F401208

General Info

Members Datasets Scaffolds Average Seq Length
311 224 309 182

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10089471|Ga0163163_100894714
Length 226
Sequence MIMRVATCSRGQDRSDCGRLDPRDRGKGEQAVRSLRYSINVTLDGCCDHQAGVADEELHRHHAANLARADALLLGRVTYEMMEEAWRQSATGTWPEWMADWMVPFARTIDVAKKYVVSSTLERVDWNAELVQGDLAKAVVQLKQEPGSGLAVGGVTLPLALADLGLIDEYEFVVQPIVAGHGPTLFAGLSERLELKLVGRQEFRSGAVALRYQPAESRPEAGRVTA

Samples

Sample ID Description Type Environment
1 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
110 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
179 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
182 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10031260 3300003322 Bacteria 1554
2 Ga0055524_1000340 3300003775 Bacteria 42965
3 Ga0055540_1025093 3300003792 Bacteria 1466
4 Ga0055531_10000152 3300003794 Bacteria 80208
5 Ga0070658_10002911 3300005327 Bacteria 14195
6 Ga0070683_100125920 3300005329 Bacteria 2422
7 Ga0070683_100616551 3300005329 Bacteria 1039
8 Ga0070690_100440901 3300005330 Bacteria 964
9 Ga0070670_100065398 3300005331 Bacteria 3120
10 Ga0070670_100080621 3300005331 Bacteria 2797
11 Ga0070666_10142356 3300005335 Bacteria 1670
12 Ga0070666_10188517 3300005335 Bacteria 1449
13 Ga0070680_100025953 3300005336 Bacteria 4686
14 Ga0068868_100004939 3300005338 Bacteria 9370
15 Ga0068868_100310310 3300005338 Bacteria 1342
16 Ga0070660_100761022 3300005339 Bacteria 814
17 Ga0070689_100338369 3300005340 Bacteria 1260
18 Ga0070661_100023487 3300005344 Bacteria 4420
19 Ga0070692_10027187 3300005345 Bacteria 2833
20 Ga0070671_100099429 3300005355 Bacteria 2440
21 Ga0070674_100092721 3300005356 Bacteria 2184
22 Ga0070674_100655615 3300005356 Bacteria 893
23 Ga0070659_100312092 3300005366 Bacteria 1313
24 Ga0070667_100162146 3300005367 Bacteria 1970
25 Ga0070714_100000801 3300005435 Bacteria 22250
26 Ga0070714_100810773 3300005435 Bacteria 907
27 Ga0070713_100010652 3300005436 Bacteria 6654
28 Ga0068867_100536122 3300005459 Bacteria 1011
29 Ga0070706_100004644 3300005467 Bacteria 13186
30 Ga0070698_100000353 3300005471 Bacteria 47490
31 Ga0070699_100109376 3300005518 Bacteria 2426
32 Ga0070679_100169536 3300005530 Bacteria 2156
33 Ga0070679_100608272 3300005530 Bacteria 1036
34 Ga0068853_100045144 3300005539 Bacteria 3774
35 Ga0068853_100552638 3300005539 Bacteria 1091
36 Ga0070696_100009360 3300005546 Bacteria 6559
37 Ga0070693_100022590 3300005547 Bacteria 3348
38 Ga0068855_100381133 3300005563 Bacteria 1548
39 Ga0070664_100033070 3300005564 Bacteria 4328
40 Ga0070664_100351103 3300005564 Bacteria 1342
41 Ga0068857_100030851 3300005577 Bacteria 4735
42 Ga0068856_100075914 3300005614 Bacteria 3329
43 Ga0068852_100017584 3300005616 Bacteria 5614
44 Ga0068852_100091639 3300005616 Bacteria 2720
45 Ga0068852_100921069 3300005616 Bacteria 891
46 Ga0068859_100000524 3300005617 Bacteria 38111
47 Ga0068864_100292860 3300005618 Bacteria 1522
48 Ga0068866_10153809 3300005718 Bacteria 1335
49 Ga0068851_10020624 3300005834 Bacteria 3192
50 Ga0068851_10515295 3300005834 Bacteria 719
51 Ga0068863_100339304 3300005841 Bacteria 1462
52 Ga0068860_100238113 3300005843 Bacteria 1770
53 Ga0068862_100002395 3300005844 Bacteria 16675
54 Ga0070717_10246116 3300006028 Bacteria 1578
55 Ga0075366_10205275 3300006195 Bacteria 1199
56 Ga0097621_100032320 3300006237 Bacteria 4159
57 Ga0097621_100740650 3300006237 Bacteria 907
58 Ga0075428_101245336 3300006844 Bacteria 783
59 Ga0075431_100078045 3300006847 Bacteria 3418
60 Ga0075433_10010601 3300006852 Bacteria 7409
61 Ga0075433_10116570 3300006852 Bacteria 2370
62 Ga0075434_100041468 3300006871 Bacteria 4560
63 Ga0075434_100075106 3300006871 Bacteria 3373
64 Ga0075434_100127752 3300006871 Bacteria 2559
65 Ga0075434_100282560 3300006871 Bacteria 1679
66 Ga0075429_100030116 3300006880 Bacteria 4715
67 Ga0075429_100694367 3300006880 Bacteria 891
68 Ga0068865_100508193 3300006881 Bacteria 1006
69 Ga0097620_100000524 3300006931 Bacteria 38111
70 Ga0079104_1000328 3300006946 Bacteria 58129
71 Ga0075435_100049171 3300007076 Bacteria 3390
72 Ga0075435_100435092 3300007076 Bacteria 1130
73 Ga0105240_10410936 3300009093 Bacteria 1522
74 Ga0105240_10439125 3300009093 Bacteria 1463
75 Ga0111539_10267008 3300009094 Bacteria 1992
76 Ga0114129_10081022 3300009147 Bacteria 4512
77 Ga0114129_10799650 3300009147 Bacteria 1203
78 Ga0105243_11109075 3300009148 Bacteria 800
79 Ga0105241_10099034 3300009174 Bacteria 2314
80 Ga0105241_10327670 3300009174 Bacteria 1322
81 Ga0105248_10503009 3300009177 Bacteria 1366
82 Ga0105248_10880382 3300009177 Bacteria 1011
83 Ga0157373_10027175 3300013100 Bacteria 4128
84 Ga0157373_10170431 3300013100 Bacteria 1532
85 Ga0157373_10384836 3300013100 Bacteria 1004
86 Ga0157369_10059019 3300013105 Bacteria 4138
87 Ga0157369_10063384 3300013105 Bacteria 3983
88 Ga0157374_10114057 3300013296 Bacteria 2601
89 Ga0157374_10623634 3300013296 Bacteria 1089
90 Ga0157374_11270904 3300013296 Bacteria 758
91 Ga0157372_10034957 3300013307 Bacteria 5530
92 Ga0157372_11283663 3300013307 Bacteria 845
93 Ga0163163_10089471 3300014325 Bacteria 3091
94 Ga0163163_10250919 3300014325 Bacteria 1820
95 Ga0157379_10075929 3300014968 Bacteria 3009
96 Ga0157379_11501889 3300014968 Bacteria 655
97 Ga0157376_10045747 3300014969 Bacteria 3606
98 Ga0157376_11171754 3300014969 Bacteria 796
99 Ga0163161_10059677 3300017792 Bacteria 2775
100 Ga0209565_1001678 3300025263 Bacteria 9208
101 Ga0209256_1000120 3300025299 Bacteria 167691
102 Ga0209051_1000059 3300025303 Bacteria 260307
103 Ga0209257_1000022 3300025304 Bacteria 765258
104 Ga0207656_10010642 3300025321 Bacteria 3452
105 Ga0207680_10039867 3300025903 Bacteria 2728
106 Ga0207645_10115476 3300025907 Bacteria 1740
107 Ga0207705_10001954 3300025909 Bacteria 16079
108 Ga0207684_10004452 3300025910 Bacteria 13193
109 Ga0207695_10435185 3300025913 Bacteria 1195
110 Ga0207693_10126303 3300025915 Bacteria 2010
111 Ga0207662_10574207 3300025918 Bacteria 783
112 Ga0207649_10033290 3300025920 Bacteria 3078
113 Ga0207652_10042760 3300025921 Bacteria 3858
114 Ga0207681_10128605 3300025923 Bacteria 1869
115 Ga0207650_10025117 3300025925 Unclassified 4243
116 Ga0207687_10419359 3300025927 Bacteria 1104
117 Ga0207700_11047404 3300025928 Bacteria 730
118 Ga0207664_10109868 3300025929 Bacteria 2291
119 Ga0207644_10146635 3300025931 Bacteria 1822
120 Ga0207706_10203039 3300025933 Bacteria 1738
121 Ga0207686_10244164 3300025934 Bacteria 1308
122 Ga0207709_10595269 3300025935 Bacteria 875
123 Ga0207669_10155847 3300025937 Bacteria 1606
124 Ga0207704_10550563 3300025938 Bacteria 937
125 Ga0207661_10177491 3300025944 Bacteria 1858
126 Ga0207661_10356267 3300025944 Bacteria 1321
127 Ga0207679_10037290 3300025945 Bacteria 3454
128 Ga0207679_10058241 3300025945 Bacteria 2861
129 Ga0207679_10069791 3300025945 Bacteria 2646
130 Ga0207679_10218151 3300025945 Bacteria 1604
131 Ga0207712_10143299 3300025961 Bacteria 1836
132 Ga0207712_10218532 3300025961 Bacteria 1522
133 Ga0207668_10399709 3300025972 Bacteria 1161
134 Ga0207640_10051999 3300025981 Bacteria 2666
135 Ga0207658_10114578 3300025986 Bacteria 2138
136 Ga0207677_10006364 3300026023 Bacteria 6473
137 Ga0207677_10297101 3300026023 Bacteria 1333
138 Ga0207639_10106961 3300026041 Bacteria 2271
139 Ga0207678_10084924 3300026067 Bacteria 2707
140 Ga0207641_11236936 3300026088 Bacteria 747
141 Ga0207648_10025434 3300026089 Bacteria 5273
142 Ga0207648_10139620 3300026089 Bacteria 2135
143 Ga0207676_10026880 3300026095 Bacteria 4281
144 Ga0207676_10112287 3300026095 Bacteria 2283
145 Ga0207674_10013961 3300026116 Bacteria 8884
146 Ga0207674_11013420 3300026116 Bacteria 799
147 Ga0207675_100025074 3300026118 Bacteria 5550
148 Ga0207698_10019204 3300026142 Bacteria 4675
149 Ga0207698_10760861 3300026142 Bacteria 968
150 Ga0209281_1000455 3300027111 Bacteria 58143
151 Ga0209968_1009565 3300027526 Bacteria 1484
152 Ga0209966_1006715 3300027695 Bacteria 2003
153 Ga0268266_10001353 3300028379 Bacteria 29617
154 Ga0268265_10001883 3300028380 Bacteria 16688
155 Ga0268264_10227199 3300028381 Bacteria 1721
156 Ga0265319_1016626 3300028563 Bacteria 2818
157 Ga0265336_10028297 3300028666 Bacteria 1752
158 Ga0307515_10068068 3300028794 Bacteria 4899
159 Ga0265328_10006652 3300031239 Bacteria 4868
160 Ga0265325_10054190 3300031241 Bacteria 2054
161 Ga0265339_10000007 3300031249 Bacteria 241067
162 Ga0307408_100067293 3300031548 Bacteria 2634
163 Ga0265313_10073378 3300031595 Bacteria 1571
164 Ga0316579_10214950 3300031691 Bacteria 930
165 Ga0307405_10048267 3300031731 Bacteria 2625
166 Ga0307405_10063966 3300031731 Bacteria 2336
167 Ga0307410_10217859 3300031852 Bacteria 1467
168 Ga0307410_10289088 3300031852 Bacteria 1289
169 Ga0307412_10025571 3300031911 Bacteria 3658
170 Ga0307416_100181717 3300032002 Bacteria 1972
171 Ga0307416_100423983 3300032002 Bacteria 1375
172 Ga0307416_100740983 3300032002 Bacteria 1074
173 Ga0307411_11386194 3300032005 Bacteria 643
174 Ga0373957_0076351 3300035120 Bacteria 1317
175 Ga0373955_0016263 3300035172 Bacteria 3659
176 Ga0373931_0432242 3300035691 Bacteria 839
177 Ga0373935_0936297 3300035692 Bacteria 642
178 Ga0373937_0003968 3300036401 Bacteria 12516
179 Ga0373937_0111197 3300036401 Bacteria 2548
180 Ga0373925_0194908 3300037068 Bacteria 1609
181 Ga0395899_0010811 3300037312 Bacteria 6997
182 Ga0395900_0038629 3300037418 Bacteria 4921
183 Ga0395905_0007267 3300037471 Bacteria 11036
184 Ga0395905_0128865 3300037471 Bacteria 2379
185 Ga0395901_0061561 3300038443 Bacteria 3905
186 Ga0237816_00071 3300039145 Bacteria 7005
187 Ga0436365_0926934 3300039437 Bacteria 841
188 Ga0436360_1034853 3300039438 Bacteria 694
189 Ga0436363_0016106 3300039450 Bacteria 730
190 Ga0439461_0020876 3300041410 Bacteria 1301
191 Ga0439465_0003309 3300041413 Bacteria 5263
192 Ga0451807_1612768 3300041486 Bacteria 708
193 Ga0439443_033677 3300042003 Bacteria 853
194 Ga0439434_0070342 3300042435 Bacteria 1101
195 Ga0451577_0038637 3300042876 Bacteria 4292
196 Ga0466963_0378848 3300044694 Bacteria 997
197 Ga0453684_0017561 3300044712 Bacteria 11069
198 Ga0453684_0381917 3300044712 Bacteria 1581
199 Ga0466971_0312588 3300044719 Bacteria 756
200 Ga0466957_0810523 3300044842 Bacteria 665
201 Ga0466960_0418125 3300044901 Bacteria 775
202 Ga0451576_0033914 3300045051 Bacteria 5423
203 Ga0466958_0320208 3300045836 Bacteria 997
204 Ga0495592_0000087 3300046454 Bacteria 81851
205 Ga0495629_0180831 3300046459 Bacteria 1461
206 Ga0495580_0085287 3300046472 Bacteria 2200
207 Ga0495582_0049048 3300046473 Bacteria 2325
208 Ga0495594_0020447 3300046499 Bacteria 3526
209 Ga0495606_0187524 3300046507 Bacteria 1188
210 Ga0495618_0049953 3300046514 Bacteria 2641
211 Ga0495630_0006993 3300046517 Bacteria 8043
212 Ga0495640_0158582 3300046533 Bacteria 1451
213 Ga0495586_0001949 3300046535 Bacteria 11264
214 Ga0495586_0004802 3300046535 Bacteria 7224
215 Ga0495597_0145949 3300046542 Bacteria 973
216 Ga0495634_0081435 3300046642 Bacteria 2117
217 Ga0495658_0027689 3300046683 Bacteria 3053
218 Ga0495658_0106100 3300046683 Bacteria 1683
219 Ga0495613_0016024 3300046689 Bacteria 5581
220 Ga0495671_0014220 3300046692 Bacteria 4289
221 Ga0495649_0059242 3300046694 Bacteria 2062
222 Ga0495649_0450778 3300046694 Bacteria 643
223 Ga0495581_0047773 3300047315 Bacteria 2473
224 Ga0495674_0010008 3300047319 Bacteria 8986
225 Ga0495674_0056890 3300047319 Bacteria 3424
226 Ga0495672_0129721 3300047320 Bacteria 1328
227 Ga0495614_0060652 3300048089 Bacteria 1625
228 Ga0496112_0583468 3300048915 Bacteria 1050
229 Ga0496115_0914036 3300048918 Bacteria 676
230 Ga0496116_0005168 3300048919 Bacteria 12252
231 Ga0496117_0087161 3300048920 Bacteria 2024
232 Ga0496118_0006998 3300048921 Bacteria 12155
233 Ga0496119_0003736 3300048922 Bacteria 15581
234 Ga0496120_0013733 3300048923 Bacteria 5437
235 Ga0496122_0000059 3300048925 Bacteria 247170
236 Ga0496123_0000013 3300048926 Bacteria 439694
237 Ga0496124_0008021 3300048927 Bacteria 11107
238 Ga0496125_0007898 3300048928 Bacteria 11236
239 Ga0496126_0147892 3300048929 Bacteria 2016
240 Ga0496126_0519957 3300048929 Bacteria 948
241 Ga0496126_0669411 3300048929 Bacteria 810
242 Ga0501298_053882 3300049521 Bacteria 839
243 Ga0501031_0270130 3300049568 Bacteria 1104
244 Ga0501032_0118449 3300049569 Bacteria 1751
245 Ga0501036_0607034 3300049572 Bacteria 907
246 Ga0501038_0189568 3300049574 Bacteria 1655
247 Ga0501039_0136256 3300049575 Bacteria 1928
248 Ga0501039_0360502 3300049575 Bacteria 1142
249 Ga0501039_0431924 3300049575 Bacteria 1034
250 Ga0501040_0275128 3300049576 Bacteria 1202
251 Ga0501040_0655943 3300049576 Bacteria 758
252 Ga0501041_0120845 3300049577 Bacteria 1628
253 Ga0501041_0139164 3300049577 Bacteria 1513
254 Ga0501042_0551983 3300049578 Bacteria 837
255 Ga0501046_0561735 3300049580 Bacteria 813
256 Ga0501047_0175522 3300049581 Bacteria 2010
257 Ga0501048_0250829 3300049582 Bacteria 1256
258 Ga0501068_0133896 3300049584 Bacteria 1551
259 Ga0501070_0368143 3300049586 Bacteria 1165
260 Ga0501070_0578845 3300049586 Bacteria 897
261 Ga0501070_0652603 3300049586 Bacteria 835
262 Ga0501071_0975230 3300049587 Bacteria 654
263 Ga0501072_0012582 3300049588 Bacteria 6469
264 Ga0501073_0332537 3300049589 Bacteria 1049
265 Ga0501075_0063395 3300049591 Bacteria 2786
266 Ga0501075_0115803 3300049591 Bacteria 2038
267 Ga0501075_0207113 3300049591 Bacteria 1496
268 Ga0501076_0223195 3300049592 Bacteria 1540
269 Ga0501077_0011951 3300049593 Bacteria 5431
270 Ga0501077_0075245 3300049593 Bacteria 2138
271 Ga0501079_0039731 3300049741 Bacteria 3629
272 Ga0501079_0084093 3300049741 Bacteria 2462
273 Ga0501079_0270408 3300049741 Bacteria 1329
274 Ga0501083_0010736 3300049744 Bacteria 6440
275 Ga0501035_0117636 3300049822 Bacteria 2326
276 Ga0501035_0238461 3300049822 Bacteria 1548
277 Ga0501044_0252358 3300049823 Bacteria 1705
278 Ga0501044_0855782 3300049823 Bacteria 786
279 Ga0501045_0116717 3300049824 Bacteria 1981
280 Ga0501045_0193047 3300049824 Bacteria 1517
281 Ga0501045_0400600 3300049824 Bacteria 1021
282 Ga0501045_0428147 3300049824 Bacteria 984
283 nmdc:mga05p37_173342_c1 3300050507 Bacteria 2630
284 nmdc:mga05p37_369343_c1 3300050507 Bacteria 1684
285 nmdc:mga05p37_439810_c1 3300050507 Bacteria 1513
286 nmdc:mga05p37_994722_c1 3300050507 Bacteria 892
287 nmdc:mga09592_15824_c1 3300050508 Bacteria 6164
288 nmdc:mga09592_40924_c1 3300050508 Bacteria 3895
289 nmdc:mga0qj67_191589_c1 3300050509 Bacteria 1662
290 nmdc:mga0qj67_24328_c1 3300050509 Bacteria 4668
291 nmdc:mga06r32_312139_c1 3300050510 Bacteria 1558
292 nmdc:mga06r32_4963_c1 3300050510 Bacteria 11992
293 nmdc:mga06r32_931956_c1 3300050510 Bacteria 824
294 nmdc:mga0n895_263692_c1 3300050512 Bacteria 1748
295 nmdc:mga0n895_30018_c1 3300050512 Bacteria 5191
296 nmdc:mga0n895_3724_c1 3300050512 Bacteria 12336
297 nmdc:mga0n895_59678_c1 3300050512 Bacteria 3764
298 nmdc:mga0rr50_92512_c1 3300050513 Bacteria 2358
299 nmdc:mga0a205_50987_c1 3300050515 Bacteria 3995
300 nmdc:mga0a205_819028_c1 3300050515 Bacteria 779
301 Ga0500635_0022089 3300053080 Bacteria 1968
302 Ga0501084_0212616 3300054114 Bacteria 1632
303 Ga0501084_0286131 3300054114 Bacteria 1392
304 Ga0501084_0470607 3300054114 Bacteria 1062
305 Ga0501082_0466700 3300060353 Bacteria 1103
306 Ga0501082_0858775 3300060353 Bacteria 794
307 Ga0501082_0886455 3300060353 Bacteria 780
308 Ga0530510_0054569 3300061734 Bacteria 2887
309 Ga0530510_0060494 3300061734 Bacteria 2741

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10002911 Ga0070658_100029119 151
2 3300005435 Ga0070714_100000801 Ga0070714_10000080111 151
3 3300005436 Ga0070713_100010652 Ga0070713_1000106522 151
4 3300005616 Ga0068852_100017584 Ga0068852_1000175843 151
5 3300013105 Ga0157369_10063384 Ga0157369_100633842 151
6 3300025909 Ga0207705_10001954 Ga0207705_1000195412 151
7 3300025929 Ga0207664_10109868 Ga0207664_101098683 151
8 3300026142 Ga0207698_10019204 Ga0207698_100192044 151
9 3300039438 Ga0436360_1034853 Ga0436360_1034853_167_625 152
10 3300005335 Ga0070666_10188517 Ga0070666_101885172 155
11 3300005459 Ga0068867_100536122 Ga0068867_1005361221 155
12 3300014968 Ga0157379_10075929 Ga0157379_100759292 156
13 3300039450 Ga0436363_0016106 Ga0436363_0016106_222_692 156
14 3300050507 nmdc:mga05p37_994722_c1 nmdc:mga05p37_994722_c1_39_509 156
15 3300037068 Ga0373925_0194908 Ga0373925_0194908_358_858 161
16 3300046472 Ga0495580_0085287 Ga0495580_0085287_1024_1509 161
17 3300046683 Ga0495658_0106100 Ga0495658_0106100_96_596 161
18 3300050512 nmdc:mga0n895_30018_c1 nmdc:mga0n895_30018_c1_661_1146 161
19 3300009093 Ga0105240_10439125 Ga0105240_104391252 162
20 3300009147 Ga0114129_10799650 Ga0114129_107996502 162
21 3300025907 Ga0207645_10115476 Ga0207645_101154763 162
22 3300028666 Ga0265336_10028297 Ga0265336_100282972 162
23 3300031239 Ga0265328_10006652 Ga0265328_100066523 162
24 3300031249 Ga0265339_10000007 Ga0265339_10000007154 162
25 3300035691 Ga0373931_0432242 Ga0373931_0432242_293_781 162
26 3300042435 Ga0439434_0070342 Ga0439434_0070342_423_941 162
27 3300044842 Ga0466957_0810523 Ga0466957_0810523_35_523 162
28 3300046542 Ga0495597_0145949 Ga0495597_0145949_215_706 162
29 3300047315 Ga0495581_0047773 Ga0495581_0047773_1768_2268 162
30 3300048915 Ga0496112_0583468 Ga0496112_0583468_458_946 162
31 3300050507 nmdc:mga05p37_369343_c1 nmdc:mga05p37_369343_c1_257_757 162
32 3300050510 nmdc:mga06r32_931956_c1 nmdc:mga06r32_931956_c1_261_749 162
33 3300050512 nmdc:mga0n895_59678_c1 nmdc:mga0n895_59678_c1_2244_2750 162
34 3300050515 nmdc:mga0a205_819028_c1 nmdc:mga0a205_819028_c1_226_732 162
35 3300005339 Ga0070660_100761022 Ga0070660_1007610221 169
36 3300044712 Ga0453684_0017561 Ga0453684_0017561_6022_6546 170
37 3300044712 Ga0453684_0381917 Ga0453684_0381917_96_620 170
38 3300036401 Ga0373937_0003968 Ga0373937_0003968_9911_10426 171
39 3300044719 Ga0466971_0312588 Ga0466971_0312588_20_547 171
40 3300046459 Ga0495629_0180831 Ga0495629_0180831_757_1272 171
41 3300046473 Ga0495582_0049048 Ga0495582_0049048_942_1457 171
42 3300046499 Ga0495594_0020447 Ga0495594_0020447_1905_2420 171
43 3300046517 Ga0495630_0006993 Ga0495630_0006993_19_534 171
44 3300046689 Ga0495613_0016024 Ga0495613_0016024_4185_4700 171
45 3300046694 Ga0495649_0450778 Ga0495649_0450778_93_620 171
46 3300048089 Ga0495614_0060652 Ga0495614_0060652_955_1470 171
47 3300049577 Ga0501041_0139164 Ga0501041_0139164_241_768 171
48 3300049593 Ga0501077_0011951 Ga0501077_0011951_1078_1605 171
49 3300061734 Ga0530510_0054569 Ga0530510_0054569_2238_2765 171
50 3300044901 Ga0466960_0418125 Ga0466960_0418125_123_683 175
51 iso_pu_bacteria 2891326441 2891329095 175
52 iso_pu_bacteria 8002775197 8002780337 177
53 3300006880 Ga0075429_100030116 Ga0075429_1000301164 179
54 3300009094 Ga0111539_10267008 Ga0111539_102670081 179
55 3300009147 Ga0114129_10081022 Ga0114129_100810225 179
56 3300025927 Ga0207687_10419359 Ga0207687_104193593 179
57 3300025961 Ga0207712_10143299 Ga0207712_101432993 179
58 3300026095 Ga0207676_10112287 Ga0207676_101122874 179
59 3300026118 Ga0207675_100025074 Ga0207675_1000250749 179
60 3300032002 Ga0307416_100181717 Ga0307416_1001817172 179
61 3300048919 Ga0496116_0005168 Ga0496116_0005168_119_667 179
62 3300048920 Ga0496117_0087161 Ga0496117_0087161_19_567 179
63 3300048921 Ga0496118_0006998 Ga0496118_0006998_2606_3154 179
64 3300048922 Ga0496119_0003736 Ga0496119_0003736_2591_3139 179
65 3300048923 Ga0496120_0013733 Ga0496120_0013733_2279_2827 179
66 3300048925 Ga0496122_0000059 Ga0496122_0000059_188421_188969 179
67 3300048926 Ga0496123_0000013 Ga0496123_0000013_387811_388359 179
68 3300048927 Ga0496124_0008021 Ga0496124_0008021_7811_8359 179
69 3300048928 Ga0496125_0007898 Ga0496125_0007898_8058_8606 179
70 3300048929 Ga0496126_0519957 Ga0496126_0519957_104_652 179
71 3300050507 nmdc:mga05p37_439810_c1 nmdc:mga05p37_439810_c1_327_884 179
72 3300050508 nmdc:mga09592_40924_c1 nmdc:mga09592_40924_c1_459_1016 179
73 3300050509 nmdc:mga0qj67_191589_c1 nmdc:mga0qj67_191589_c1_534_1091 179
74 3300005330 Ga0070690_100440901 Ga0070690_1004409012 180
75 3300005338 Ga0068868_100004939 Ga0068868_1000049393 180
76 3300005471 Ga0070698_100000353 Ga0070698_10000035310 180
77 3300006237 Ga0097621_100032320 Ga0097621_1000323204 180
78 3300006881 Ga0068865_100508193 Ga0068865_1005081933 180
79 3300009093 Ga0105240_10410936 Ga0105240_104109361 180
80 3300014969 Ga0157376_10045747 Ga0157376_100457474 180
81 3300017792 Ga0163161_10059677 Ga0163161_100596772 180
82 3300025913 Ga0207695_10435185 Ga0207695_104351852 180
83 3300025938 Ga0207704_10550563 Ga0207704_105505632 180
84 3300025961 Ga0207712_10218532 Ga0207712_102185322 180
85 3300026023 Ga0207677_10006364 Ga0207677_100063642 180
86 3300026088 Ga0207641_11236936 Ga0207641_112369362 180
87 3300026089 Ga0207648_10025434 Ga0207648_100254342 180
88 3300048918 Ga0496115_0914036 Ga0496115_0914036_116_661 180
89 3300049589 Ga0501073_0332537 Ga0501073_0332537_27_581 180
90 3300050512 nmdc:mga0n895_263692_c1 nmdc:mga0n895_263692_c1_165_719 180
91 3300003775 Ga0055524_1000340 Ga0055524_100034038 181
92 3300005331 Ga0070670_100065398 Ga0070670_1000653983 181
93 3300005335 Ga0070666_10142356 Ga0070666_101423562 181
94 3300005340 Ga0070689_100338369 Ga0070689_1003383692 181
95 3300005345 Ga0070692_10027187 Ga0070692_100271871 181
96 3300005355 Ga0070671_100099429 Ga0070671_1000994291 181
97 3300005367 Ga0070667_100162146 Ga0070667_1001621462 181
98 3300005564 Ga0070664_100033070 Ga0070664_1000330703 181
99 3300005617 Ga0068859_100000524 Ga0068859_1000005242 181
100 3300005618 Ga0068864_100292860 Ga0068864_1002928602 181
101 3300005841 Ga0068863_100339304 Ga0068863_1003393043 181
102 3300005843 Ga0068860_100238113 Ga0068860_1002381133 181
103 3300005844 Ga0068862_100002395 Ga0068862_10000239516 181
104 3300006237 Ga0097621_100740650 Ga0097621_1007406501 181
105 3300006931 Ga0097620_100000524 Ga0097620_1000005242 181
106 3300006946 Ga0079104_1000328 Ga0079104_100032858 181
107 3300009174 Ga0105241_10327670 Ga0105241_103276702 181
108 3300009177 Ga0105248_10503009 Ga0105248_105030091 181
109 3300013296 Ga0157374_11270904 Ga0157374_112709041 181
110 3300013307 Ga0157372_11283663 Ga0157372_112836631 181
111 3300014325 Ga0163163_10089471 Ga0163163_100894714 181
112 3300014325 Ga0163163_10250919 Ga0163163_102509191 181
113 3300014968 Ga0157379_11501889 Ga0157379_115018891 181
114 3300014969 Ga0157376_11171754 Ga0157376_111717541 181
115 3300025263 Ga0209565_1001678 Ga0209565_10016788 181
116 3300025299 Ga0209256_1000120 Ga0209256_1000120145 181
117 3300025903 Ga0207680_10039867 Ga0207680_100398672 181
118 3300025918 Ga0207662_10574207 Ga0207662_105742072 181
119 3300025923 Ga0207681_10128605 Ga0207681_101286053 181
120 3300025931 Ga0207644_10146635 Ga0207644_101466351 181
121 3300025933 Ga0207706_10203039 Ga0207706_102030391 181
122 3300025944 Ga0207661_10356267 Ga0207661_103562672 181
123 3300025945 Ga0207679_10037290 Ga0207679_100372902 181
124 3300025972 Ga0207668_10399709 Ga0207668_103997092 181
125 3300025986 Ga0207658_10114578 Ga0207658_101145782 181
126 3300026089 Ga0207648_10139620 Ga0207648_101396202 181
127 3300026095 Ga0207676_10026880 Ga0207676_100268806 181
128 3300027111 Ga0209281_1000455 Ga0209281_100045557 181
129 3300028380 Ga0268265_10001883 Ga0268265_100018831 181
130 3300028381 Ga0268264_10227199 Ga0268264_102271993 181
131 3300028794 Ga0307515_10068068 Ga0307515_100680687 181
132 3300031691 Ga0316579_10214950 Ga0316579_102149501 181
133 3300037471 Ga0395905_0128865 Ga0395905_0128865_494_1054 181
134 3300039437 Ga0436365_0926934 Ga0436365_0926934_263_823 181
135 3300041410 Ga0439461_0020876 Ga0439461_0020876_193_759 181
136 3300041413 Ga0439465_0003309 Ga0439465_0003309_278_844 181
137 3300041486 Ga0451807_1612768 Ga0451807_1612768_45_602 181
138 3300042876 Ga0451577_0038637 Ga0451577_0038637_454_1011 181
139 3300045051 Ga0451576_0033914 Ga0451576_0033914_1969_2514 181
140 3300046454 Ga0495592_0000087 Ga0495592_0000087_5630_6187 181
141 3300046514 Ga0495618_0049953 Ga0495618_0049953_70_627 181
142 3300046535 Ga0495586_0004802 Ga0495586_0004802_3363_3920 181
143 3300046683 Ga0495658_0027689 Ga0495658_0027689_575_1132 181
144 3300047319 Ga0495674_0010008 Ga0495674_0010008_5335_5892 181
145 3300047320 Ga0495672_0129721 Ga0495672_0129721_617_1183 181
146 3300049572 Ga0501036_0607034 Ga0501036_0607034_154_723 181
147 3300049575 Ga0501039_0136256 Ga0501039_0136256_452_1009 181
148 3300049575 Ga0501039_0360502 Ga0501039_0360502_54_620 181
149 3300049575 Ga0501039_0431924 Ga0501039_0431924_111_680 181
150 3300049576 Ga0501040_0275128 Ga0501040_0275128_507_1064 181
151 3300049576 Ga0501040_0655943 Ga0501040_0655943_105_674 181
152 3300049578 Ga0501042_0551983 Ga0501042_0551983_89_658 181
153 3300049582 Ga0501048_0250829 Ga0501048_0250829_133_702 181
154 3300049584 Ga0501068_0133896 Ga0501068_0133896_207_776 181
155 3300049586 Ga0501070_0652603 Ga0501070_0652603_146_715 181
156 3300049587 Ga0501071_0975230 Ga0501071_0975230_59_616 181
157 3300049588 Ga0501072_0012582 Ga0501072_0012582_3060_3629 181
158 3300049591 Ga0501075_0063395 Ga0501075_0063395_690_1259 181
159 3300049741 Ga0501079_0039731 Ga0501079_0039731_868_1434 181
160 3300049741 Ga0501079_0084093 Ga0501079_0084093_1483_2040 181
161 3300049741 Ga0501079_0270408 Ga0501079_0270408_637_1203 181
162 3300049822 Ga0501035_0117636 Ga0501035_0117636_1398_1955 181
163 3300049822 Ga0501035_0238461 Ga0501035_0238461_572_1141 181
164 3300049823 Ga0501044_0855782 Ga0501044_0855782_76_642 181
165 3300049824 Ga0501045_0116717 Ga0501045_0116717_594_1151 181
166 3300049824 Ga0501045_0193047 Ga0501045_0193047_203_772 181
167 3300049824 Ga0501045_0428147 Ga0501045_0428147_30_596 181
168 3300053080 Ga0500635_0022089 Ga0500635_0022089_1106_1672 181
169 3300054114 Ga0501084_0470607 Ga0501084_0470607_312_881 181
170 3300060353 Ga0501082_0886455 Ga0501082_0886455_101_667 181
171 3300061734 Ga0530510_0060494 Ga0530510_0060494_1141_1707 181
172 3300003322 rootL2_10031260 rootL2_100312602 182
173 3300003792 Ga0055540_1025093 Ga0055540_10250932 182
174 3300003794 Ga0055531_10000152 Ga0055531_1000015260 182
175 3300005329 Ga0070683_100125920 Ga0070683_1001259204 182
176 3300005329 Ga0070683_100616551 Ga0070683_1006165511 182
177 3300005331 Ga0070670_100080621 Ga0070670_1000806212 182
178 3300005336 Ga0070680_100025953 Ga0070680_1000259532 182
179 3300005338 Ga0068868_100310310 Ga0068868_1003103101 182
180 3300005344 Ga0070661_100023487 Ga0070661_1000234875 182
181 3300005356 Ga0070674_100092721 Ga0070674_1000927214 182
182 3300005356 Ga0070674_100655615 Ga0070674_1006556151 182
183 3300005366 Ga0070659_100312092 Ga0070659_1003120923 182
184 3300005435 Ga0070714_100810773 Ga0070714_1008107731 182
185 3300005467 Ga0070706_100004644 Ga0070706_10000464413 182
186 3300005518 Ga0070699_100109376 Ga0070699_1001093763 182
187 3300005530 Ga0070679_100169536 Ga0070679_1001695363 182
188 3300005530 Ga0070679_100608272 Ga0070679_1006082721 182
189 3300005539 Ga0068853_100045144 Ga0068853_1000451443 182
190 3300005539 Ga0068853_100552638 Ga0068853_1005526382 182
191 3300005546 Ga0070696_100009360 Ga0070696_1000093609 182
192 3300005547 Ga0070693_100022590 Ga0070693_1000225903 182
193 3300005563 Ga0068855_100381133 Ga0068855_1003811332 182
194 3300005564 Ga0070664_100351103 Ga0070664_1003511032 182
195 3300005577 Ga0068857_100030851 Ga0068857_1000308514 182
196 3300005614 Ga0068856_100075914 Ga0068856_1000759142 182
197 3300005616 Ga0068852_100091639 Ga0068852_1000916392 182
198 3300005616 Ga0068852_100921069 Ga0068852_1009210692 182
199 3300005718 Ga0068866_10153809 Ga0068866_101538092 182
200 3300005834 Ga0068851_10020624 Ga0068851_100206243 182
201 3300005834 Ga0068851_10515295 Ga0068851_105152951 182
202 3300006028 Ga0070717_10246116 Ga0070717_102461163 182
203 3300006195 Ga0075366_10205275 Ga0075366_102052752 182
204 3300006844 Ga0075428_101245336 Ga0075428_1012453362 182
205 3300006847 Ga0075431_100078045 Ga0075431_1000780456 182
206 3300006852 Ga0075433_10010601 Ga0075433_100106014 182
207 3300006852 Ga0075433_10116570 Ga0075433_101165704 182
208 3300006871 Ga0075434_100041468 Ga0075434_1000414682 182
209 3300006871 Ga0075434_100075106 Ga0075434_1000751063 182
210 3300006871 Ga0075434_100127752 Ga0075434_1001277521 182
211 3300006871 Ga0075434_100282560 Ga0075434_1002825602 182
212 3300006880 Ga0075429_100694367 Ga0075429_1006943672 182
213 3300007076 Ga0075435_100049171 Ga0075435_1000491715 182
214 3300007076 Ga0075435_100435092 Ga0075435_1004350921 182
215 3300009148 Ga0105243_11109075 Ga0105243_111090752 182
216 3300009174 Ga0105241_10099034 Ga0105241_100990343 182
217 3300009177 Ga0105248_10880382 Ga0105248_108803822 182
218 3300013100 Ga0157373_10027175 Ga0157373_100271755 182
219 3300013100 Ga0157373_10170431 Ga0157373_101704313 182
220 3300013100 Ga0157373_10384836 Ga0157373_103848361 182
221 3300013105 Ga0157369_10059019 Ga0157369_100590192 182
222 3300013296 Ga0157374_10114057 Ga0157374_101140572 182
223 3300013296 Ga0157374_10623634 Ga0157374_106236342 182
224 3300013307 Ga0157372_10034957 Ga0157372_100349572 182
225 3300025303 Ga0209051_1000059 Ga0209051_1000059154 182
226 3300025304 Ga0209257_1000022 Ga0209257_1000022246 182
227 3300025321 Ga0207656_10010642 Ga0207656_100106422 182
228 3300025910 Ga0207684_10004452 Ga0207684_1000445213 182
229 3300025915 Ga0207693_10126303 Ga0207693_101263031 182
230 3300025920 Ga0207649_10033290 Ga0207649_100332904 182
231 3300025921 Ga0207652_10042760 Ga0207652_100427604 182
232 3300025925 Ga0207650_10025117 Ga0207650_100251171 182
233 3300025928 Ga0207700_11047404 Ga0207700_110474041 182
234 3300025934 Ga0207686_10244164 Ga0207686_102441642 182
235 3300025935 Ga0207709_10595269 Ga0207709_105952691 182
236 3300025937 Ga0207669_10155847 Ga0207669_101558473 182
237 3300025944 Ga0207661_10177491 Ga0207661_101774912 182
238 3300025945 Ga0207679_10058241 Ga0207679_100582412 182
239 3300025945 Ga0207679_10069791 Ga0207679_100697913 182
240 3300025945 Ga0207679_10218151 Ga0207679_102181512 182
241 3300025981 Ga0207640_10051999 Ga0207640_100519992 182
242 3300026023 Ga0207677_10297101 Ga0207677_102971011 182
243 3300026041 Ga0207639_10106961 Ga0207639_101069613 182
244 3300026067 Ga0207678_10084924 Ga0207678_100849243 182
245 3300026116 Ga0207674_10013961 Ga0207674_100139614 182
246 3300026116 Ga0207674_11013420 Ga0207674_110134201 182
247 3300026142 Ga0207698_10760861 Ga0207698_107608611 182
248 3300027526 Ga0209968_1009565 Ga0209968_10095653 182
249 3300027695 Ga0209966_1006715 Ga0209966_10067153 182
250 3300028379 Ga0268266_10001353 Ga0268266_1000135311 182
251 3300028563 Ga0265319_1016626 Ga0265319_10166262 182
252 3300031241 Ga0265325_10054190 Ga0265325_100541903 182
253 3300031548 Ga0307408_100067293 Ga0307408_1000672933 182
254 3300031595 Ga0265313_10073378 Ga0265313_100733781 182
255 3300031731 Ga0307405_10048267 Ga0307405_100482673 182
256 3300031731 Ga0307405_10063966 Ga0307405_100639663 182
257 3300031852 Ga0307410_10217859 Ga0307410_102178591 182
258 3300031852 Ga0307410_10289088 Ga0307410_102890882 182
259 3300031911 Ga0307412_10025571 Ga0307412_100255715 182
260 3300032002 Ga0307416_100423983 Ga0307416_1004239831 182
261 3300032002 Ga0307416_100740983 Ga0307416_1007409832 182
262 3300032005 Ga0307411_11386194 Ga0307411_113861941 182
263 3300035120 Ga0373957_0076351 Ga0373957_0076351_146_694 182
264 3300035172 Ga0373955_0016263 Ga0373955_0016263_3018_3566 182
265 3300035692 Ga0373935_0936297 Ga0373935_0936297_46_594 182
266 3300036401 Ga0373937_0111197 Ga0373937_0111197_1771_2319 182
267 3300037312 Ga0395899_0010811 Ga0395899_0010811_4744_5292 182
268 3300037418 Ga0395900_0038629 Ga0395900_0038629_3184_3732 182
269 3300037471 Ga0395905_0007267 Ga0395905_0007267_5285_5833 182
270 3300038443 Ga0395901_0061561 Ga0395901_0061561_2594_3142 182
271 3300039145 Ga0237816_00071 Ga0237816_00071_6352_6924 182
272 3300042003 Ga0439443_033677 Ga0439443_033677_200_760 182
273 3300044694 Ga0466963_0378848 Ga0466963_0378848_100_672 182
274 3300045836 Ga0466958_0320208 Ga0466958_0320208_426_986 182
275 3300046507 Ga0495606_0187524 Ga0495606_0187524_338_916 182
276 3300046533 Ga0495640_0158582 Ga0495640_0158582_341_925 182
277 3300046535 Ga0495586_0001949 Ga0495586_0001949_8769_9353 182
278 3300046642 Ga0495634_0081435 Ga0495634_0081435_360_944 182
279 3300046692 Ga0495671_0014220 Ga0495671_0014220_236_814 182
280 3300046694 Ga0495649_0059242 Ga0495649_0059242_717_1295 182
281 3300047319 Ga0495674_0056890 Ga0495674_0056890_2848_3396 182
282 3300048929 Ga0496126_0147892 Ga0496126_0147892_1062_1616 182
283 3300048929 Ga0496126_0669411 Ga0496126_0669411_232_780 182
284 3300049521 Ga0501298_053882 Ga0501298_053882_110_670 182
285 3300049568 Ga0501031_0270130 Ga0501031_0270130_254_802 182
286 3300049569 Ga0501032_0118449 Ga0501032_0118449_464_1075 182
287 3300049574 Ga0501038_0189568 Ga0501038_0189568_527_1138 182
288 3300049577 Ga0501041_0120845 Ga0501041_0120845_86_646 182
289 3300049580 Ga0501046_0561735 Ga0501046_0561735_180_740 182
290 3300049581 Ga0501047_0175522 Ga0501047_0175522_1108_1719 182
291 3300049586 Ga0501070_0368143 Ga0501070_0368143_492_1055 182
292 3300049586 Ga0501070_0578845 Ga0501070_0578845_259_819 182
293 3300049591 Ga0501075_0115803 Ga0501075_0115803_1301_1849 182
294 3300049591 Ga0501075_0207113 Ga0501075_0207113_132_692 182
295 3300049592 Ga0501076_0223195 Ga0501076_0223195_98_658 182
296 3300049593 Ga0501077_0075245 Ga0501077_0075245_1551_2111 182
297 3300049744 Ga0501083_0010736 Ga0501083_0010736_4582_5130 182
298 3300049823 Ga0501044_0252358 Ga0501044_0252358_898_1446 182
299 3300049824 Ga0501045_0400600 Ga0501045_0400600_325_885 182
300 3300050507 nmdc:mga05p37_173342_c1 nmdc:mga05p37_173342_c1_329_889 182
301 3300050508 nmdc:mga09592_15824_c1 nmdc:mga09592_15824_c1_2707_3267 182
302 3300050509 nmdc:mga0qj67_24328_c1 nmdc:mga0qj67_24328_c1_2022_2582 182
303 3300050510 nmdc:mga06r32_312139_c1 nmdc:mga06r32_312139_c1_908_1537 182
304 3300050510 nmdc:mga06r32_4963_c1 nmdc:mga06r32_4963_c1_6910_7470 182
305 3300050512 nmdc:mga0n895_3724_c1 nmdc:mga0n895_3724_c1_5750_6298 182
306 3300050513 nmdc:mga0rr50_92512_c1 nmdc:mga0rr50_92512_c1_1404_1952 182
307 3300050515 nmdc:mga0a205_50987_c1 nmdc:mga0a205_50987_c1_1876_2424 182
308 3300054114 Ga0501084_0212616 Ga0501084_0212616_313_873 182
309 3300054114 Ga0501084_0286131 Ga0501084_0286131_190_750 182
310 3300060353 Ga0501082_0466700 Ga0501082_0466700_155_715 182
311 3300060353 Ga0501082_0858775 Ga0501082_0858775_89_694 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

33

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.813 3 181
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.804 3 181
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.8002 2 179
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.7794 1 179
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7786 3 182
ID Description Score Start End Superfamily
2wbmB03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8438 161 181 3.30.70.240
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7897 3 182 3.40.430.10
3fgeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7868 161 182 2.30.110.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7702 2 178 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7687 1 179 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A1G8DFK4-F1-model_v4 Dihydrofolate reductase 0.9926 1 181 GO:0008703
GO:0009231
AF-A0A3N5FXU3-F1-model_v4 Deaminase 0.985 1 154 GO:0008703
GO:0009231
AF-A0A4Q5YEZ0-F1-model_v4 Deaminase 0.9846 44 182 GO:0008703
GO:0009231
AF-A0A7V9GHA7-F1-model_v4 Dihydrofolate reductase family protein 0.9828 1 182 GO:0008703
GO:0009231
AF-A0A1G8DFK4-F1-model_v4 Dihydrofolate reductase 0.9818 1 181 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
93.47 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map