F401210

General Info

Members Datasets Scaffolds Average Seq Length
311 199 622 101

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10331710|Ga0163163_103317103
Length 120
Sequence MPAAQSRAGRRLRRHNEEATVHLTPADTEKLLLAVAGMVARDRLARGVKLNYPETVALLTTWVIERARDGRRVADLMVEGREVLTRDQVMDGVAEMLPDVQVEATFPDGRKLVTIHQPIA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
103 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
104 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
121 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
130 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
131 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
134 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
137 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
138 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
139 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
140 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.22
Nodule 0
Rhizoplane 14.47
Rhizosphere 73.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10331710 3300014325 Bacteria 1576
2 JGI24739J22299_10159002 3300001989 Bacteria 667
3 Ga0070658_10203528 3300005327 Bacteria 1671
4 Ga0070683_100497197 3300005329 Bacteria 1165
5 Ga0070683_101172272 3300005329 Bacteria 738
6 Ga0070683_101365696 3300005329 Bacteria 681
7 Ga0070690_101133803 3300005330 Bacteria 621
8 Ga0070670_100108776 3300005331 Bacteria 2389
9 Ga0070670_101528018 3300005331 Bacteria 613
10 Ga0070666_10026297 3300005335 Bacteria 3800
11 Ga0070682_100260307 3300005337 Bacteria 1255
12 Ga0070682_101582256 3300005337 Bacteria 566
13 Ga0070660_100617484 3300005339 Bacteria 907
14 Ga0070661_100102040 3300005344 Bacteria 2135
15 Ga0070692_10843273 3300005345 Bacteria 629
16 Ga0070668_100941781 3300005347 Bacteria 774
17 Ga0070668_102088940 3300005347 Bacteria 523
18 Ga0070669_101150856 3300005353 Bacteria 669
19 Ga0070675_100876733 3300005354 Bacteria 822
20 Ga0070671_100449486 3300005355 Bacteria 1106
21 Ga0070674_100091047 3300005356 Bacteria 2201
22 Ga0070674_101340649 3300005356 Bacteria 639
23 Ga0070688_100531907 3300005365 Bacteria 891
24 Ga0070667_100002903 3300005367 Bacteria 14729
25 Ga0070663_100332514 3300005455 Bacteria 1225
26 Ga0070663_101347079 3300005455 Bacteria 631
27 Ga0070663_101773108 3300005455 Bacteria 553
28 Ga0070678_100192293 3300005456 Bacteria 1678
29 Ga0070678_102053086 3300005456 Bacteria 541
30 Ga0068867_100515723 3300005459 Bacteria 1030
31 Ga0070685_10409067 3300005466 Bacteria 941
32 Ga0070698_101141390 3300005471 Bacteria 728
33 Ga0070672_100455144 3300005543 Bacteria 1103
34 Ga0070693_100911961 3300005547 Bacteria 659
35 Ga0070693_101037706 3300005547 Bacteria 622
36 Ga0070665_100001319 3300005548 Bacteria 29608
37 Ga0070665_100506978 3300005548 Bacteria 1218
38 Ga0070664_100027514 3300005564 Bacteria 4726
39 Ga0068856_100315086 3300005614 Bacteria 1582
40 Ga0070702_101264995 3300005615 Bacteria 598
41 Ga0068852_100171333 3300005616 Bacteria 2035
42 Ga0068852_100578120 3300005616 Bacteria 1126
43 Ga0068852_101015417 3300005616 Bacteria 848
44 Ga0068852_101381360 3300005616 Bacteria 726
45 Ga0068852_102062776 3300005616 Bacteria 592
46 Ga0068864_100994603 3300005618 Bacteria 832
47 Ga0068861_100673959 3300005719 Bacteria 958
48 Ga0068863_100081088 3300005841 Bacteria 3074
49 Ga0068858_100000074 3300005842 Bacteria 104483
50 Ga0068858_100017074 3300005842 Bacteria 6813
51 Ga0068860_100000035 3300005843 Bacteria 238993
52 Ga0068862_101739625 3300005844 Bacteria 632
53 Ga0081455_10000070 3300005937 Bacteria 110926
54 Ga0070717_10344209 3300006028 Bacteria 1332
55 Ga0075364_10001401 3300006051 Bacteria 13043
56 Ga0075367_10508783 3300006178 Bacteria 764
57 Ga0075370_10082522 3300006353 Bacteria 1849
58 Ga0068865_101701683 3300006881 Bacteria 569
59 Ga0105240_12081491 3300009093 Bacteria 589
60 Ga0105245_10037736 3300009098 Bacteria 4296
61 Ga0105245_10288029 3300009098 Bacteria 1608
62 Ga0105245_10443225 3300009098 Bacteria 1306
63 Ga0105245_12698989 3300009098 Bacteria 550
64 Ga0105245_12980601 3300009098 Bacteria 525
65 Ga0105247_11007148 3300009101 Bacteria 651
66 Ga0105243_10097576 3300009148 Bacteria 2433
67 Ga0105243_10248170 3300009148 Bacteria 1588
68 Ga0105243_12874517 3300009148 Bacteria 522
69 Ga0105241_11589187 3300009174 Bacteria 632
70 Ga0105242_10210288 3300009176 Bacteria 1733
71 Ga0105242_10694677 3300009176 Bacteria 995
72 Ga0105242_11761829 3300009176 Bacteria 657
73 Ga0105242_13229291 3300009176 Bacteria 506
74 Ga0105248_10000329 3300009177 Bacteria 55993
75 Ga0105248_10703076 3300009177 Bacteria 1141
76 Ga0105237_12632775 3300009545 Bacteria 514
77 Ga0105238_10151202 3300009551 Bacteria 2296
78 Ga0105238_11729800 3300009551 Bacteria 657
79 Ga0105249_10648401 3300009553 Bacteria 1113
80 Ga0105239_10205073 3300010375 Bacteria 2209
81 Ga0105239_10540188 3300010375 Bacteria 1327
82 Ga0105239_11511485 3300010375 Bacteria 776
83 Ga0105246_10499680 3300011119 Bacteria 1033
84 Ga0105246_12238140 3300011119 Bacteria 533
85 Ga0157313_1042055 3300012503 Bacteria 564
86 Ga0157370_10892963 3300013104 Bacteria 807
87 Ga0157369_10805824 3300013105 Bacteria 965
88 Ga0157374_12971004 3300013296 Bacteria 501
89 Ga0163162_12396229 3300013306 Bacteria 607
90 Ga0163162_12884792 3300013306 Bacteria 553
91 Ga0157372_10104757 3300013307 Bacteria 3234
92 Ga0157372_10134341 3300013307 Bacteria 2848
93 Ga0157372_10241442 3300013307 Bacteria 2096
94 Ga0157372_12711762 3300013307 Bacteria 568
95 Ga0157375_10308365 3300013308 Bacteria 1747
96 Ga0157375_10370853 3300013308 Bacteria 1598
97 Ga0157375_10602686 3300013308 Bacteria 1257
98 Ga0157375_11078617 3300013308 Bacteria 939
99 Ga0163163_10057026 3300014325 Bacteria 3862
100 Ga0157380_10138133 3300014326 Bacteria 2089
101 Ga0157380_11793311 3300014326 Bacteria 673
102 Ga0157377_10130906 3300014745 Bacteria 1532
103 Ga0157377_11408362 3300014745 Bacteria 550
104 Ga0157379_10000011 3300014968 Bacteria 111920
105 Ga0157379_12667250 3300014968 Bacteria 501
106 Ga0157376_10503213 3300014969 Bacteria 1191
107 Ga0163161_11608129 3300017792 Bacteria 573
108 Ga0207656_10410554 3300025321 Bacteria 681
109 Ga0207688_10073515 3300025901 Bacteria 1943
110 Ga0207688_10137418 3300025901 Bacteria 1436
111 Ga0207645_10719152 3300025907 Bacteria 679
112 Ga0207643_10109860 3300025908 Bacteria 1624
113 Ga0207705_10251492 3300025909 Bacteria 1348
114 Ga0207705_10376950 3300025909 Bacteria 1095
115 Ga0207662_10936263 3300025918 Bacteria 614
116 Ga0207657_10502205 3300025919 Bacteria 950
117 Ga0207649_10528732 3300025920 Bacteria 900
118 Ga0207652_11196515 3300025921 Bacteria 662
119 Ga0207650_10692747 3300025925 Bacteria 860
120 Ga0207687_10109950 3300025927 Bacteria 2043
121 Ga0207687_10340785 3300025927 Bacteria 1219
122 Ga0207687_11770363 3300025927 Bacteria 529
123 Ga0207644_10461346 3300025931 Bacteria 1044
124 Ga0207706_10904097 3300025933 Bacteria 745
125 Ga0207686_10530913 3300025934 Bacteria 917
126 Ga0207709_10273150 3300025935 Bacteria 1245
127 Ga0207669_10242507 3300025937 Bacteria 1337
128 Ga0207704_11261030 3300025938 Bacteria 631
129 Ga0207691_10556547 3300025940 Bacteria 972
130 Ga0207711_10000270 3300025941 Bacteria 56050
131 Ga0207711_11081990 3300025941 Bacteria 742
132 Ga0207679_10008118 3300025945 Bacteria 6678
133 Ga0207679_10188728 3300025945 Bacteria 1712
134 Ga0207712_10424431 3300025961 Bacteria 1122
135 Ga0207712_10663088 3300025961 Bacteria 908
136 Ga0207712_10965374 3300025961 Bacteria 755
137 Ga0207668_11737974 3300025972 Bacteria 563
138 Ga0207658_10006377 3300025986 Bacteria 8052
139 Ga0207658_10380178 3300025986 Bacteria 1237
140 Ga0207658_10595759 3300025986 Bacteria 993
141 Ga0207677_12210989 3300026023 Bacteria 512
142 Ga0207703_10000066 3300026035 Bacteria 125891
143 Ga0207703_10012143 3300026035 Bacteria 6713
144 Ga0207678_10078160 3300026067 Bacteria 2834
145 Ga0207678_10132545 3300026067 Bacteria 2126
146 Ga0207708_11834912 3300026075 Bacteria 532
147 Ga0207702_10887193 3300026078 Bacteria 883
148 Ga0207641_10002941 3300026088 Bacteria 15408
149 Ga0207676_10381060 3300026095 Bacteria 1313
150 Ga0207675_100700169 3300026118 Bacteria 1022
151 Ga0207683_10066661 3300026121 Bacteria 3175
152 Ga0207683_10110746 3300026121 Bacteria 2458
153 Ga0207683_10162242 3300026121 Bacteria 2021
154 Ga0207683_10783289 3300026121 Bacteria 885
155 Ga0207683_10829628 3300026121 Bacteria 858
156 Ga0207683_11010756 3300026121 Bacteria 772
157 Ga0207698_11857007 3300026142 Bacteria 617
158 Ga0268266_10001743 3300028379 Bacteria 24876
159 Ga0268266_10621148 3300028379 Bacteria 1039
160 Ga0268266_11795332 3300028379 Bacteria 588
161 Ga0268264_10000031 3300028381 Bacteria 409525
162 Ga0307512_10271272 3300030522 Bacteria 821
163 Ga0316181_1092082 3300030744 Bacteria 1099
164 Ga0316182_1169914 3300030745 Bacteria 3075
165 Ga0307513_10395983 3300031456 Bacteria 1117
166 Ga0307408_100622564 3300031548 Bacteria 962
167 Ga0307408_100781281 3300031548 Bacteria 865
168 Ga0307413_10847686 3300031824 Bacteria 772
169 Ga0307518_10346112 3300031838 Bacteria 869
170 Ga0307410_10036321 3300031852 Bacteria 3208
171 Ga0307406_10115359 3300031901 Bacteria 1857
172 Ga0307412_10362328 3300031911 Bacteria 1168
173 Ga0307409_100003814 3300031995 Bacteria 8314
174 Ga0307409_100374042 3300031995 Bacteria 1352
175 Ga0307409_100712610 3300031995 Bacteria 1004
176 Ga0307409_101169880 3300031995 Bacteria 792
177 Ga0307409_102057124 3300031995 Bacteria 601
178 Ga0307409_102734650 3300031995 Bacteria 521
179 Ga0307416_101022326 3300032002 Bacteria 930
180 Ga0307416_101110514 3300032002 Bacteria 895
181 Ga0307414_10211969 3300032004 Bacteria 1584
182 Ga0307415_100943114 3300032126 Bacteria 798
183 Ga0307415_101426267 3300032126 Bacteria 660
184 Ga0307507_10510447 3300033179 Bacteria 645
185 Ga0395900_0916984 3300037418 Bacteria 799
186 Ga0395898_0690039 3300037466 Bacteria 963
187 Ga0395898_1535513 3300037466 Bacteria 591
188 Ga0395901_0607093 3300038443 Bacteria 1103
189 Ga0395901_1321112 3300038443 Bacteria 682
190 Ga0439465_0108178 3300041413 Bacteria 965
191 Ga0451789_0310276 3300041443 Bacteria 1744
192 Ga0451789_0588037 3300041443 Bacteria 527
193 Ga0451791_0021333 3300041451 Bacteria 7709
194 Ga0451791_0906780 3300041451 Bacteria 776
195 Ga0451791_1036282 3300041451 Bacteria 552
196 Ga0451793_0244312 3300041452 Bacteria 809
197 Ga0451793_0474619 3300041452 Bacteria 1928
198 Ga0451797_1118349 3300041453 Bacteria 4306
199 Ga0451797_1200370 3300041453 Bacteria 1265
200 Ga0451795_1020297 3300041456 Bacteria 2236
201 Ga0451800_0317399 3300041459 Bacteria 848
202 Ga0451800_0951511 3300041459 Bacteria 1450
203 Ga0451807_0527569 3300041486 Bacteria 567
204 Ga0451807_1358197 3300041486 Bacteria 898
205 Ga0451833_1252689 3300041491 Bacteria 10277
206 Ga0451837_0154696 3300041494 Bacteria 1917
207 Ga0451841_0879553 3300041498 Bacteria 2118
208 Ga0451847_0267762 3300041503 Bacteria 763
209 Ga0451849_0078271 3300041505 Bacteria 1912
210 Ga0451843_0666867 3300041509 Bacteria 2925
211 Ga0451843_0670129 3300041509 Bacteria 505
212 Ga0451843_1584356 3300041509 Bacteria 2174
213 Ga0451855_0466905 3300041511 Bacteria 733
214 Ga0451853_0127500 3300041512 Bacteria 949
215 Ga0451853_0824003 3300041512 Bacteria 6114
216 Ga0451853_1953813 3300041512 Bacteria 2133
217 Ga0439445_0095808 3300042004 Bacteria 839
218 Ga0439455_0091171 3300042012 Bacteria 836
219 Ga0450902_079340 3300042137 Bacteria 576
220 Ga0439446_0225480 3300042156 Bacteria 640
221 Ga0439434_0067674 3300042435 Bacteria 1122
222 Ga0466957_1145196 3300044842 Bacteria 562
223 Ga0495627_034321 3300046453 Bacteria 1586
224 Ga0495603_0088068 3300046455 Bacteria 1817
225 Ga0495629_0385991 3300046459 Bacteria 953
226 Ga0495641_0074001 3300046461 Bacteria 1528
227 Ga0495651_0045116 3300046462 Bacteria 3415
228 Ga0495651_0316970 3300046462 Bacteria 1041
229 Ga0495653_0034801 3300046463 Bacteria 3979
230 Ga0495653_0072924 3300046463 Bacteria 2563
231 Ga0495653_0468592 3300046463 Bacteria 790
232 Ga0495585_0234492 3300046492 Bacteria 921
233 Ga0495608_0097818 3300046511 Bacteria 1894
234 Ga0495618_0226942 3300046514 Bacteria 1177
235 Ga0495665_0311552 3300046531 Bacteria 805
236 Ga0495645_0143560 3300046543 Bacteria 1664
237 Ga0495645_0268112 3300046543 Bacteria 1128
238 Ga0495622_0184756 3300046557 Bacteria 934
239 Ga0495667_0662591 3300046559 Bacteria 648
240 Ga0495667_0663866 3300046559 Bacteria 647
241 Ga0495625_0428371 3300046660 Bacteria 821
242 Ga0495625_0631407 3300046660 Bacteria 640
243 Ga0495623_0389621 3300046679 Bacteria 752
244 Ga0495658_0143391 3300046683 Bacteria 1462
245 Ga0495613_0257015 3300046689 Bacteria 1218
246 Ga0495624_0158539 3300046690 Bacteria 1383
247 Ga0495671_0593845 3300046692 Bacteria 527
248 Ga0495600_0514685 3300046809 Bacteria 734
249 Ga0495581_0340276 3300047315 Bacteria 876
250 Ga0495672_0117191 3300047320 Bacteria 1421
251 Ga0495684_0776974 3300047471 Bacteria 628
252 Ga0496100_0258846 3300048903 Bacteria 1290
253 Ga0496100_0710315 3300048903 Bacteria 785
254 Ga0496101_0026534 3300048904 Bacteria 4028
255 Ga0496102_0010874 3300048905 Bacteria 7836
256 Ga0496102_0071354 3300048905 Bacteria 3189
257 Ga0496104_0022269 3300048907 Bacteria 5821
258 Ga0496104_0103828 3300048907 Bacteria 2723
259 Ga0496104_1382593 3300048907 Bacteria 607
260 Ga0496105_0106560 3300048908 Bacteria 2314
261 Ga0496105_0177070 3300048908 Bacteria 1747
262 Ga0496105_0216270 3300048908 Bacteria 1561
263 Ga0496105_0556144 3300048908 Bacteria 895
264 Ga0496108_0114867 3300048911 Bacteria 2305
265 Ga0496108_0163619 3300048911 Bacteria 1924
266 Ga0496108_0407960 3300048911 Bacteria 1187
267 Ga0496108_0968811 3300048911 Bacteria 728
268 Ga0496109_0301709 3300048912 Bacteria 1510
269 Ga0496109_0584979 3300048912 Bacteria 1052
270 Ga0496109_0907497 3300048912 Bacteria 819
271 Ga0496110_0276415 3300048913 Bacteria 1529
272 Ga0496111_0246292 3300048914 Bacteria 1327
273 Ga0496113_0442703 3300048916 Bacteria 1044
274 Ga0496113_1472407 3300048916 Bacteria 526
275 Ga0496114_0024471 3300048917 Bacteria 4930
276 Ga0496114_0025458 3300048917 Bacteria 4837
277 Ga0496114_0071741 3300048917 Bacteria 2911
278 Ga0496114_0329191 3300048917 Bacteria 1350
279 Ga0496114_0334926 3300048917 Bacteria 1338
280 Ga0496114_0398157 3300048917 Bacteria 1219
281 Ga0496114_0461618 3300048917 Bacteria 1124
282 Ga0496115_1190115 3300048918 Bacteria 573
283 Ga0496119_0001612 3300048922 Bacteria 26721
284 Ga0496119_0002510 3300048922 Bacteria 20042
285 Ga0496120_0003507 3300048923 Bacteria 14216
286 Ga0496121_0640960 3300048924 Bacteria 649
287 Ga0496122_0009938 3300048925 Bacteria 9910
288 Ga0496123_0010411 3300048926 Bacteria 8221
289 Ga0496124_0011954 3300048927 Bacteria 8637
290 Ga0496124_0103028 3300048927 Bacteria 2309
291 Ga0496125_0009962 3300048928 Bacteria 9658
292 Ga0496126_0006708 3300048929 Bacteria 12785
293 Ga0496126_0130127 3300048929 Bacteria 2175
294 Ga0501034_0175396 3300049571 Bacteria 2110
295 Ga0501038_0597816 3300049574 Bacteria 835
296 Ga0501039_1003523 3300049575 Bacteria 648
297 Ga0501039_1457503 3300049575 Bacteria 526
298 Ga0501070_0000902 3300049586 Bacteria 27057
299 nmdc:mga00v17_10789_c1 3300050491 Bacteria 5004
300 nmdc:mga07m45_63732_c1 3300050496 Bacteria 1056
301 Ga0495601_0744504 3300053077 Bacteria 624
302 Ga0495655_0020320 3300053083 Bacteria 1488
303 Ga0495595_0050601 3300053084 Bacteria 1925
304 Ga0495595_0175707 3300053084 Bacteria 1061
305 Ga0495595_0285332 3300053084 Bacteria 829
306 Ga0495619_0081039 3300053085 Bacteria 2185
307 Ga0500556_0001332 3300053104 Bacteria 10929
308 Ga0500593_000847 3300053117 Bacteria 11384
309 Ga0500568_0296453 3300053139 Bacteria 587
310 Ga0500573_0002868 3300053140 Bacteria 8765
311 Ga0500616_0175443 3300053153 Bacteria 969
312 Ga0163163_10331710
313 JGI24739J22299_10159002
314 Ga0070658_10203528
315 Ga0070683_100497197
316 Ga0070683_101172272
317 Ga0070683_101365696
318 Ga0070690_101133803
319 Ga0070670_100108776
320 Ga0070670_101528018
321 Ga0070666_10026297
322 Ga0070682_100260307
323 Ga0070682_101582256
324 Ga0070660_100617484
325 Ga0070661_100102040
326 Ga0070692_10843273
327 Ga0070668_100941781
328 Ga0070668_102088940
329 Ga0070669_101150856
330 Ga0070675_100876733
331 Ga0070671_100449486
332 Ga0070674_100091047
333 Ga0070674_101340649
334 Ga0070688_100531907
335 Ga0070667_100002903
336 Ga0070663_100332514
337 Ga0070663_101347079
338 Ga0070663_101773108
339 Ga0070678_100192293
340 Ga0070678_102053086
341 Ga0068867_100515723
342 Ga0070685_10409067
343 Ga0070698_101141390
344 Ga0070672_100455144
345 Ga0070693_100911961
346 Ga0070693_101037706
347 Ga0070665_100001319
348 Ga0070665_100506978
349 Ga0070664_100027514
350 Ga0068856_100315086
351 Ga0070702_101264995
352 Ga0068852_100171333
353 Ga0068852_100578120
354 Ga0068852_101015417
355 Ga0068852_101381360
356 Ga0068852_102062776
357 Ga0068864_100994603
358 Ga0068861_100673959
359 Ga0068863_100081088
360 Ga0068858_100000074
361 Ga0068858_100017074
362 Ga0068860_100000035
363 Ga0068862_101739625
364 Ga0081455_10000070
365 Ga0070717_10344209
366 Ga0075364_10001401
367 Ga0075367_10508783
368 Ga0075370_10082522
369 Ga0068865_101701683
370 Ga0105240_12081491
371 Ga0105245_10037736
372 Ga0105245_10288029
373 Ga0105245_10443225
374 Ga0105245_12698989
375 Ga0105245_12980601
376 Ga0105247_11007148
377 Ga0105243_10097576
378 Ga0105243_10248170
379 Ga0105243_12874517
380 Ga0105241_11589187
381 Ga0105242_10210288
382 Ga0105242_10694677
383 Ga0105242_11761829
384 Ga0105242_13229291
385 Ga0105248_10000329
386 Ga0105248_10703076
387 Ga0105237_12632775
388 Ga0105238_10151202
389 Ga0105238_11729800
390 Ga0105249_10648401
391 Ga0105239_10205073
392 Ga0105239_10540188
393 Ga0105239_11511485
394 Ga0105246_10499680
395 Ga0105246_12238140
396 Ga0157313_1042055
397 Ga0157370_10892963
398 Ga0157369_10805824
399 Ga0157374_12971004
400 Ga0163162_12396229
401 Ga0163162_12884792
402 Ga0157372_10104757
403 Ga0157372_10134341
404 Ga0157372_10241442
405 Ga0157372_12711762
406 Ga0157375_10308365
407 Ga0157375_10370853
408 Ga0157375_10602686
409 Ga0157375_11078617
410 Ga0163163_10057026
411 Ga0157380_10138133
412 Ga0157380_11793311
413 Ga0157377_10130906
414 Ga0157377_11408362
415 Ga0157379_10000011
416 Ga0157379_12667250
417 Ga0157376_10503213
418 Ga0163161_11608129
419 Ga0207656_10410554
420 Ga0207688_10073515
421 Ga0207688_10137418
422 Ga0207645_10719152
423 Ga0207643_10109860
424 Ga0207705_10251492
425 Ga0207705_10376950
426 Ga0207662_10936263
427 Ga0207657_10502205
428 Ga0207649_10528732
429 Ga0207652_11196515
430 Ga0207650_10692747
431 Ga0207687_10109950
432 Ga0207687_10340785
433 Ga0207687_11770363
434 Ga0207644_10461346
435 Ga0207706_10904097
436 Ga0207686_10530913
437 Ga0207709_10273150
438 Ga0207669_10242507
439 Ga0207704_11261030
440 Ga0207691_10556547
441 Ga0207711_10000270
442 Ga0207711_11081990
443 Ga0207679_10008118
444 Ga0207679_10188728
445 Ga0207712_10424431
446 Ga0207712_10663088
447 Ga0207712_10965374
448 Ga0207668_11737974
449 Ga0207658_10006377
450 Ga0207658_10380178
451 Ga0207658_10595759
452 Ga0207677_12210989
453 Ga0207703_10000066
454 Ga0207703_10012143
455 Ga0207678_10078160
456 Ga0207678_10132545
457 Ga0207708_11834912
458 Ga0207702_10887193
459 Ga0207641_10002941
460 Ga0207676_10381060
461 Ga0207675_100700169
462 Ga0207683_10066661
463 Ga0207683_10110746
464 Ga0207683_10162242
465 Ga0207683_10783289
466 Ga0207683_10829628
467 Ga0207683_11010756
468 Ga0207698_11857007
469 Ga0268266_10001743
470 Ga0268266_10621148
471 Ga0268266_11795332
472 Ga0268264_10000031
473 Ga0307512_10271272
474 Ga0316181_1092082
475 Ga0316182_1169914
476 Ga0307513_10395983
477 Ga0307408_100622564
478 Ga0307408_100781281
479 Ga0307413_10847686
480 Ga0307518_10346112
481 Ga0307410_10036321
482 Ga0307406_10115359
483 Ga0307412_10362328
484 Ga0307409_100003814
485 Ga0307409_100374042
486 Ga0307409_100712610
487 Ga0307409_101169880
488 Ga0307409_102057124
489 Ga0307409_102734650
490 Ga0307416_101022326
491 Ga0307416_101110514
492 Ga0307414_10211969
493 Ga0307415_100943114
494 Ga0307415_101426267
495 Ga0307507_10510447
496 Ga0395900_0916984
497 Ga0395898_0690039
498 Ga0395898_1535513
499 Ga0395901_0607093
500 Ga0395901_1321112
501 Ga0439465_0108178
502 Ga0451789_0310276
503 Ga0451789_0588037
504 Ga0451791_0021333
505 Ga0451791_0906780
506 Ga0451791_1036282
507 Ga0451793_0244312
508 Ga0451793_0474619
509 Ga0451797_1118349
510 Ga0451797_1200370
511 Ga0451795_1020297
512 Ga0451800_0317399
513 Ga0451800_0951511
514 Ga0451807_0527569
515 Ga0451807_1358197
516 Ga0451833_1252689
517 Ga0451837_0154696
518 Ga0451841_0879553
519 Ga0451847_0267762
520 Ga0451849_0078271
521 Ga0451843_0666867
522 Ga0451843_0670129
523 Ga0451843_1584356
524 Ga0451855_0466905
525 Ga0451853_0127500
526 Ga0451853_0824003
527 Ga0451853_1953813
528 Ga0439445_0095808
529 Ga0439455_0091171
530 Ga0450902_079340
531 Ga0439446_0225480
532 Ga0439434_0067674
533 Ga0466957_1145196
534 Ga0495627_034321
535 Ga0495603_0088068
536 Ga0495629_0385991
537 Ga0495641_0074001
538 Ga0495651_0045116
539 Ga0495651_0316970
540 Ga0495653_0034801
541 Ga0495653_0072924
542 Ga0495653_0468592
543 Ga0495585_0234492
544 Ga0495608_0097818
545 Ga0495618_0226942
546 Ga0495665_0311552
547 Ga0495645_0143560
548 Ga0495645_0268112
549 Ga0495622_0184756
550 Ga0495667_0662591
551 Ga0495667_0663866
552 Ga0495625_0428371
553 Ga0495625_0631407
554 Ga0495623_0389621
555 Ga0495658_0143391
556 Ga0495613_0257015
557 Ga0495624_0158539
558 Ga0495671_0593845
559 Ga0495600_0514685
560 Ga0495581_0340276
561 Ga0495672_0117191
562 Ga0495684_0776974
563 Ga0496100_0258846
564 Ga0496100_0710315
565 Ga0496101_0026534
566 Ga0496102_0010874
567 Ga0496102_0071354
568 Ga0496104_0022269
569 Ga0496104_0103828
570 Ga0496104_1382593
571 Ga0496105_0106560
572 Ga0496105_0177070
573 Ga0496105_0216270
574 Ga0496105_0556144
575 Ga0496108_0114867
576 Ga0496108_0163619
577 Ga0496108_0407960
578 Ga0496108_0968811
579 Ga0496109_0301709
580 Ga0496109_0584979
581 Ga0496109_0907497
582 Ga0496110_0276415
583 Ga0496111_0246292
584 Ga0496113_0442703
585 Ga0496113_1472407
586 Ga0496114_0024471
587 Ga0496114_0025458
588 Ga0496114_0071741
589 Ga0496114_0329191
590 Ga0496114_0334926
591 Ga0496114_0398157
592 Ga0496114_0461618
593 Ga0496115_1190115
594 Ga0496119_0001612
595 Ga0496119_0002510
596 Ga0496120_0003507
597 Ga0496121_0640960
598 Ga0496122_0009938
599 Ga0496123_0010411
600 Ga0496124_0011954
601 Ga0496124_0103028
602 Ga0496125_0009962
603 Ga0496126_0006708
604 Ga0496126_0130127
605 Ga0501034_0175396
606 Ga0501038_0597816
607 Ga0501039_1003523
608 Ga0501039_1457503
609 Ga0501070_0000902
610 nmdc:mga00v17_10789_c1
611 nmdc:mga07m45_63732_c1
612 Ga0495601_0744504
613 Ga0495655_0020320
614 Ga0495595_0050601
615 Ga0495595_0175707
616 Ga0495595_0285332
617 Ga0495619_0081039
618 Ga0500556_0001332
619 Ga0500593_000847
620 Ga0500568_0296453
621 Ga0500573_0002868
622 Ga0500616_0175443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00547

Urease_gamma

Urease, gamma subunit

21

119

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.9371 2 100
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.9282 2 100
4fur-assembly1.cif.gz_A crystal structure of urease subunit gamma 2 from brucella melitensis biovar abortus 2308 0.9137 1 100
6zo0-assembly1.cif.gz_AAA 2.23 a resolution 3,4-dimethylcatechol (3,4-dimethylbenzene-1,2-diol) inhibited sporosarcina pasteurii urease 0.9081 2 100
7kns-assembly1.cif.gz_F cryo-em structure of jack bean urease 0.9063 1 100
ID Description Score Start End Superfamily
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9145 4 100 3.30.280.10
1a5kA00 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9032 1 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.8801 4 100 3.30.280.10
af_P76418_2_329_1.10.4080.10 Mainly Alpha;Orthogonal Bundle;ADP-ribosylglycohydrolase fold;ADP-ribosylation/Crystallin J1 0.791 33 72 1.10.4080.10
4gtnA01 Mainly Alpha;Up-down Bundle;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3;Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 0.5035 12 68 1.20.970.10
ID Description Score Start End GO Terms
AF-A0A812T7F5-F1-model_v4 Uncharacterized protein 0.9835 17 80 GO:0016151
GO:0016787
GO:0043419
AF-A0A7C8TIT0-F1-model_v4 deleted 0.9714 12 88
AF-A0A7S2IHC4-F1-model_v4 urease (EC 3.5.1.5) 0.9667 27 100 GO:0016151
GO:0016787
GO:0035550
GO:0043419
AF-A0A0A8EEL4-F1-model_v4 urease (EC 3.5.1.5) 0.9651 16 100 GO:0009039
GO:0016151
GO:0035550
GO:0043419
AF-A0A2T7PPG9-F1-model_v4 urease (EC 3.5.1.5) 0.9635 16 100 GO:0009039
GO:0016020
GO:0016151
GO:0035550
GO:0043419

Map