F401208
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 311 | 224 | 309 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10089471|Ga0163163_100894714 |
| Length | 226 |
| Sequence | MIMRVATCSRGQDRSDCGRLDPRDRGKGEQAVRSLRYSINVTLDGCCDHQAGVADEELHRHHAANLARADALLLGRVTYEMMEEAWRQSATGTWPEWMADWMVPFARTIDVAKKYVVSSTLERVDWNAELVQGDLAKAVVQLKQEPGSGLAVGGVTLPLALADLGLIDEYEFVVQPIVAGHGPTLFAGLSERLELKLVGRQEFRSGAVALRYQPAESRPEAGRVTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 116 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 117 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 118 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 120 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 130 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 132 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 133 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 136 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 139 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 142 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 145 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 146 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 147 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 148 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 149 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 179 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 182 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 183 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 184 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 185 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 186 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 224 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0 |
| Isolates | 0.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.89 |
| Nodule | 0.96 |
| Rhizoplane | 0.96 |
| Rhizosphere | 89.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10031260 | 3300003322 | Bacteria | 1554 |
| 2 | Ga0055524_1000340 | 3300003775 | Bacteria | 42965 |
| 3 | Ga0055540_1025093 | 3300003792 | Bacteria | 1466 |
| 4 | Ga0055531_10000152 | 3300003794 | Bacteria | 80208 |
| 5 | Ga0070658_10002911 | 3300005327 | Bacteria | 14195 |
| 6 | Ga0070683_100125920 | 3300005329 | Bacteria | 2422 |
| 7 | Ga0070683_100616551 | 3300005329 | Bacteria | 1039 |
| 8 | Ga0070690_100440901 | 3300005330 | Bacteria | 964 |
| 9 | Ga0070670_100065398 | 3300005331 | Bacteria | 3120 |
| 10 | Ga0070670_100080621 | 3300005331 | Bacteria | 2797 |
| 11 | Ga0070666_10142356 | 3300005335 | Bacteria | 1670 |
| 12 | Ga0070666_10188517 | 3300005335 | Bacteria | 1449 |
| 13 | Ga0070680_100025953 | 3300005336 | Bacteria | 4686 |
| 14 | Ga0068868_100004939 | 3300005338 | Bacteria | 9370 |
| 15 | Ga0068868_100310310 | 3300005338 | Bacteria | 1342 |
| 16 | Ga0070660_100761022 | 3300005339 | Bacteria | 814 |
| 17 | Ga0070689_100338369 | 3300005340 | Bacteria | 1260 |
| 18 | Ga0070661_100023487 | 3300005344 | Bacteria | 4420 |
| 19 | Ga0070692_10027187 | 3300005345 | Bacteria | 2833 |
| 20 | Ga0070671_100099429 | 3300005355 | Bacteria | 2440 |
| 21 | Ga0070674_100092721 | 3300005356 | Bacteria | 2184 |
| 22 | Ga0070674_100655615 | 3300005356 | Bacteria | 893 |
| 23 | Ga0070659_100312092 | 3300005366 | Bacteria | 1313 |
| 24 | Ga0070667_100162146 | 3300005367 | Bacteria | 1970 |
| 25 | Ga0070714_100000801 | 3300005435 | Bacteria | 22250 |
| 26 | Ga0070714_100810773 | 3300005435 | Bacteria | 907 |
| 27 | Ga0070713_100010652 | 3300005436 | Bacteria | 6654 |
| 28 | Ga0068867_100536122 | 3300005459 | Bacteria | 1011 |
| 29 | Ga0070706_100004644 | 3300005467 | Bacteria | 13186 |
| 30 | Ga0070698_100000353 | 3300005471 | Bacteria | 47490 |
| 31 | Ga0070699_100109376 | 3300005518 | Bacteria | 2426 |
| 32 | Ga0070679_100169536 | 3300005530 | Bacteria | 2156 |
| 33 | Ga0070679_100608272 | 3300005530 | Bacteria | 1036 |
| 34 | Ga0068853_100045144 | 3300005539 | Bacteria | 3774 |
| 35 | Ga0068853_100552638 | 3300005539 | Bacteria | 1091 |
| 36 | Ga0070696_100009360 | 3300005546 | Bacteria | 6559 |
| 37 | Ga0070693_100022590 | 3300005547 | Bacteria | 3348 |
| 38 | Ga0068855_100381133 | 3300005563 | Bacteria | 1548 |
| 39 | Ga0070664_100033070 | 3300005564 | Bacteria | 4328 |
| 40 | Ga0070664_100351103 | 3300005564 | Bacteria | 1342 |
| 41 | Ga0068857_100030851 | 3300005577 | Bacteria | 4735 |
| 42 | Ga0068856_100075914 | 3300005614 | Bacteria | 3329 |
| 43 | Ga0068852_100017584 | 3300005616 | Bacteria | 5614 |
| 44 | Ga0068852_100091639 | 3300005616 | Bacteria | 2720 |
| 45 | Ga0068852_100921069 | 3300005616 | Bacteria | 891 |
| 46 | Ga0068859_100000524 | 3300005617 | Bacteria | 38111 |
| 47 | Ga0068864_100292860 | 3300005618 | Bacteria | 1522 |
| 48 | Ga0068866_10153809 | 3300005718 | Bacteria | 1335 |
| 49 | Ga0068851_10020624 | 3300005834 | Bacteria | 3192 |
| 50 | Ga0068851_10515295 | 3300005834 | Bacteria | 719 |
| 51 | Ga0068863_100339304 | 3300005841 | Bacteria | 1462 |
| 52 | Ga0068860_100238113 | 3300005843 | Bacteria | 1770 |
| 53 | Ga0068862_100002395 | 3300005844 | Bacteria | 16675 |
| 54 | Ga0070717_10246116 | 3300006028 | Bacteria | 1578 |
| 55 | Ga0075366_10205275 | 3300006195 | Bacteria | 1199 |
| 56 | Ga0097621_100032320 | 3300006237 | Bacteria | 4159 |
| 57 | Ga0097621_100740650 | 3300006237 | Bacteria | 907 |
| 58 | Ga0075428_101245336 | 3300006844 | Bacteria | 783 |
| 59 | Ga0075431_100078045 | 3300006847 | Bacteria | 3418 |
| 60 | Ga0075433_10010601 | 3300006852 | Bacteria | 7409 |
| 61 | Ga0075433_10116570 | 3300006852 | Bacteria | 2370 |
| 62 | Ga0075434_100041468 | 3300006871 | Bacteria | 4560 |
| 63 | Ga0075434_100075106 | 3300006871 | Bacteria | 3373 |
| 64 | Ga0075434_100127752 | 3300006871 | Bacteria | 2559 |
| 65 | Ga0075434_100282560 | 3300006871 | Bacteria | 1679 |
| 66 | Ga0075429_100030116 | 3300006880 | Bacteria | 4715 |
| 67 | Ga0075429_100694367 | 3300006880 | Bacteria | 891 |
| 68 | Ga0068865_100508193 | 3300006881 | Bacteria | 1006 |
| 69 | Ga0097620_100000524 | 3300006931 | Bacteria | 38111 |
| 70 | Ga0079104_1000328 | 3300006946 | Bacteria | 58129 |
| 71 | Ga0075435_100049171 | 3300007076 | Bacteria | 3390 |
| 72 | Ga0075435_100435092 | 3300007076 | Bacteria | 1130 |
| 73 | Ga0105240_10410936 | 3300009093 | Bacteria | 1522 |
| 74 | Ga0105240_10439125 | 3300009093 | Bacteria | 1463 |
| 75 | Ga0111539_10267008 | 3300009094 | Bacteria | 1992 |
| 76 | Ga0114129_10081022 | 3300009147 | Bacteria | 4512 |
| 77 | Ga0114129_10799650 | 3300009147 | Bacteria | 1203 |
| 78 | Ga0105243_11109075 | 3300009148 | Bacteria | 800 |
| 79 | Ga0105241_10099034 | 3300009174 | Bacteria | 2314 |
| 80 | Ga0105241_10327670 | 3300009174 | Bacteria | 1322 |
| 81 | Ga0105248_10503009 | 3300009177 | Bacteria | 1366 |
| 82 | Ga0105248_10880382 | 3300009177 | Bacteria | 1011 |
| 83 | Ga0157373_10027175 | 3300013100 | Bacteria | 4128 |
| 84 | Ga0157373_10170431 | 3300013100 | Bacteria | 1532 |
| 85 | Ga0157373_10384836 | 3300013100 | Bacteria | 1004 |
| 86 | Ga0157369_10059019 | 3300013105 | Bacteria | 4138 |
| 87 | Ga0157369_10063384 | 3300013105 | Bacteria | 3983 |
| 88 | Ga0157374_10114057 | 3300013296 | Bacteria | 2601 |
| 89 | Ga0157374_10623634 | 3300013296 | Bacteria | 1089 |
| 90 | Ga0157374_11270904 | 3300013296 | Bacteria | 758 |
| 91 | Ga0157372_10034957 | 3300013307 | Bacteria | 5530 |
| 92 | Ga0157372_11283663 | 3300013307 | Bacteria | 845 |
| 93 | Ga0163163_10089471 | 3300014325 | Bacteria | 3091 |
| 94 | Ga0163163_10250919 | 3300014325 | Bacteria | 1820 |
| 95 | Ga0157379_10075929 | 3300014968 | Bacteria | 3009 |
| 96 | Ga0157379_11501889 | 3300014968 | Bacteria | 655 |
| 97 | Ga0157376_10045747 | 3300014969 | Bacteria | 3606 |
| 98 | Ga0157376_11171754 | 3300014969 | Bacteria | 796 |
| 99 | Ga0163161_10059677 | 3300017792 | Bacteria | 2775 |
| 100 | Ga0209565_1001678 | 3300025263 | Bacteria | 9208 |
| 101 | Ga0209256_1000120 | 3300025299 | Bacteria | 167691 |
| 102 | Ga0209051_1000059 | 3300025303 | Bacteria | 260307 |
| 103 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 104 | Ga0207656_10010642 | 3300025321 | Bacteria | 3452 |
| 105 | Ga0207680_10039867 | 3300025903 | Bacteria | 2728 |
| 106 | Ga0207645_10115476 | 3300025907 | Bacteria | 1740 |
| 107 | Ga0207705_10001954 | 3300025909 | Bacteria | 16079 |
| 108 | Ga0207684_10004452 | 3300025910 | Bacteria | 13193 |
| 109 | Ga0207695_10435185 | 3300025913 | Bacteria | 1195 |
| 110 | Ga0207693_10126303 | 3300025915 | Bacteria | 2010 |
| 111 | Ga0207662_10574207 | 3300025918 | Bacteria | 783 |
| 112 | Ga0207649_10033290 | 3300025920 | Bacteria | 3078 |
| 113 | Ga0207652_10042760 | 3300025921 | Bacteria | 3858 |
| 114 | Ga0207681_10128605 | 3300025923 | Bacteria | 1869 |
| 115 | Ga0207650_10025117 | 3300025925 | Unclassified | 4243 |
| 116 | Ga0207687_10419359 | 3300025927 | Bacteria | 1104 |
| 117 | Ga0207700_11047404 | 3300025928 | Bacteria | 730 |
| 118 | Ga0207664_10109868 | 3300025929 | Bacteria | 2291 |
| 119 | Ga0207644_10146635 | 3300025931 | Bacteria | 1822 |
| 120 | Ga0207706_10203039 | 3300025933 | Bacteria | 1738 |
| 121 | Ga0207686_10244164 | 3300025934 | Bacteria | 1308 |
| 122 | Ga0207709_10595269 | 3300025935 | Bacteria | 875 |
| 123 | Ga0207669_10155847 | 3300025937 | Bacteria | 1606 |
| 124 | Ga0207704_10550563 | 3300025938 | Bacteria | 937 |
| 125 | Ga0207661_10177491 | 3300025944 | Bacteria | 1858 |
| 126 | Ga0207661_10356267 | 3300025944 | Bacteria | 1321 |
| 127 | Ga0207679_10037290 | 3300025945 | Bacteria | 3454 |
| 128 | Ga0207679_10058241 | 3300025945 | Bacteria | 2861 |
| 129 | Ga0207679_10069791 | 3300025945 | Bacteria | 2646 |
| 130 | Ga0207679_10218151 | 3300025945 | Bacteria | 1604 |
| 131 | Ga0207712_10143299 | 3300025961 | Bacteria | 1836 |
| 132 | Ga0207712_10218532 | 3300025961 | Bacteria | 1522 |
| 133 | Ga0207668_10399709 | 3300025972 | Bacteria | 1161 |
| 134 | Ga0207640_10051999 | 3300025981 | Bacteria | 2666 |
| 135 | Ga0207658_10114578 | 3300025986 | Bacteria | 2138 |
| 136 | Ga0207677_10006364 | 3300026023 | Bacteria | 6473 |
| 137 | Ga0207677_10297101 | 3300026023 | Bacteria | 1333 |
| 138 | Ga0207639_10106961 | 3300026041 | Bacteria | 2271 |
| 139 | Ga0207678_10084924 | 3300026067 | Bacteria | 2707 |
| 140 | Ga0207641_11236936 | 3300026088 | Bacteria | 747 |
| 141 | Ga0207648_10025434 | 3300026089 | Bacteria | 5273 |
| 142 | Ga0207648_10139620 | 3300026089 | Bacteria | 2135 |
| 143 | Ga0207676_10026880 | 3300026095 | Bacteria | 4281 |
| 144 | Ga0207676_10112287 | 3300026095 | Bacteria | 2283 |
| 145 | Ga0207674_10013961 | 3300026116 | Bacteria | 8884 |
| 146 | Ga0207674_11013420 | 3300026116 | Bacteria | 799 |
| 147 | Ga0207675_100025074 | 3300026118 | Bacteria | 5550 |
| 148 | Ga0207698_10019204 | 3300026142 | Bacteria | 4675 |
| 149 | Ga0207698_10760861 | 3300026142 | Bacteria | 968 |
| 150 | Ga0209281_1000455 | 3300027111 | Bacteria | 58143 |
| 151 | Ga0209968_1009565 | 3300027526 | Bacteria | 1484 |
| 152 | Ga0209966_1006715 | 3300027695 | Bacteria | 2003 |
| 153 | Ga0268266_10001353 | 3300028379 | Bacteria | 29617 |
| 154 | Ga0268265_10001883 | 3300028380 | Bacteria | 16688 |
| 155 | Ga0268264_10227199 | 3300028381 | Bacteria | 1721 |
| 156 | Ga0265319_1016626 | 3300028563 | Bacteria | 2818 |
| 157 | Ga0265336_10028297 | 3300028666 | Bacteria | 1752 |
| 158 | Ga0307515_10068068 | 3300028794 | Bacteria | 4899 |
| 159 | Ga0265328_10006652 | 3300031239 | Bacteria | 4868 |
| 160 | Ga0265325_10054190 | 3300031241 | Bacteria | 2054 |
| 161 | Ga0265339_10000007 | 3300031249 | Bacteria | 241067 |
| 162 | Ga0307408_100067293 | 3300031548 | Bacteria | 2634 |
| 163 | Ga0265313_10073378 | 3300031595 | Bacteria | 1571 |
| 164 | Ga0316579_10214950 | 3300031691 | Bacteria | 930 |
| 165 | Ga0307405_10048267 | 3300031731 | Bacteria | 2625 |
| 166 | Ga0307405_10063966 | 3300031731 | Bacteria | 2336 |
| 167 | Ga0307410_10217859 | 3300031852 | Bacteria | 1467 |
| 168 | Ga0307410_10289088 | 3300031852 | Bacteria | 1289 |
| 169 | Ga0307412_10025571 | 3300031911 | Bacteria | 3658 |
| 170 | Ga0307416_100181717 | 3300032002 | Bacteria | 1972 |
| 171 | Ga0307416_100423983 | 3300032002 | Bacteria | 1375 |
| 172 | Ga0307416_100740983 | 3300032002 | Bacteria | 1074 |
| 173 | Ga0307411_11386194 | 3300032005 | Bacteria | 643 |
| 174 | Ga0373957_0076351 | 3300035120 | Bacteria | 1317 |
| 175 | Ga0373955_0016263 | 3300035172 | Bacteria | 3659 |
| 176 | Ga0373931_0432242 | 3300035691 | Bacteria | 839 |
| 177 | Ga0373935_0936297 | 3300035692 | Bacteria | 642 |
| 178 | Ga0373937_0003968 | 3300036401 | Bacteria | 12516 |
| 179 | Ga0373937_0111197 | 3300036401 | Bacteria | 2548 |
| 180 | Ga0373925_0194908 | 3300037068 | Bacteria | 1609 |
| 181 | Ga0395899_0010811 | 3300037312 | Bacteria | 6997 |
| 182 | Ga0395900_0038629 | 3300037418 | Bacteria | 4921 |
| 183 | Ga0395905_0007267 | 3300037471 | Bacteria | 11036 |
| 184 | Ga0395905_0128865 | 3300037471 | Bacteria | 2379 |
| 185 | Ga0395901_0061561 | 3300038443 | Bacteria | 3905 |
| 186 | Ga0237816_00071 | 3300039145 | Bacteria | 7005 |
| 187 | Ga0436365_0926934 | 3300039437 | Bacteria | 841 |
| 188 | Ga0436360_1034853 | 3300039438 | Bacteria | 694 |
| 189 | Ga0436363_0016106 | 3300039450 | Bacteria | 730 |
| 190 | Ga0439461_0020876 | 3300041410 | Bacteria | 1301 |
| 191 | Ga0439465_0003309 | 3300041413 | Bacteria | 5263 |
| 192 | Ga0451807_1612768 | 3300041486 | Bacteria | 708 |
| 193 | Ga0439443_033677 | 3300042003 | Bacteria | 853 |
| 194 | Ga0439434_0070342 | 3300042435 | Bacteria | 1101 |
| 195 | Ga0451577_0038637 | 3300042876 | Bacteria | 4292 |
| 196 | Ga0466963_0378848 | 3300044694 | Bacteria | 997 |
| 197 | Ga0453684_0017561 | 3300044712 | Bacteria | 11069 |
| 198 | Ga0453684_0381917 | 3300044712 | Bacteria | 1581 |
| 199 | Ga0466971_0312588 | 3300044719 | Bacteria | 756 |
| 200 | Ga0466957_0810523 | 3300044842 | Bacteria | 665 |
| 201 | Ga0466960_0418125 | 3300044901 | Bacteria | 775 |
| 202 | Ga0451576_0033914 | 3300045051 | Bacteria | 5423 |
| 203 | Ga0466958_0320208 | 3300045836 | Bacteria | 997 |
| 204 | Ga0495592_0000087 | 3300046454 | Bacteria | 81851 |
| 205 | Ga0495629_0180831 | 3300046459 | Bacteria | 1461 |
| 206 | Ga0495580_0085287 | 3300046472 | Bacteria | 2200 |
| 207 | Ga0495582_0049048 | 3300046473 | Bacteria | 2325 |
| 208 | Ga0495594_0020447 | 3300046499 | Bacteria | 3526 |
| 209 | Ga0495606_0187524 | 3300046507 | Bacteria | 1188 |
| 210 | Ga0495618_0049953 | 3300046514 | Bacteria | 2641 |
| 211 | Ga0495630_0006993 | 3300046517 | Bacteria | 8043 |
| 212 | Ga0495640_0158582 | 3300046533 | Bacteria | 1451 |
| 213 | Ga0495586_0001949 | 3300046535 | Bacteria | 11264 |
| 214 | Ga0495586_0004802 | 3300046535 | Bacteria | 7224 |
| 215 | Ga0495597_0145949 | 3300046542 | Bacteria | 973 |
| 216 | Ga0495634_0081435 | 3300046642 | Bacteria | 2117 |
| 217 | Ga0495658_0027689 | 3300046683 | Bacteria | 3053 |
| 218 | Ga0495658_0106100 | 3300046683 | Bacteria | 1683 |
| 219 | Ga0495613_0016024 | 3300046689 | Bacteria | 5581 |
| 220 | Ga0495671_0014220 | 3300046692 | Bacteria | 4289 |
| 221 | Ga0495649_0059242 | 3300046694 | Bacteria | 2062 |
| 222 | Ga0495649_0450778 | 3300046694 | Bacteria | 643 |
| 223 | Ga0495581_0047773 | 3300047315 | Bacteria | 2473 |
| 224 | Ga0495674_0010008 | 3300047319 | Bacteria | 8986 |
| 225 | Ga0495674_0056890 | 3300047319 | Bacteria | 3424 |
| 226 | Ga0495672_0129721 | 3300047320 | Bacteria | 1328 |
| 227 | Ga0495614_0060652 | 3300048089 | Bacteria | 1625 |
| 228 | Ga0496112_0583468 | 3300048915 | Bacteria | 1050 |
| 229 | Ga0496115_0914036 | 3300048918 | Bacteria | 676 |
| 230 | Ga0496116_0005168 | 3300048919 | Bacteria | 12252 |
| 231 | Ga0496117_0087161 | 3300048920 | Bacteria | 2024 |
| 232 | Ga0496118_0006998 | 3300048921 | Bacteria | 12155 |
| 233 | Ga0496119_0003736 | 3300048922 | Bacteria | 15581 |
| 234 | Ga0496120_0013733 | 3300048923 | Bacteria | 5437 |
| 235 | Ga0496122_0000059 | 3300048925 | Bacteria | 247170 |
| 236 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 237 | Ga0496124_0008021 | 3300048927 | Bacteria | 11107 |
| 238 | Ga0496125_0007898 | 3300048928 | Bacteria | 11236 |
| 239 | Ga0496126_0147892 | 3300048929 | Bacteria | 2016 |
| 240 | Ga0496126_0519957 | 3300048929 | Bacteria | 948 |
| 241 | Ga0496126_0669411 | 3300048929 | Bacteria | 810 |
| 242 | Ga0501298_053882 | 3300049521 | Bacteria | 839 |
| 243 | Ga0501031_0270130 | 3300049568 | Bacteria | 1104 |
| 244 | Ga0501032_0118449 | 3300049569 | Bacteria | 1751 |
| 245 | Ga0501036_0607034 | 3300049572 | Bacteria | 907 |
| 246 | Ga0501038_0189568 | 3300049574 | Bacteria | 1655 |
| 247 | Ga0501039_0136256 | 3300049575 | Bacteria | 1928 |
| 248 | Ga0501039_0360502 | 3300049575 | Bacteria | 1142 |
| 249 | Ga0501039_0431924 | 3300049575 | Bacteria | 1034 |
| 250 | Ga0501040_0275128 | 3300049576 | Bacteria | 1202 |
| 251 | Ga0501040_0655943 | 3300049576 | Bacteria | 758 |
| 252 | Ga0501041_0120845 | 3300049577 | Bacteria | 1628 |
| 253 | Ga0501041_0139164 | 3300049577 | Bacteria | 1513 |
| 254 | Ga0501042_0551983 | 3300049578 | Bacteria | 837 |
| 255 | Ga0501046_0561735 | 3300049580 | Bacteria | 813 |
| 256 | Ga0501047_0175522 | 3300049581 | Bacteria | 2010 |
| 257 | Ga0501048_0250829 | 3300049582 | Bacteria | 1256 |
| 258 | Ga0501068_0133896 | 3300049584 | Bacteria | 1551 |
| 259 | Ga0501070_0368143 | 3300049586 | Bacteria | 1165 |
| 260 | Ga0501070_0578845 | 3300049586 | Bacteria | 897 |
| 261 | Ga0501070_0652603 | 3300049586 | Bacteria | 835 |
| 262 | Ga0501071_0975230 | 3300049587 | Bacteria | 654 |
| 263 | Ga0501072_0012582 | 3300049588 | Bacteria | 6469 |
| 264 | Ga0501073_0332537 | 3300049589 | Bacteria | 1049 |
| 265 | Ga0501075_0063395 | 3300049591 | Bacteria | 2786 |
| 266 | Ga0501075_0115803 | 3300049591 | Bacteria | 2038 |
| 267 | Ga0501075_0207113 | 3300049591 | Bacteria | 1496 |
| 268 | Ga0501076_0223195 | 3300049592 | Bacteria | 1540 |
| 269 | Ga0501077_0011951 | 3300049593 | Bacteria | 5431 |
| 270 | Ga0501077_0075245 | 3300049593 | Bacteria | 2138 |
| 271 | Ga0501079_0039731 | 3300049741 | Bacteria | 3629 |
| 272 | Ga0501079_0084093 | 3300049741 | Bacteria | 2462 |
| 273 | Ga0501079_0270408 | 3300049741 | Bacteria | 1329 |
| 274 | Ga0501083_0010736 | 3300049744 | Bacteria | 6440 |
| 275 | Ga0501035_0117636 | 3300049822 | Bacteria | 2326 |
| 276 | Ga0501035_0238461 | 3300049822 | Bacteria | 1548 |
| 277 | Ga0501044_0252358 | 3300049823 | Bacteria | 1705 |
| 278 | Ga0501044_0855782 | 3300049823 | Bacteria | 786 |
| 279 | Ga0501045_0116717 | 3300049824 | Bacteria | 1981 |
| 280 | Ga0501045_0193047 | 3300049824 | Bacteria | 1517 |
| 281 | Ga0501045_0400600 | 3300049824 | Bacteria | 1021 |
| 282 | Ga0501045_0428147 | 3300049824 | Bacteria | 984 |
| 283 | nmdc:mga05p37_173342_c1 | 3300050507 | Bacteria | 2630 |
| 284 | nmdc:mga05p37_369343_c1 | 3300050507 | Bacteria | 1684 |
| 285 | nmdc:mga05p37_439810_c1 | 3300050507 | Bacteria | 1513 |
| 286 | nmdc:mga05p37_994722_c1 | 3300050507 | Bacteria | 892 |
| 287 | nmdc:mga09592_15824_c1 | 3300050508 | Bacteria | 6164 |
| 288 | nmdc:mga09592_40924_c1 | 3300050508 | Bacteria | 3895 |
| 289 | nmdc:mga0qj67_191589_c1 | 3300050509 | Bacteria | 1662 |
| 290 | nmdc:mga0qj67_24328_c1 | 3300050509 | Bacteria | 4668 |
| 291 | nmdc:mga06r32_312139_c1 | 3300050510 | Bacteria | 1558 |
| 292 | nmdc:mga06r32_4963_c1 | 3300050510 | Bacteria | 11992 |
| 293 | nmdc:mga06r32_931956_c1 | 3300050510 | Bacteria | 824 |
| 294 | nmdc:mga0n895_263692_c1 | 3300050512 | Bacteria | 1748 |
| 295 | nmdc:mga0n895_30018_c1 | 3300050512 | Bacteria | 5191 |
| 296 | nmdc:mga0n895_3724_c1 | 3300050512 | Bacteria | 12336 |
| 297 | nmdc:mga0n895_59678_c1 | 3300050512 | Bacteria | 3764 |
| 298 | nmdc:mga0rr50_92512_c1 | 3300050513 | Bacteria | 2358 |
| 299 | nmdc:mga0a205_50987_c1 | 3300050515 | Bacteria | 3995 |
| 300 | nmdc:mga0a205_819028_c1 | 3300050515 | Bacteria | 779 |
| 301 | Ga0500635_0022089 | 3300053080 | Bacteria | 1968 |
| 302 | Ga0501084_0212616 | 3300054114 | Bacteria | 1632 |
| 303 | Ga0501084_0286131 | 3300054114 | Bacteria | 1392 |
| 304 | Ga0501084_0470607 | 3300054114 | Bacteria | 1062 |
| 305 | Ga0501082_0466700 | 3300060353 | Bacteria | 1103 |
| 306 | Ga0501082_0858775 | 3300060353 | Bacteria | 794 |
| 307 | Ga0501082_0886455 | 3300060353 | Bacteria | 780 |
| 308 | Ga0530510_0054569 | 3300061734 | Bacteria | 2887 |
| 309 | Ga0530510_0060494 | 3300061734 | Bacteria | 2741 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10002911 | Ga0070658_100029119 | 151 |
| 2 | 3300005435 | Ga0070714_100000801 | Ga0070714_10000080111 | 151 |
| 3 | 3300005436 | Ga0070713_100010652 | Ga0070713_1000106522 | 151 |
| 4 | 3300005616 | Ga0068852_100017584 | Ga0068852_1000175843 | 151 |
| 5 | 3300013105 | Ga0157369_10063384 | Ga0157369_100633842 | 151 |
| 6 | 3300025909 | Ga0207705_10001954 | Ga0207705_1000195412 | 151 |
| 7 | 3300025929 | Ga0207664_10109868 | Ga0207664_101098683 | 151 |
| 8 | 3300026142 | Ga0207698_10019204 | Ga0207698_100192044 | 151 |
| 9 | 3300039438 | Ga0436360_1034853 | Ga0436360_1034853_167_625 | 152 |
| 10 | 3300005335 | Ga0070666_10188517 | Ga0070666_101885172 | 155 |
| 11 | 3300005459 | Ga0068867_100536122 | Ga0068867_1005361221 | 155 |
| 12 | 3300014968 | Ga0157379_10075929 | Ga0157379_100759292 | 156 |
| 13 | 3300039450 | Ga0436363_0016106 | Ga0436363_0016106_222_692 | 156 |
| 14 | 3300050507 | nmdc:mga05p37_994722_c1 | nmdc:mga05p37_994722_c1_39_509 | 156 |
| 15 | 3300037068 | Ga0373925_0194908 | Ga0373925_0194908_358_858 | 161 |
| 16 | 3300046472 | Ga0495580_0085287 | Ga0495580_0085287_1024_1509 | 161 |
| 17 | 3300046683 | Ga0495658_0106100 | Ga0495658_0106100_96_596 | 161 |
| 18 | 3300050512 | nmdc:mga0n895_30018_c1 | nmdc:mga0n895_30018_c1_661_1146 | 161 |
| 19 | 3300009093 | Ga0105240_10439125 | Ga0105240_104391252 | 162 |
| 20 | 3300009147 | Ga0114129_10799650 | Ga0114129_107996502 | 162 |
| 21 | 3300025907 | Ga0207645_10115476 | Ga0207645_101154763 | 162 |
| 22 | 3300028666 | Ga0265336_10028297 | Ga0265336_100282972 | 162 |
| 23 | 3300031239 | Ga0265328_10006652 | Ga0265328_100066523 | 162 |
| 24 | 3300031249 | Ga0265339_10000007 | Ga0265339_10000007154 | 162 |
| 25 | 3300035691 | Ga0373931_0432242 | Ga0373931_0432242_293_781 | 162 |
| 26 | 3300042435 | Ga0439434_0070342 | Ga0439434_0070342_423_941 | 162 |
| 27 | 3300044842 | Ga0466957_0810523 | Ga0466957_0810523_35_523 | 162 |
| 28 | 3300046542 | Ga0495597_0145949 | Ga0495597_0145949_215_706 | 162 |
| 29 | 3300047315 | Ga0495581_0047773 | Ga0495581_0047773_1768_2268 | 162 |
| 30 | 3300048915 | Ga0496112_0583468 | Ga0496112_0583468_458_946 | 162 |
| 31 | 3300050507 | nmdc:mga05p37_369343_c1 | nmdc:mga05p37_369343_c1_257_757 | 162 |
| 32 | 3300050510 | nmdc:mga06r32_931956_c1 | nmdc:mga06r32_931956_c1_261_749 | 162 |
| 33 | 3300050512 | nmdc:mga0n895_59678_c1 | nmdc:mga0n895_59678_c1_2244_2750 | 162 |
| 34 | 3300050515 | nmdc:mga0a205_819028_c1 | nmdc:mga0a205_819028_c1_226_732 | 162 |
| 35 | 3300005339 | Ga0070660_100761022 | Ga0070660_1007610221 | 169 |
| 36 | 3300044712 | Ga0453684_0017561 | Ga0453684_0017561_6022_6546 | 170 |
| 37 | 3300044712 | Ga0453684_0381917 | Ga0453684_0381917_96_620 | 170 |
| 38 | 3300036401 | Ga0373937_0003968 | Ga0373937_0003968_9911_10426 | 171 |
| 39 | 3300044719 | Ga0466971_0312588 | Ga0466971_0312588_20_547 | 171 |
| 40 | 3300046459 | Ga0495629_0180831 | Ga0495629_0180831_757_1272 | 171 |
| 41 | 3300046473 | Ga0495582_0049048 | Ga0495582_0049048_942_1457 | 171 |
| 42 | 3300046499 | Ga0495594_0020447 | Ga0495594_0020447_1905_2420 | 171 |
| 43 | 3300046517 | Ga0495630_0006993 | Ga0495630_0006993_19_534 | 171 |
| 44 | 3300046689 | Ga0495613_0016024 | Ga0495613_0016024_4185_4700 | 171 |
| 45 | 3300046694 | Ga0495649_0450778 | Ga0495649_0450778_93_620 | 171 |
| 46 | 3300048089 | Ga0495614_0060652 | Ga0495614_0060652_955_1470 | 171 |
| 47 | 3300049577 | Ga0501041_0139164 | Ga0501041_0139164_241_768 | 171 |
| 48 | 3300049593 | Ga0501077_0011951 | Ga0501077_0011951_1078_1605 | 171 |
| 49 | 3300061734 | Ga0530510_0054569 | Ga0530510_0054569_2238_2765 | 171 |
| 50 | 3300044901 | Ga0466960_0418125 | Ga0466960_0418125_123_683 | 175 |
| 51 | iso_pu_bacteria | 2891326441 | 2891329095 | 175 |
| 52 | iso_pu_bacteria | 8002775197 | 8002780337 | 177 |
| 53 | 3300006880 | Ga0075429_100030116 | Ga0075429_1000301164 | 179 |
| 54 | 3300009094 | Ga0111539_10267008 | Ga0111539_102670081 | 179 |
| 55 | 3300009147 | Ga0114129_10081022 | Ga0114129_100810225 | 179 |
| 56 | 3300025927 | Ga0207687_10419359 | Ga0207687_104193593 | 179 |
| 57 | 3300025961 | Ga0207712_10143299 | Ga0207712_101432993 | 179 |
| 58 | 3300026095 | Ga0207676_10112287 | Ga0207676_101122874 | 179 |
| 59 | 3300026118 | Ga0207675_100025074 | Ga0207675_1000250749 | 179 |
| 60 | 3300032002 | Ga0307416_100181717 | Ga0307416_1001817172 | 179 |
| 61 | 3300048919 | Ga0496116_0005168 | Ga0496116_0005168_119_667 | 179 |
| 62 | 3300048920 | Ga0496117_0087161 | Ga0496117_0087161_19_567 | 179 |
| 63 | 3300048921 | Ga0496118_0006998 | Ga0496118_0006998_2606_3154 | 179 |
| 64 | 3300048922 | Ga0496119_0003736 | Ga0496119_0003736_2591_3139 | 179 |
| 65 | 3300048923 | Ga0496120_0013733 | Ga0496120_0013733_2279_2827 | 179 |
| 66 | 3300048925 | Ga0496122_0000059 | Ga0496122_0000059_188421_188969 | 179 |
| 67 | 3300048926 | Ga0496123_0000013 | Ga0496123_0000013_387811_388359 | 179 |
| 68 | 3300048927 | Ga0496124_0008021 | Ga0496124_0008021_7811_8359 | 179 |
| 69 | 3300048928 | Ga0496125_0007898 | Ga0496125_0007898_8058_8606 | 179 |
| 70 | 3300048929 | Ga0496126_0519957 | Ga0496126_0519957_104_652 | 179 |
| 71 | 3300050507 | nmdc:mga05p37_439810_c1 | nmdc:mga05p37_439810_c1_327_884 | 179 |
| 72 | 3300050508 | nmdc:mga09592_40924_c1 | nmdc:mga09592_40924_c1_459_1016 | 179 |
| 73 | 3300050509 | nmdc:mga0qj67_191589_c1 | nmdc:mga0qj67_191589_c1_534_1091 | 179 |
| 74 | 3300005330 | Ga0070690_100440901 | Ga0070690_1004409012 | 180 |
| 75 | 3300005338 | Ga0068868_100004939 | Ga0068868_1000049393 | 180 |
| 76 | 3300005471 | Ga0070698_100000353 | Ga0070698_10000035310 | 180 |
| 77 | 3300006237 | Ga0097621_100032320 | Ga0097621_1000323204 | 180 |
| 78 | 3300006881 | Ga0068865_100508193 | Ga0068865_1005081933 | 180 |
| 79 | 3300009093 | Ga0105240_10410936 | Ga0105240_104109361 | 180 |
| 80 | 3300014969 | Ga0157376_10045747 | Ga0157376_100457474 | 180 |
| 81 | 3300017792 | Ga0163161_10059677 | Ga0163161_100596772 | 180 |
| 82 | 3300025913 | Ga0207695_10435185 | Ga0207695_104351852 | 180 |
| 83 | 3300025938 | Ga0207704_10550563 | Ga0207704_105505632 | 180 |
| 84 | 3300025961 | Ga0207712_10218532 | Ga0207712_102185322 | 180 |
| 85 | 3300026023 | Ga0207677_10006364 | Ga0207677_100063642 | 180 |
| 86 | 3300026088 | Ga0207641_11236936 | Ga0207641_112369362 | 180 |
| 87 | 3300026089 | Ga0207648_10025434 | Ga0207648_100254342 | 180 |
| 88 | 3300048918 | Ga0496115_0914036 | Ga0496115_0914036_116_661 | 180 |
| 89 | 3300049589 | Ga0501073_0332537 | Ga0501073_0332537_27_581 | 180 |
| 90 | 3300050512 | nmdc:mga0n895_263692_c1 | nmdc:mga0n895_263692_c1_165_719 | 180 |
| 91 | 3300003775 | Ga0055524_1000340 | Ga0055524_100034038 | 181 |
| 92 | 3300005331 | Ga0070670_100065398 | Ga0070670_1000653983 | 181 |
| 93 | 3300005335 | Ga0070666_10142356 | Ga0070666_101423562 | 181 |
| 94 | 3300005340 | Ga0070689_100338369 | Ga0070689_1003383692 | 181 |
| 95 | 3300005345 | Ga0070692_10027187 | Ga0070692_100271871 | 181 |
| 96 | 3300005355 | Ga0070671_100099429 | Ga0070671_1000994291 | 181 |
| 97 | 3300005367 | Ga0070667_100162146 | Ga0070667_1001621462 | 181 |
| 98 | 3300005564 | Ga0070664_100033070 | Ga0070664_1000330703 | 181 |
| 99 | 3300005617 | Ga0068859_100000524 | Ga0068859_1000005242 | 181 |
| 100 | 3300005618 | Ga0068864_100292860 | Ga0068864_1002928602 | 181 |
| 101 | 3300005841 | Ga0068863_100339304 | Ga0068863_1003393043 | 181 |
| 102 | 3300005843 | Ga0068860_100238113 | Ga0068860_1002381133 | 181 |
| 103 | 3300005844 | Ga0068862_100002395 | Ga0068862_10000239516 | 181 |
| 104 | 3300006237 | Ga0097621_100740650 | Ga0097621_1007406501 | 181 |
| 105 | 3300006931 | Ga0097620_100000524 | Ga0097620_1000005242 | 181 |
| 106 | 3300006946 | Ga0079104_1000328 | Ga0079104_100032858 | 181 |
| 107 | 3300009174 | Ga0105241_10327670 | Ga0105241_103276702 | 181 |
| 108 | 3300009177 | Ga0105248_10503009 | Ga0105248_105030091 | 181 |
| 109 | 3300013296 | Ga0157374_11270904 | Ga0157374_112709041 | 181 |
| 110 | 3300013307 | Ga0157372_11283663 | Ga0157372_112836631 | 181 |
| 111 | 3300014325 | Ga0163163_10089471 | Ga0163163_100894714 | 181 |
| 112 | 3300014325 | Ga0163163_10250919 | Ga0163163_102509191 | 181 |
| 113 | 3300014968 | Ga0157379_11501889 | Ga0157379_115018891 | 181 |
| 114 | 3300014969 | Ga0157376_11171754 | Ga0157376_111717541 | 181 |
| 115 | 3300025263 | Ga0209565_1001678 | Ga0209565_10016788 | 181 |
| 116 | 3300025299 | Ga0209256_1000120 | Ga0209256_1000120145 | 181 |
| 117 | 3300025903 | Ga0207680_10039867 | Ga0207680_100398672 | 181 |
| 118 | 3300025918 | Ga0207662_10574207 | Ga0207662_105742072 | 181 |
| 119 | 3300025923 | Ga0207681_10128605 | Ga0207681_101286053 | 181 |
| 120 | 3300025931 | Ga0207644_10146635 | Ga0207644_101466351 | 181 |
| 121 | 3300025933 | Ga0207706_10203039 | Ga0207706_102030391 | 181 |
| 122 | 3300025944 | Ga0207661_10356267 | Ga0207661_103562672 | 181 |
| 123 | 3300025945 | Ga0207679_10037290 | Ga0207679_100372902 | 181 |
| 124 | 3300025972 | Ga0207668_10399709 | Ga0207668_103997092 | 181 |
| 125 | 3300025986 | Ga0207658_10114578 | Ga0207658_101145782 | 181 |
| 126 | 3300026089 | Ga0207648_10139620 | Ga0207648_101396202 | 181 |
| 127 | 3300026095 | Ga0207676_10026880 | Ga0207676_100268806 | 181 |
| 128 | 3300027111 | Ga0209281_1000455 | Ga0209281_100045557 | 181 |
| 129 | 3300028380 | Ga0268265_10001883 | Ga0268265_100018831 | 181 |
| 130 | 3300028381 | Ga0268264_10227199 | Ga0268264_102271993 | 181 |
| 131 | 3300028794 | Ga0307515_10068068 | Ga0307515_100680687 | 181 |
| 132 | 3300031691 | Ga0316579_10214950 | Ga0316579_102149501 | 181 |
| 133 | 3300037471 | Ga0395905_0128865 | Ga0395905_0128865_494_1054 | 181 |
| 134 | 3300039437 | Ga0436365_0926934 | Ga0436365_0926934_263_823 | 181 |
| 135 | 3300041410 | Ga0439461_0020876 | Ga0439461_0020876_193_759 | 181 |
| 136 | 3300041413 | Ga0439465_0003309 | Ga0439465_0003309_278_844 | 181 |
| 137 | 3300041486 | Ga0451807_1612768 | Ga0451807_1612768_45_602 | 181 |
| 138 | 3300042876 | Ga0451577_0038637 | Ga0451577_0038637_454_1011 | 181 |
| 139 | 3300045051 | Ga0451576_0033914 | Ga0451576_0033914_1969_2514 | 181 |
| 140 | 3300046454 | Ga0495592_0000087 | Ga0495592_0000087_5630_6187 | 181 |
| 141 | 3300046514 | Ga0495618_0049953 | Ga0495618_0049953_70_627 | 181 |
| 142 | 3300046535 | Ga0495586_0004802 | Ga0495586_0004802_3363_3920 | 181 |
| 143 | 3300046683 | Ga0495658_0027689 | Ga0495658_0027689_575_1132 | 181 |
| 144 | 3300047319 | Ga0495674_0010008 | Ga0495674_0010008_5335_5892 | 181 |
| 145 | 3300047320 | Ga0495672_0129721 | Ga0495672_0129721_617_1183 | 181 |
| 146 | 3300049572 | Ga0501036_0607034 | Ga0501036_0607034_154_723 | 181 |
| 147 | 3300049575 | Ga0501039_0136256 | Ga0501039_0136256_452_1009 | 181 |
| 148 | 3300049575 | Ga0501039_0360502 | Ga0501039_0360502_54_620 | 181 |
| 149 | 3300049575 | Ga0501039_0431924 | Ga0501039_0431924_111_680 | 181 |
| 150 | 3300049576 | Ga0501040_0275128 | Ga0501040_0275128_507_1064 | 181 |
| 151 | 3300049576 | Ga0501040_0655943 | Ga0501040_0655943_105_674 | 181 |
| 152 | 3300049578 | Ga0501042_0551983 | Ga0501042_0551983_89_658 | 181 |
| 153 | 3300049582 | Ga0501048_0250829 | Ga0501048_0250829_133_702 | 181 |
| 154 | 3300049584 | Ga0501068_0133896 | Ga0501068_0133896_207_776 | 181 |
| 155 | 3300049586 | Ga0501070_0652603 | Ga0501070_0652603_146_715 | 181 |
| 156 | 3300049587 | Ga0501071_0975230 | Ga0501071_0975230_59_616 | 181 |
| 157 | 3300049588 | Ga0501072_0012582 | Ga0501072_0012582_3060_3629 | 181 |
| 158 | 3300049591 | Ga0501075_0063395 | Ga0501075_0063395_690_1259 | 181 |
| 159 | 3300049741 | Ga0501079_0039731 | Ga0501079_0039731_868_1434 | 181 |
| 160 | 3300049741 | Ga0501079_0084093 | Ga0501079_0084093_1483_2040 | 181 |
| 161 | 3300049741 | Ga0501079_0270408 | Ga0501079_0270408_637_1203 | 181 |
| 162 | 3300049822 | Ga0501035_0117636 | Ga0501035_0117636_1398_1955 | 181 |
| 163 | 3300049822 | Ga0501035_0238461 | Ga0501035_0238461_572_1141 | 181 |
| 164 | 3300049823 | Ga0501044_0855782 | Ga0501044_0855782_76_642 | 181 |
| 165 | 3300049824 | Ga0501045_0116717 | Ga0501045_0116717_594_1151 | 181 |
| 166 | 3300049824 | Ga0501045_0193047 | Ga0501045_0193047_203_772 | 181 |
| 167 | 3300049824 | Ga0501045_0428147 | Ga0501045_0428147_30_596 | 181 |
| 168 | 3300053080 | Ga0500635_0022089 | Ga0500635_0022089_1106_1672 | 181 |
| 169 | 3300054114 | Ga0501084_0470607 | Ga0501084_0470607_312_881 | 181 |
| 170 | 3300060353 | Ga0501082_0886455 | Ga0501082_0886455_101_667 | 181 |
| 171 | 3300061734 | Ga0530510_0060494 | Ga0530510_0060494_1141_1707 | 181 |
| 172 | 3300003322 | rootL2_10031260 | rootL2_100312602 | 182 |
| 173 | 3300003792 | Ga0055540_1025093 | Ga0055540_10250932 | 182 |
| 174 | 3300003794 | Ga0055531_10000152 | Ga0055531_1000015260 | 182 |
| 175 | 3300005329 | Ga0070683_100125920 | Ga0070683_1001259204 | 182 |
| 176 | 3300005329 | Ga0070683_100616551 | Ga0070683_1006165511 | 182 |
| 177 | 3300005331 | Ga0070670_100080621 | Ga0070670_1000806212 | 182 |
| 178 | 3300005336 | Ga0070680_100025953 | Ga0070680_1000259532 | 182 |
| 179 | 3300005338 | Ga0068868_100310310 | Ga0068868_1003103101 | 182 |
| 180 | 3300005344 | Ga0070661_100023487 | Ga0070661_1000234875 | 182 |
| 181 | 3300005356 | Ga0070674_100092721 | Ga0070674_1000927214 | 182 |
| 182 | 3300005356 | Ga0070674_100655615 | Ga0070674_1006556151 | 182 |
| 183 | 3300005366 | Ga0070659_100312092 | Ga0070659_1003120923 | 182 |
| 184 | 3300005435 | Ga0070714_100810773 | Ga0070714_1008107731 | 182 |
| 185 | 3300005467 | Ga0070706_100004644 | Ga0070706_10000464413 | 182 |
| 186 | 3300005518 | Ga0070699_100109376 | Ga0070699_1001093763 | 182 |
| 187 | 3300005530 | Ga0070679_100169536 | Ga0070679_1001695363 | 182 |
| 188 | 3300005530 | Ga0070679_100608272 | Ga0070679_1006082721 | 182 |
| 189 | 3300005539 | Ga0068853_100045144 | Ga0068853_1000451443 | 182 |
| 190 | 3300005539 | Ga0068853_100552638 | Ga0068853_1005526382 | 182 |
| 191 | 3300005546 | Ga0070696_100009360 | Ga0070696_1000093609 | 182 |
| 192 | 3300005547 | Ga0070693_100022590 | Ga0070693_1000225903 | 182 |
| 193 | 3300005563 | Ga0068855_100381133 | Ga0068855_1003811332 | 182 |
| 194 | 3300005564 | Ga0070664_100351103 | Ga0070664_1003511032 | 182 |
| 195 | 3300005577 | Ga0068857_100030851 | Ga0068857_1000308514 | 182 |
| 196 | 3300005614 | Ga0068856_100075914 | Ga0068856_1000759142 | 182 |
| 197 | 3300005616 | Ga0068852_100091639 | Ga0068852_1000916392 | 182 |
| 198 | 3300005616 | Ga0068852_100921069 | Ga0068852_1009210692 | 182 |
| 199 | 3300005718 | Ga0068866_10153809 | Ga0068866_101538092 | 182 |
| 200 | 3300005834 | Ga0068851_10020624 | Ga0068851_100206243 | 182 |
| 201 | 3300005834 | Ga0068851_10515295 | Ga0068851_105152951 | 182 |
| 202 | 3300006028 | Ga0070717_10246116 | Ga0070717_102461163 | 182 |
| 203 | 3300006195 | Ga0075366_10205275 | Ga0075366_102052752 | 182 |
| 204 | 3300006844 | Ga0075428_101245336 | Ga0075428_1012453362 | 182 |
| 205 | 3300006847 | Ga0075431_100078045 | Ga0075431_1000780456 | 182 |
| 206 | 3300006852 | Ga0075433_10010601 | Ga0075433_100106014 | 182 |
| 207 | 3300006852 | Ga0075433_10116570 | Ga0075433_101165704 | 182 |
| 208 | 3300006871 | Ga0075434_100041468 | Ga0075434_1000414682 | 182 |
| 209 | 3300006871 | Ga0075434_100075106 | Ga0075434_1000751063 | 182 |
| 210 | 3300006871 | Ga0075434_100127752 | Ga0075434_1001277521 | 182 |
| 211 | 3300006871 | Ga0075434_100282560 | Ga0075434_1002825602 | 182 |
| 212 | 3300006880 | Ga0075429_100694367 | Ga0075429_1006943672 | 182 |
| 213 | 3300007076 | Ga0075435_100049171 | Ga0075435_1000491715 | 182 |
| 214 | 3300007076 | Ga0075435_100435092 | Ga0075435_1004350921 | 182 |
| 215 | 3300009148 | Ga0105243_11109075 | Ga0105243_111090752 | 182 |
| 216 | 3300009174 | Ga0105241_10099034 | Ga0105241_100990343 | 182 |
| 217 | 3300009177 | Ga0105248_10880382 | Ga0105248_108803822 | 182 |
| 218 | 3300013100 | Ga0157373_10027175 | Ga0157373_100271755 | 182 |
| 219 | 3300013100 | Ga0157373_10170431 | Ga0157373_101704313 | 182 |
| 220 | 3300013100 | Ga0157373_10384836 | Ga0157373_103848361 | 182 |
| 221 | 3300013105 | Ga0157369_10059019 | Ga0157369_100590192 | 182 |
| 222 | 3300013296 | Ga0157374_10114057 | Ga0157374_101140572 | 182 |
| 223 | 3300013296 | Ga0157374_10623634 | Ga0157374_106236342 | 182 |
| 224 | 3300013307 | Ga0157372_10034957 | Ga0157372_100349572 | 182 |
| 225 | 3300025303 | Ga0209051_1000059 | Ga0209051_1000059154 | 182 |
| 226 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022246 | 182 |
| 227 | 3300025321 | Ga0207656_10010642 | Ga0207656_100106422 | 182 |
| 228 | 3300025910 | Ga0207684_10004452 | Ga0207684_1000445213 | 182 |
| 229 | 3300025915 | Ga0207693_10126303 | Ga0207693_101263031 | 182 |
| 230 | 3300025920 | Ga0207649_10033290 | Ga0207649_100332904 | 182 |
| 231 | 3300025921 | Ga0207652_10042760 | Ga0207652_100427604 | 182 |
| 232 | 3300025925 | Ga0207650_10025117 | Ga0207650_100251171 | 182 |
| 233 | 3300025928 | Ga0207700_11047404 | Ga0207700_110474041 | 182 |
| 234 | 3300025934 | Ga0207686_10244164 | Ga0207686_102441642 | 182 |
| 235 | 3300025935 | Ga0207709_10595269 | Ga0207709_105952691 | 182 |
| 236 | 3300025937 | Ga0207669_10155847 | Ga0207669_101558473 | 182 |
| 237 | 3300025944 | Ga0207661_10177491 | Ga0207661_101774912 | 182 |
| 238 | 3300025945 | Ga0207679_10058241 | Ga0207679_100582412 | 182 |
| 239 | 3300025945 | Ga0207679_10069791 | Ga0207679_100697913 | 182 |
| 240 | 3300025945 | Ga0207679_10218151 | Ga0207679_102181512 | 182 |
| 241 | 3300025981 | Ga0207640_10051999 | Ga0207640_100519992 | 182 |
| 242 | 3300026023 | Ga0207677_10297101 | Ga0207677_102971011 | 182 |
| 243 | 3300026041 | Ga0207639_10106961 | Ga0207639_101069613 | 182 |
| 244 | 3300026067 | Ga0207678_10084924 | Ga0207678_100849243 | 182 |
| 245 | 3300026116 | Ga0207674_10013961 | Ga0207674_100139614 | 182 |
| 246 | 3300026116 | Ga0207674_11013420 | Ga0207674_110134201 | 182 |
| 247 | 3300026142 | Ga0207698_10760861 | Ga0207698_107608611 | 182 |
| 248 | 3300027526 | Ga0209968_1009565 | Ga0209968_10095653 | 182 |
| 249 | 3300027695 | Ga0209966_1006715 | Ga0209966_10067153 | 182 |
| 250 | 3300028379 | Ga0268266_10001353 | Ga0268266_1000135311 | 182 |
| 251 | 3300028563 | Ga0265319_1016626 | Ga0265319_10166262 | 182 |
| 252 | 3300031241 | Ga0265325_10054190 | Ga0265325_100541903 | 182 |
| 253 | 3300031548 | Ga0307408_100067293 | Ga0307408_1000672933 | 182 |
| 254 | 3300031595 | Ga0265313_10073378 | Ga0265313_100733781 | 182 |
| 255 | 3300031731 | Ga0307405_10048267 | Ga0307405_100482673 | 182 |
| 256 | 3300031731 | Ga0307405_10063966 | Ga0307405_100639663 | 182 |
| 257 | 3300031852 | Ga0307410_10217859 | Ga0307410_102178591 | 182 |
| 258 | 3300031852 | Ga0307410_10289088 | Ga0307410_102890882 | 182 |
| 259 | 3300031911 | Ga0307412_10025571 | Ga0307412_100255715 | 182 |
| 260 | 3300032002 | Ga0307416_100423983 | Ga0307416_1004239831 | 182 |
| 261 | 3300032002 | Ga0307416_100740983 | Ga0307416_1007409832 | 182 |
| 262 | 3300032005 | Ga0307411_11386194 | Ga0307411_113861941 | 182 |
| 263 | 3300035120 | Ga0373957_0076351 | Ga0373957_0076351_146_694 | 182 |
| 264 | 3300035172 | Ga0373955_0016263 | Ga0373955_0016263_3018_3566 | 182 |
| 265 | 3300035692 | Ga0373935_0936297 | Ga0373935_0936297_46_594 | 182 |
| 266 | 3300036401 | Ga0373937_0111197 | Ga0373937_0111197_1771_2319 | 182 |
| 267 | 3300037312 | Ga0395899_0010811 | Ga0395899_0010811_4744_5292 | 182 |
| 268 | 3300037418 | Ga0395900_0038629 | Ga0395900_0038629_3184_3732 | 182 |
| 269 | 3300037471 | Ga0395905_0007267 | Ga0395905_0007267_5285_5833 | 182 |
| 270 | 3300038443 | Ga0395901_0061561 | Ga0395901_0061561_2594_3142 | 182 |
| 271 | 3300039145 | Ga0237816_00071 | Ga0237816_00071_6352_6924 | 182 |
| 272 | 3300042003 | Ga0439443_033677 | Ga0439443_033677_200_760 | 182 |
| 273 | 3300044694 | Ga0466963_0378848 | Ga0466963_0378848_100_672 | 182 |
| 274 | 3300045836 | Ga0466958_0320208 | Ga0466958_0320208_426_986 | 182 |
| 275 | 3300046507 | Ga0495606_0187524 | Ga0495606_0187524_338_916 | 182 |
| 276 | 3300046533 | Ga0495640_0158582 | Ga0495640_0158582_341_925 | 182 |
| 277 | 3300046535 | Ga0495586_0001949 | Ga0495586_0001949_8769_9353 | 182 |
| 278 | 3300046642 | Ga0495634_0081435 | Ga0495634_0081435_360_944 | 182 |
| 279 | 3300046692 | Ga0495671_0014220 | Ga0495671_0014220_236_814 | 182 |
| 280 | 3300046694 | Ga0495649_0059242 | Ga0495649_0059242_717_1295 | 182 |
| 281 | 3300047319 | Ga0495674_0056890 | Ga0495674_0056890_2848_3396 | 182 |
| 282 | 3300048929 | Ga0496126_0147892 | Ga0496126_0147892_1062_1616 | 182 |
| 283 | 3300048929 | Ga0496126_0669411 | Ga0496126_0669411_232_780 | 182 |
| 284 | 3300049521 | Ga0501298_053882 | Ga0501298_053882_110_670 | 182 |
| 285 | 3300049568 | Ga0501031_0270130 | Ga0501031_0270130_254_802 | 182 |
| 286 | 3300049569 | Ga0501032_0118449 | Ga0501032_0118449_464_1075 | 182 |
| 287 | 3300049574 | Ga0501038_0189568 | Ga0501038_0189568_527_1138 | 182 |
| 288 | 3300049577 | Ga0501041_0120845 | Ga0501041_0120845_86_646 | 182 |
| 289 | 3300049580 | Ga0501046_0561735 | Ga0501046_0561735_180_740 | 182 |
| 290 | 3300049581 | Ga0501047_0175522 | Ga0501047_0175522_1108_1719 | 182 |
| 291 | 3300049586 | Ga0501070_0368143 | Ga0501070_0368143_492_1055 | 182 |
| 292 | 3300049586 | Ga0501070_0578845 | Ga0501070_0578845_259_819 | 182 |
| 293 | 3300049591 | Ga0501075_0115803 | Ga0501075_0115803_1301_1849 | 182 |
| 294 | 3300049591 | Ga0501075_0207113 | Ga0501075_0207113_132_692 | 182 |
| 295 | 3300049592 | Ga0501076_0223195 | Ga0501076_0223195_98_658 | 182 |
| 296 | 3300049593 | Ga0501077_0075245 | Ga0501077_0075245_1551_2111 | 182 |
| 297 | 3300049744 | Ga0501083_0010736 | Ga0501083_0010736_4582_5130 | 182 |
| 298 | 3300049823 | Ga0501044_0252358 | Ga0501044_0252358_898_1446 | 182 |
| 299 | 3300049824 | Ga0501045_0400600 | Ga0501045_0400600_325_885 | 182 |
| 300 | 3300050507 | nmdc:mga05p37_173342_c1 | nmdc:mga05p37_173342_c1_329_889 | 182 |
| 301 | 3300050508 | nmdc:mga09592_15824_c1 | nmdc:mga09592_15824_c1_2707_3267 | 182 |
| 302 | 3300050509 | nmdc:mga0qj67_24328_c1 | nmdc:mga0qj67_24328_c1_2022_2582 | 182 |
| 303 | 3300050510 | nmdc:mga06r32_312139_c1 | nmdc:mga06r32_312139_c1_908_1537 | 182 |
| 304 | 3300050510 | nmdc:mga06r32_4963_c1 | nmdc:mga06r32_4963_c1_6910_7470 | 182 |
| 305 | 3300050512 | nmdc:mga0n895_3724_c1 | nmdc:mga0n895_3724_c1_5750_6298 | 182 |
| 306 | 3300050513 | nmdc:mga0rr50_92512_c1 | nmdc:mga0rr50_92512_c1_1404_1952 | 182 |
| 307 | 3300050515 | nmdc:mga0a205_50987_c1 | nmdc:mga0a205_50987_c1_1876_2424 | 182 |
| 308 | 3300054114 | Ga0501084_0212616 | Ga0501084_0212616_313_873 | 182 |
| 309 | 3300054114 | Ga0501084_0286131 | Ga0501084_0286131_190_750 | 182 |
| 310 | 3300060353 | Ga0501082_0466700 | Ga0501082_0466700_155_715 | 182 |
| 311 | 3300060353 | Ga0501082_0858775 | Ga0501082_0858775_89_694 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.813 | 3 | 181 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.804 | 3 | 181 |
| 2gd9-assembly1.cif.gz_B | crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution | 0.8002 | 2 | 179 |
| 3jtw-assembly2.cif.gz_B-3 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.7794 | 1 | 179 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.7786 | 3 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wbmB03 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8438 | 161 | 181 | 3.30.70.240 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7897 | 3 | 182 | 3.40.430.10 |
| 3fgeA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7868 | 161 | 182 | 2.30.110.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7702 | 2 | 178 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.7687 | 1 | 179 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G8DFK4-F1-model_v4 | Dihydrofolate reductase | 0.9926 | 1 | 181 |
GO:0008703
GO:0009231 |
| AF-A0A3N5FXU3-F1-model_v4 | Deaminase | 0.985 | 1 | 154 |
GO:0008703
GO:0009231 |
| AF-A0A4Q5YEZ0-F1-model_v4 | Deaminase | 0.9846 | 44 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A7V9GHA7-F1-model_v4 | Dihydrofolate reductase family protein | 0.9828 | 1 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A1G8DFK4-F1-model_v4 | Dihydrofolate reductase | 0.9818 | 1 | 181 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar