 834
275 Ga0495659_0205421 3300046664 Bacteria 809
276 Ga0495626_0333983 3300048091 Bacteria 594
277 Ga0496100_0462031 3300048903 Bacteria 974
278 Ga0496102_0305268 3300048905 Bacteria 1500
279 Ga0496107_0141492 3300048910 Bacteria 1778
280 Ga0496108_0715535 3300048911 Bacteria 868
281 Ga0496109_1040447 3300048912 Bacteria 756
282 Ga0496109_1428720 3300048912 Bacteria 627
283 Ga0496110_0174425 3300048913 Unclassified 1951
284 Ga0496111_0288160 3300048914 Bacteria 1218
285 Ga0496113_0552506 3300048916 Unclassified 923
286 Ga0496114_0147452 3300048917 Bacteria 2040
287 Ga0501048_0492749 3300049582 Unclassified 879
288 Ga0501069_0218242 3300049585 Bacteria 1108
289 Ga0501071_0364561 3300049587 Unclassified 1101
290 Ga0501075_0293862 3300049591 Bacteria 1238
291 Ga0501077_0793371 3300049593 Unclassified 609
292 Ga0501209_156477 3300049656 Bacteria 688
293 nmdc:mga03n38_757825_c1 3300050490 Bacteria 563
294 nmdc:mga00v17_404338_c1 3300050491 Unclassified 887
295 nmdc:mga0yw44_3453_c1 3300050492 Bacteria 7017
296 nmdc:mga0yw44_352044_c1 3300050492 Bacteria 991
297 nmdc:mga09592_290233_c1 3300050508 Bacteria 1418
298 nmdc:mga06r32_6524_c1 3300050510 Bacteria 10484
299 nmdc:mga08y16_1165026_c1 3300050511 Bacteria 743
300 nmdc:mga08y16_142697_c1 3300050511 Unclassified 2490
301 nmdc:mga08y16_231196_c1 3300050511 Bacteria 1912
302 nmdc:mga08y16_4772_c1 3300050511 Bacteria 14144
303 nmdc:mga08y16_631418_c1 3300050511 Bacteria 1077
304 nmdc:mga0n895_4179_c1 3300050512 Bacteria 11792
305 nmdc:mga0rr50_209745_c1 3300050513 Bacteria 1604
306 nmdc:mga0rr50_55959_c1 3300050513 Bacteria 2945
307 nmdc:mga0a205_177652_c1 3300050515 Bacteria 2024
308 nmdc:mga0a205_658055_c1 3300050515 Bacteria 899
309 Ga0500572_305844 3300053111 Bacteria 511
310 Ga0590071_020594 3300059421 Bacteria 1553
311 Ga0590074_040247 3300059423 Bacteria 840
312 Ga0590077_040660 3300059426 Bacteria 1032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_404338_c1 nmdc:mga00v17_404338_c1_561_869 86
2 3300050492 nmdc:mga0yw44_3453_c1 nmdc:mga0yw44_3453_c1_5923_6231 86
3 3300005344 Ga0070661_101054732 Ga0070661_1010547322 98
4 3300014968 Ga0157379_10540361 Ga0157379_105403613 98
5 3300026078 Ga0207702_12437302 Ga0207702_124373021 98
6 3300006038 Ga0075365_10123711 Ga0075365_101237113 100
7 3300006051 Ga0075364_10085171 Ga0075364_100851713 100
8 3300005334 Ga0068869_100371828 Ga0068869_1003718282 102
9 3300005338 Ga0068868_100183818 Ga0068868_1001838182 102
10 3300005339 Ga0070660_101523399 Ga0070660_1015233991 102
11 3300005340 Ga0070689_100627996 Ga0070689_1006279962 102
12 3300005353 Ga0070669_100165783 Ga0070669_1001657833 102
13 3300005366 Ga0070659_100072204 Ga0070659_1000722041 102
14 3300005578 Ga0068854_100257648 Ga0068854_1002576482 102
15 3300005615 Ga0070702_100015965 Ga0070702_1000159653 102
16 3300005616 Ga0068852_100199108 Ga0068852_1001991083 102
17 3300005719 Ga0068861_100027140 Ga0068861_1000271402 102
18 3300005842 Ga0068858_101056671 Ga0068858_1010566712 102
19 3300005844 Ga0068862_100373860 Ga0068862_1003738602 102
20 3300006881 Ga0068865_100259286 Ga0068865_1002592862 102
21 3300009093 Ga0105240_11148629 Ga0105240_111486291 102
22 3300009098 Ga0105245_11252783 Ga0105245_112527832 102
23 3300010375 Ga0105239_10574567 Ga0105239_105745671 102
24 3300013296 Ga0157374_10959970 Ga0157374_109599702 102
25 3300013297 Ga0157378_10492739 Ga0157378_104927392 102
26 3300013308 Ga0157375_10069748 Ga0157375_100697483 102
27 3300014326 Ga0157380_10370201 Ga0157380_103702012 102
28 3300014745 Ga0157377_10082851 Ga0157377_100828512 102
29 3300025918 Ga0207662_10116225 Ga0207662_101162252 102
30 3300025923 Ga0207681_10062312 Ga0207681_100623125 102
31 3300025927 Ga0207687_10059876 Ga0207687_100598764 102
32 3300025932 Ga0207690_10354977 Ga0207690_103549772 102
33 3300025933 Ga0207706_10219296 Ga0207706_102192962 102
34 3300025936 Ga0207670_10594215 Ga0207670_105942152 102
35 3300025938 Ga0207704_10150406 Ga0207704_101504063 102
36 3300025942 Ga0207689_10190480 Ga0207689_101904802 102
37 3300025961 Ga0207712_10058344 Ga0207712_100583442 102
38 3300026023 Ga0207677_10787422 Ga0207677_107874222 102
39 3300026089 Ga0207648_10443606 Ga0207648_104436063 102
40 3300026142 Ga0207698_10933278 Ga0207698_109332782 102
41 3300028380 Ga0268265_10256850 Ga0268265_102568504 102
42 3300048903 Ga0496100_0462031 Ga0496100_0462031_75_443 102
43 3300048910 Ga0496107_0141492 Ga0496107_0141492_160_528 102
44 3300050511 nmdc:mga08y16_1165026_c1 nmdc:mga08y16_1165026_c1_303_671 102
45 3300037466 Ga0395898_1068573 Ga0395898_1068573_15_362 104
46 3300005564 Ga0070664_100074866 Ga0070664_1000748664 106
47 3300005444 Ga0070694_101006616 Ga0070694_1010066161 108
48 3300005468 Ga0070707_100205994 Ga0070707_1002059943 108
49 3300005471 Ga0070698_100067052 Ga0070698_1000670521 108
50 3300005518 Ga0070699_100064957 Ga0070699_1000649573 108
51 3300009147 Ga0114129_12605565 Ga0114129_126055652 108
52 3300025911 Ga0207654_10410951 Ga0207654_104109512 108
53 3300026142 Ga0207698_11130218 Ga0207698_111302182 108
54 3300031852 Ga0307410_10964940 Ga0307410_109649401 108
55 3300031995 Ga0307409_100117814 Ga0307409_1001178142 108
56 3300032005 Ga0307411_11550540 Ga0307411_115505402 108
57 3300041410 Ga0439461_0112893 Ga0439461_0112893_167_514 108
58 3300041410 Ga0439461_0233041 Ga0439461_0233041_67_414 108
59 3300041413 Ga0439465_0165308 Ga0439465_0165308_230_577 108
60 3300042146 Ga0450907_003500 Ga0450907_003500_2262_2618 108
61 3300042156 Ga0439446_0109632 Ga0439446_0109632_108_455 108
62 3300049582 Ga0501048_0492749 Ga0501048_0492749_427_783 108
63 3300049591 Ga0501075_0293862 Ga0501075_0293862_138_494 108
64 3300049593 Ga0501077_0793371 Ga0501077_0793371_206_562 108
65 3300049656 Ga0501209_156477 Ga0501209_156477_30_386 108
66 3300059421 Ga0590071_020594 Ga0590071_020594_246_596 108
67 3300059423 Ga0590074_040247 Ga0590074_040247_135_485 108
68 3300059426 Ga0590077_040660 Ga0590077_040660_410_760 108
69 3300005345 Ga0070692_10404059 Ga0070692_104040592 109
70 3300005347 Ga0070668_100951128 Ga0070668_1009511282 109
71 3300005364 Ga0070673_100951664 Ga0070673_1009516641 109
72 3300005455 Ga0070663_101155835 Ga0070663_1011558352 109
73 3300005457 Ga0070662_100249707 Ga0070662_1002497072 109
74 3300005564 Ga0070664_100167131 Ga0070664_1001671313 109
75 3300005578 Ga0068854_100942799 Ga0068854_1009427992 109
76 3300005985 Ga0081539_10193278 Ga0081539_101932782 109
77 3300007076 Ga0075435_100136907 Ga0075435_1001369072 109
78 3300009094 Ga0111539_10244158 Ga0111539_102441582 109
79 3300009094 Ga0111539_11893744 Ga0111539_118937442 109
80 3300009094 Ga0111539_12947806 Ga0111539_129478061 109
81 3300025933 Ga0207706_10203248 Ga0207706_102032482 109
82 3300025942 Ga0207689_10335648 Ga0207689_103356482 109
83 3300025945 Ga0207679_10356945 Ga0207679_103569452 109
84 3300025981 Ga0207640_10709704 Ga0207640_107097042 109
85 3300026067 Ga0207678_10494734 Ga0207678_104947341 109
86 3300041407 Ga0439447_044405 Ga0439447_044405_68_424 109
87 3300041511 Ga0451855_1523054 Ga0451855_1523054_98_451 109
88 3300041999 Ga0439433_0147392 Ga0439433_0147392_145_501 109
89 3300045976 Ga0466967_0164073 Ga0466967_0164073_551_898 109
90 3300046474 Ga0495605_0404431 Ga0495605_0404431_156_506 109
91 3300048091 Ga0495626_0333983 Ga0495626_0333983_41_394 109
92 3300048917 Ga0496114_0147452 Ga0496114_0147452_978_1334 109
93 3300050490 nmdc:mga03n38_757825_c1 nmdc:mga03n38_757825_c1_72_425 109
94 3300050511 nmdc:mga08y16_631418_c1 nmdc:mga08y16_631418_c1_657_1004 109
95 3300050513 nmdc:mga0rr50_209745_c1 nmdc:mga0rr50_209745_c1_847_1197 109
96 2088090002 CNA_F6ESG4R02HPQQC CNA_00985120 110
97 3300003322 rootL2_10026344 rootL2_100263442 110
98 3300003373 JGI25407J50210_10016686 JGI25407J50210_100166862 110
99 3300005329 Ga0070683_101033983 Ga0070683_1010339832 110
100 3300005336 Ga0070680_100002138 Ga0070680_1000021386 110
101 3300005337 Ga0070682_100057628 Ga0070682_1000576283 110
102 3300005337 Ga0070682_100978539 Ga0070682_1009785391 110
103 3300005338 Ga0068868_100016665 Ga0068868_1000166655 110
104 3300005338 Ga0068868_100056117 Ga0068868_1000561173 110
105 3300005338 Ga0068868_100264475 Ga0068868_1002644752 110
106 3300005338 Ga0068868_100377654 Ga0068868_1003776542 110
107 3300005340 Ga0070689_100309316 Ga0070689_1003093162 110
108 3300005341 Ga0070691_10021422 Ga0070691_100214222 110
109 3300005344 Ga0070661_100413118 Ga0070661_1004131182 110
110 3300005345 Ga0070692_10094898 Ga0070692_100948981 110
111 3300005345 Ga0070692_10127545 Ga0070692_101275453 110
112 3300005345 Ga0070692_10159838 Ga0070692_101598382 110
113 3300005355 Ga0070671_101828312 Ga0070671_1018283121 110
114 3300005366 Ga0070659_100023334 Ga0070659_1000233344 110
115 3300005441 Ga0070700_100166086 Ga0070700_1001660863 110
116 3300005455 Ga0070663_100086929 Ga0070663_1000869292 110
117 3300005456 Ga0070678_100383170 Ga0070678_1003831702 110
118 3300005458 Ga0070681_10271795 Ga0070681_102717953 110
119 3300005458 Ga0070681_12032437 Ga0070681_120324371 110
120 3300005459 Ga0068867_100447395 Ga0068867_1004473951 110
121 3300005466 Ga0070685_10303913 Ga0070685_103039132 110
122 3300005466 Ga0070685_10761168 Ga0070685_107611682 110
123 3300005466 Ga0070685_10948260 Ga0070685_109482602 110
124 3300005535 Ga0070684_100020878 Ga0070684_1000208785 110
125 3300005535 Ga0070684_100212385 Ga0070684_1002123852 110
126 3300005535 Ga0070684_100463433 Ga0070684_1004634332 110
127 3300005539 Ga0068853_101385560 Ga0068853_1013855602 110
128 3300005543 Ga0070672_100874107 Ga0070672_1008741072 110
129 3300005544 Ga0070686_100271378 Ga0070686_1002713783 110
130 3300005549 Ga0070704_100376756 Ga0070704_1003767562 110
131 3300005563 Ga0068855_100211362 Ga0068855_1002113623 110
132 3300005564 Ga0070664_100260380 Ga0070664_1002603802 110
133 3300005564 Ga0070664_101657454 Ga0070664_1016574542 110
134 3300005578 Ga0068854_100827991 Ga0068854_1008279911 110
135 3300005614 Ga0068856_100266460 Ga0068856_1002664602 110
136 3300005615 Ga0070702_100862308 Ga0070702_1008623082 110
137 3300005616 Ga0068852_100510097 Ga0068852_1005100972 110
138 3300005617 Ga0068859_100223734 Ga0068859_1002237343 110
139 3300005617 Ga0068859_102851758 Ga0068859_1028517581 110
140 3300005618 Ga0068864_100093366 Ga0068864_1000933662 110
141 3300005618 Ga0068864_100993867 Ga0068864_1009938672 110
142 3300005618 Ga0068864_101822888 Ga0068864_1018228881 110
143 3300005718 Ga0068866_10020041 Ga0068866_100200413 110
144 3300005718 Ga0068866_10718280 Ga0068866_107182802 110
145 3300005719 Ga0068861_101881577 Ga0068861_1018815772 110
146 3300005834 Ga0068851_10195038 Ga0068851_101950381 110
147 3300005834 Ga0068851_10276990 Ga0068851_102769902 110
148 3300005834 Ga0068851_10925877 Ga0068851_109258771 110
149 3300005841 Ga0068863_100084822 Ga0068863_1000848224 110
150 3300005841 Ga0068863_102519351 Ga0068863_1025193511 110
151 3300005844 Ga0068862_101883802 Ga0068862_1018838021 110
152 3300005937 Ga0081455_10654068 Ga0081455_106540682 110
153 3300005981 Ga0081538_10002012 Ga0081538_1000201210 110
154 3300006038 Ga0075365_10938739 Ga0075365_109387392 110
155 3300006058 Ga0075432_10224079 Ga0075432_102240792 110
156 3300006175 Ga0070712_100038776 Ga0070712_1000387765 110
157 3300006847 Ga0075431_100004212 Ga0075431_10000421217 110
158 3300006852 Ga0075433_10267782 Ga0075433_102677822 110
159 3300006852 Ga0075433_10764295 Ga0075433_107642952 110
160 3300006871 Ga0075434_100049372 Ga0075434_1000493724 110
161 3300006880 Ga0075429_100302960 Ga0075429_1003029602 110
162 3300006881 Ga0068865_100056884 Ga0068865_1000568843 110
163 3300006881 Ga0068865_100308518 Ga0068865_1003085182 110
164 3300006931 Ga0097620_100223739 Ga0097620_1002237393 110
165 3300006931 Ga0097620_102850200 Ga0097620_1028502001 110
166 3300007076 Ga0075435_100055368 Ga0075435_1000553682 110
167 3300009093 Ga0105240_10252581 Ga0105240_102525813 110
168 3300009094 Ga0111539_10006799 Ga0111539_100067996 110
169 3300009094 Ga0111539_10173087 Ga0111539_101730872 110
170 3300009094 Ga0111539_10547531 Ga0111539_105475312 110
171 3300009098 Ga0105245_10014855 Ga0105245_100148555 110
172 3300009098 Ga0105245_10367184 Ga0105245_103671842 110
173 3300009098 Ga0105245_11612548 Ga0105245_116125481 110
174 3300009098 Ga0105245_12311289 Ga0105245_123112892 110
175 3300009101 Ga0105247_10259511 Ga0105247_102595112 110
176 3300009147 Ga0114129_10016828 Ga0114129_100168285 110
177 3300009147 Ga0114129_11402296 Ga0114129_114022961 110
178 3300009148 Ga0105243_10057292 Ga0105243_100572923 110
179 3300009148 Ga0105243_10842200 Ga0105243_108422002 110
180 3300009148 Ga0105243_10953872 Ga0105243_109538722 110
181 3300009148 Ga0105243_13116363 Ga0105243_131163632 110
182 3300009176 Ga0105242_10991382 Ga0105242_109913822 110
183 3300009177 Ga0105248_10210756 Ga0105248_102107562 110
184 3300009545 Ga0105237_10246105 Ga0105237_102461052 110
185 3300009551 Ga0105238_10051452 Ga0105238_100514524 110
186 3300009551 Ga0105238_10472793 Ga0105238_104727932 110
187 3300009553 Ga0105249_10101794 Ga0105249_101017941 110
188 3300009553 Ga0105249_11898498 Ga0105249_118984982 110
189 3300011119 Ga0105246_10044847 Ga0105246_100448474 110
190 3300013104 Ga0157370_10014384 Ga0157370_100143847 110
191 3300013297 Ga0157378_11820842 Ga0157378_118208421 110
192 3300013297 Ga0157378_12056495 Ga0157378_120564951 110
193 3300013307 Ga0157372_10087629 Ga0157372_100876294 110
194 3300013307 Ga0157372_10671554 Ga0157372_106715542 110
195 3300013307 Ga0157372_11267825 Ga0157372_112678252 110
196 3300013307 Ga0157372_13071204 Ga0157372_130712041 110
197 3300013308 Ga0157375_10015012 Ga0157375_100150127 110
198 3300013308 Ga0157375_10758583 Ga0157375_107585832 110
199 3300013308 Ga0157375_10960909 Ga0157375_109609092 110
200 3300014325 Ga0163163_10497643 Ga0163163_104976432 110
201 3300014325 Ga0163163_12207914 Ga0163163_122079142 110
202 3300014326 Ga0157380_10209859 Ga0157380_102098592 110
203 3300014745 Ga0157377_10017886 Ga0157377_100178864 110
204 3300014745 Ga0157377_10068406 Ga0157377_100684062 110
205 3300014968 Ga0157379_10507621 Ga0157379_105076212 110
206 3300022467 Ga0224712_10085670 Ga0224712_100856703 110
207 3300025899 Ga0207642_10130910 Ga0207642_101309102 110
208 3300025899 Ga0207642_10188691 Ga0207642_101886912 110
209 3300025901 Ga0207688_10054537 Ga0207688_100545373 110
210 3300025908 Ga0207643_10929127 Ga0207643_109291272 110
211 3300025912 Ga0207707_10043296 Ga0207707_100432963 110
212 3300025913 Ga0207695_10284513 Ga0207695_102845132 110
213 3300025915 Ga0207693_10396866 Ga0207693_103968662 110
214 3300025917 Ga0207660_10018987 Ga0207660_100189874 110
215 3300025918 Ga0207662_10017159 Ga0207662_100171593 110
216 3300025919 Ga0207657_10010006 Ga0207657_100100064 110
217 3300025920 Ga0207649_10321967 Ga0207649_103219672 110
218 3300025921 Ga0207652_10049112 Ga0207652_100491124 110
219 3300025924 Ga0207694_10035149 Ga0207694_100351493 110
220 3300025925 Ga0207650_10717320 Ga0207650_107173201 110
221 3300025927 Ga0207687_10386230 Ga0207687_103862302 110
222 3300025927 Ga0207687_10469028 Ga0207687_104690282 110
223 3300025927 Ga0207687_10977578 Ga0207687_109775782 110
224 3300025932 Ga0207690_10375916 Ga0207690_103759162 110
225 3300025932 Ga0207690_11322296 Ga0207690_113222962 110
226 3300025934 Ga0207686_10096420 Ga0207686_100964202 110
227 3300025935 Ga0207709_10367173 Ga0207709_103671732 110
228 3300025936 Ga0207670_10401679 Ga0207670_104016791 110
229 3300025941 Ga0207711_10363252 Ga0207711_103632522 110
230 3300025944 Ga0207661_10011837 Ga0207661_100118373 110
231 3300025945 Ga0207679_10149655 Ga0207679_101496553 110
232 3300025945 Ga0207679_11403643 Ga0207679_114036431 110
233 3300025981 Ga0207640_10746268 Ga0207640_107462682 110
234 3300025986 Ga0207658_10957079 Ga0207658_109570792 110
235 3300026023 Ga0207677_10106767 Ga0207677_101067672 110
236 3300026023 Ga0207677_10143429 Ga0207677_101434292 110
237 3300026023 Ga0207677_11220815 Ga0207677_112208151 110
238 3300026023 Ga0207677_11487688 Ga0207677_114876882 110
239 3300026041 Ga0207639_10860634 Ga0207639_108606342 110
240 3300026067 Ga0207678_10218425 Ga0207678_102184252 110
241 3300026067 Ga0207678_10323106 Ga0207678_103231062 110
242 3300026067 Ga0207678_10405828 Ga0207678_104058282 110
243 3300026075 Ga0207708_10013156 Ga0207708_100131563 110
244 3300026078 Ga0207702_10053204 Ga0207702_100532044 110
245 3300026078 Ga0207702_10340050 Ga0207702_103400502 110
246 3300026078 Ga0207702_10997380 Ga0207702_109973802 110
247 3300026088 Ga0207641_10080334 Ga0207641_100803343 110
248 3300026089 Ga0207648_10291218 Ga0207648_102912182 110
249 3300026089 Ga0207648_10666640 Ga0207648_106666402 110
250 3300026095 Ga0207676_10727768 Ga0207676_107277682 110
251 3300026116 Ga0207674_10780812 Ga0207674_107808121 110
252 3300026118 Ga0207675_100793786 Ga0207675_1007937862 110
253 3300026121 Ga0207683_10356870 Ga0207683_103568703 110
254 3300026142 Ga0207698_10668540 Ga0207698_106685402 110
255 3300026142 Ga0207698_11252025 Ga0207698_112520252 110
256 3300027907 Ga0207428_10025745 Ga0207428_100257452 110
257 3300027907 Ga0207428_10177430 Ga0207428_101774302 110
258 3300027907 Ga0207428_10918415 Ga0207428_109184152 110
259 3300028380 Ga0268265_11823414 Ga0268265_118234142 110
260 3300031548 Ga0307408_100550745 Ga0307408_1005507453 110
261 3300031731 Ga0307405_10602891 Ga0307405_106028912 110
262 3300031824 Ga0307413_10713292 Ga0307413_107132922 110
263 3300031852 Ga0307410_10404797 Ga0307410_104047972 110
264 3300031901 Ga0307406_10075615 Ga0307406_100756152 110
265 3300031901 Ga0307406_10233951 Ga0307406_102339511 110
266 3300031901 Ga0307406_10241846 Ga0307406_102418462 110
267 3300031901 Ga0307406_10321097 Ga0307406_103210973 110
268 3300031903 Ga0307407_10036295 Ga0307407_100362952 110
269 3300031911 Ga0307412_10051243 Ga0307412_100512433 110
270 3300031995 Ga0307409_100560120 Ga0307409_1005601202 110
271 3300031995 Ga0307409_100667800 Ga0307409_1006678002 110
272 3300031995 Ga0307409_101367667 Ga0307409_1013676672 110
273 3300032002 Ga0307416_100031632 Ga0307416_1000316324 110
274 3300032004 Ga0307414_10205996 Ga0307414_102059962 110
275 3300032005 Ga0307411_10030739 Ga0307411_100307393 110
276 3300032005 Ga0307411_10365388 Ga0307411_103653882 110
277 3300032005 Ga0307411_11000052 Ga0307411_110000521 110
278 3300038443 Ga0395901_0268017 Ga0395901_0268017_1103_1459 110
279 3300041491 Ga0451833_1257202 Ga0451833_1257202_21_374 110
280 3300041512 Ga0451853_1611964 Ga0451853_1611964_236_595 110
281 3300044693 Ga0466961_0193848 Ga0466961_0193848_774_1124 110
282 3300044694 Ga0466963_0146480 Ga0466963_0146480_330_683 110
283 3300044694 Ga0466963_0246653 Ga0466963_0246653_142_492 110
284 3300044765 Ga0466970_0078911 Ga0466970_0078911_243_593 110
285 3300044901 Ga0466960_0180930 Ga0466960_0180930_310_660 110
286 3300044901 Ga0466960_0297071 Ga0466960_0297071_227_583 110
287 3300045836 Ga0466958_0320760 Ga0466958_0320760_490_840 110
288 3300046471 Ga0495650_0000035 Ga0495650_0000035_269097_269459 110
289 3300046512 Ga0495610_0360094 Ga0495610_0360094_132_488 110
290 3300046522 Ga0495643_0271958 Ga0495643_0271958_94_450 110
291 3300046616 Ga0495668_0332295 Ga0495668_0332295_384_740 110
292 3300046664 Ga0495659_0205421 Ga0495659_0205421_387_758 110
293 3300048905 Ga0496102_0305268 Ga0496102_0305268_74_457 110
294 3300048911 Ga0496108_0715535 Ga0496108_0715535_417_773 110
295 3300048912 Ga0496109_1040447 Ga0496109_1040447_140_496 110
296 3300048912 Ga0496109_1428720 Ga0496109_1428720_219_602 110
297 3300048913 Ga0496110_0174425 Ga0496110_0174425_310_663 110
298 3300048914 Ga0496111_0288160 Ga0496111_0288160_835_1191 110
299 3300048916 Ga0496113_0552506 Ga0496113_0552506_231_584 110
300 3300049585 Ga0501069_0218242 Ga0501069_0218242_550_906 110
301 3300049587 Ga0501071_0364561 Ga0501071_0364561_556_918 110
302 3300050492 nmdc:mga0yw44_352044_c1 nmdc:mga0yw44_352044_c1_147_503 110
303 3300050508 nmdc:mga09592_290233_c1 nmdc:mga09592_290233_c1_576_935 110
304 3300050510 nmdc:mga06r32_6524_c1 nmdc:mga06r32_6524_c1_1620_1979 110
305 3300050511 nmdc:mga08y16_142697_c1 nmdc:mga08y16_142697_c1_1144_1506 110
306 3300050511 nmdc:mga08y16_231196_c1 nmdc:mga08y16_231196_c1_1012_1368 110
307 3300050511 nmdc:mga08y16_4772_c1 nmdc:mga08y16_4772_c1_6854_7213 110
308 3300050512 nmdc:mga0n895_4179_c1 nmdc:mga0n895_4179_c1_2082_2441 110
309 3300050513 nmdc:mga0rr50_55959_c1 nmdc:mga0rr50_55959_c1_2016_2375 110
310 3300050515 nmdc:mga0a205_177652_c1 nmdc:mga0a205_177652_c1_863_1222 110
311 3300050515 nmdc:mga0a205_658055_c1 nmdc:mga0a205_658055_c1_120_482 110
312 3300053111 Ga0500572_305844 Ga0500572_305844_53_412 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

42

112

0.96

PF02311

AraC_binding

AraC-like ligand binding domain

41

124

0.86

PF12973

Cupin_7

ChrR Cupin-like domain

19

113

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.8158 30 99
5wse-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os) substituted form i 0.8002 30 98
8hjx-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58e mutant) in copper (cu) substituted form 0.7946 30 98
8hjy-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form 0.7933 30 98
5wsd-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459) in apo form 0.7892 30 98
ID Description Score Start End Superfamily
3l2hD01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8036 32 99 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7654 29 98 2.60.120.10
af_Q8MLZ3_588_721_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7563 31 97 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7545 30 99 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7506 30 99 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X3RLZ5-F1-model_v4 Cupin domain-containing protein 0.8058 31 98
AF-A0A225X785-F1-model_v4 deleted 0.7987 28 98
AF-A0A6H0HBG2-F1-model_v4 Cupin domain protein 0.7941 30 98 GO:0004475
GO:0005976
GO:0009298
AF-A0A1V5GFF6-F1-model_v4 Cupin domain protein 0.7916 30 98
AF-A0A7Y2FUU9-F1-model_v4 Cupin domain-containing protein 0.7883 28 101

Feature Viewer

pLDDT pTM Quality
73.74 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map