F401172

General Info

Members Datasets Scaffolds Average Seq Length
311 111 598 158

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10031840|Ga0114129_100318407
Length 176
Sequence LHIEVNLWNGLRGSSQHMKVQDKMNNAPDFANNLFQLMGETFENPIGIYLDKNTSLFQTLETVSAEEASIPVGGKCASLAAQVAHVTFFIESFERFALQGDNSPRDWGLIWRTVEKVTAEEWEEYKRKLKDAYLRMDKLFHENPTWNEDSIGGALSIVVHTAYHLGEIRQACCTLK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
73 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
74 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
76 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
77 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
81 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
82 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
83 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
98 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
99 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
111 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.64
Rhizosphere 99.36
Stem 0
Stem Tuber 0
Unclassified 28.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10031840 3300009147 Bacteria 7455
2 SwRhRL3b_contig_1167537 2162886006 Bacteria 996
3 SwRhRL3b_contig_812620 2162886006 Bacteria 1093
4 SwRhRL2b_contig_3367869 2162886007 Bacteria 4683
5 JGI25406J46586_10007476 3300003203 Bacteria 4984
6 Ga0065704_10000299 3300005289 Bacteria 46457
7 Ga0065704_10122873 3300005289 Bacteria 1743
8 Ga0065704_10131424 3300005289 Bacteria 1624
9 Ga0065704_10138538 3300005289 Unclassified 1509
10 Ga0065707_10000487 3300005295 Bacteria 33578
11 Ga0065707_10084273 3300005295 Bacteria 7418
12 Ga0065707_10087045 3300005295 Bacteria 5190
13 Ga0065707_10091181 3300005295 Bacteria 3991
14 Ga0065707_10186949 3300005295 Bacteria 1383
15 Ga0065707_10231683 3300005295 Bacteria 1186
16 Ga0065707_10581978 3300005295 Unclassified 701
17 Ga0068869_100584947 3300005334 Bacteria 941
18 Ga0070689_100229513 3300005340 Bacteria 1525
19 Ga0070689_100496403 3300005340 Unclassified 1045
20 Ga0070689_100614062 3300005340 Unclassified 943
21 Ga0070687_100549587 3300005343 Bacteria 785
22 Ga0070688_100780797 3300005365 Unclassified 746
23 Ga0070701_10680756 3300005438 Unclassified 690
24 Ga0070705_100045416 3300005440 Unclassified 2527
25 Ga0070700_100528894 3300005441 Unclassified 912
26 Ga0070694_100118591 3300005444 Bacteria 1896
27 Ga0070694_100119245 3300005444 Bacteria 1891
28 Ga0070694_100266853 3300005444 Unclassified 1300
29 Ga0070694_100292877 3300005444 Unclassified 1245
30 Ga0070694_100443521 3300005444 Unclassified 1023
31 Ga0070706_100120873 3300005467 Bacteria 2442
32 Ga0070706_100373176 3300005467 Unclassified 1329
33 Ga0070707_100128718 3300005468 Bacteria 2461
34 Ga0070707_100154671 3300005468 Bacteria 2234
35 Ga0070707_100599190 3300005468 Unclassified 1064
36 Ga0070698_100040270 3300005471 Bacteria 4803
37 Ga0070698_100068718 3300005471 Bacteria 3559
38 Ga0070698_100134596 3300005471 Bacteria 2426
39 Ga0070698_100198456 3300005471 Unclassified 1942
40 Ga0070698_100658571 3300005471 Unclassified 988
41 Ga0070699_100026594 3300005518 Bacteria 4989
42 Ga0070699_100056768 3300005518 Plasmid 3390
43 Ga0070699_100126348 3300005518 Unclassified 2252
44 Ga0070699_100458586 3300005518 Unclassified 1156
45 Ga0070699_100918797 3300005518 Unclassified 802
46 Ga0070697_100212810 3300005536 Bacteria 1646
47 Ga0070695_101022863 3300005545 Unclassified 673
48 Ga0070696_100241025 3300005546 Bacteria 1364
49 Ga0070696_100289122 3300005546 Unclassified 1252
50 Ga0070704_100178464 3300005549 Bacteria 1696
51 Ga0070704_100260273 3300005549 Unclassified 1429
52 Ga0070704_100339749 3300005549 Bacteria 1264
53 Ga0070704_100553580 3300005549 Unclassified 1005
54 Ga0070704_101183084 3300005549 Bacteria 697
55 Ga0068857_100660928 3300005577 Bacteria 991
56 Ga0068859_100077593 3300005617 Bacteria 3362
57 Ga0068859_100102786 3300005617 Unclassified 2915
58 Ga0068859_100105467 3300005617 Unclassified 2878
59 Ga0068859_101078534 3300005617 Bacteria 883
60 Ga0068864_100039895 3300005618 Bacteria 4014
61 Ga0068861_101279952 3300005719 Unclassified 712
62 Ga0068862_100022516 3300005844 Bacteria 5271
63 Ga0068862_100100548 3300005844 Bacteria 2529
64 Ga0068862_100119949 3300005844 Bacteria 2317
65 Ga0068862_100257206 3300005844 Unclassified 1593
66 Ga0081539_10000596 3300005985 Bacteria 73813
67 Ga0081539_10012335 3300005985 Bacteria 6604
68 Ga0075428_100075166 3300006844 Bacteria 3690
69 Ga0075428_100172027 3300006844 Bacteria 2347
70 Ga0075428_101182382 3300006844 Bacteria 806
71 Ga0075428_101199736 3300006844 Bacteria 800
72 Ga0075428_101466754 3300006844 Unclassified 715
73 Ga0075428_101672578 3300006844 Unclassified 664
74 Ga0075428_102030838 3300006844 Unclassified 595
75 Ga0075430_100066455 3300006846 Bacteria 3028
76 Ga0075430_100085240 3300006846 Bacteria 2645
77 Ga0075430_100435544 3300006846 Unclassified 1082
78 Ga0075431_100246166 3300006847 Bacteria 1817
79 Ga0075431_100426329 3300006847 Bacteria 1325
80 Ga0075431_100586322 3300006847 Bacteria 1100
81 Ga0075433_10169854 3300006852 Unclassified 1941
82 Ga0075433_11431223 3300006852 Bacteria 598
83 Ga0075434_101160158 3300006871 Bacteria 785
84 Ga0075429_100003533 3300006880 Bacteria 13311
85 Ga0075429_100007554 3300006880 Bacteria 9439
86 Ga0075429_100171652 3300006880 Bacteria 1899
87 Ga0075429_100277170 3300006880 Bacteria 1468
88 Ga0075429_100358479 3300006880 Bacteria 1277
89 Ga0075429_100439959 3300006880 Unclassified 1142
90 Ga0075429_100590986 3300006880 Bacteria 973
91 Ga0075429_100595719 3300006880 Unclassified 968
92 Ga0097620_100077592 3300006931 Bacteria 3362
93 Ga0097620_100102788 3300006931 Unclassified 2915
94 Ga0097620_100105464 3300006931 Unclassified 2878
95 Ga0097620_101078221 3300006931 Bacteria 883
96 Ga0111539_10119363 3300009094 Bacteria 3090
97 Ga0111539_11186760 3300009094 Bacteria 887
98 Ga0105247_10328060 3300009101 Bacteria 1070
99 Ga0114129_10001121 3300009147 Bacteria 35352
100 Ga0114129_10054363 3300009147 Bacteria 5613
101 Ga0114129_10057406 3300009147 Bacteria 5447
102 Ga0114129_10065384 3300009147 Bacteria 5076
103 Ga0114129_10088305 3300009147 Bacteria 4298
104 Ga0114129_10097796 3300009147 Unclassified 4063
105 Ga0114129_10285047 3300009147 Bacteria 2206
106 Ga0114129_10341060 3300009147 Bacteria 1987
107 Ga0114129_11078380 3300009147 Unclassified 1007
108 Ga0114129_11080532 3300009147 Bacteria 1006
109 Ga0114129_12050666 3300009147 Unclassified 691
110 Ga0105243_10018424 3300009148 Bacteria 5288
111 Ga0105243_10296937 3300009148 Bacteria 1462
112 Ga0105243_10303160 3300009148 Unclassified 1449
113 Ga0105243_10713157 3300009148 Bacteria 979
114 Ga0105243_11446882 3300009148 Bacteria 709
115 Ga0105241_10164238 3300009174 Bacteria 1828
116 Ga0105242_10227890 3300009176 Bacteria 1668
117 Ga0105237_10616942 3300009545 Bacteria 1091
118 Ga0105249_10037686 3300009553 Bacteria 4387
119 Ga0105249_10661554 3300009553 Bacteria 1103
120 Ga0105249_12054612 3300009553 Bacteria 644
121 Ga0105246_10012192 3300011119 Bacteria 5356
122 Ga0105246_10044379 3300011119 Bacteria 3021
123 Ga0105246_10255304 3300011119 Bacteria 1394
124 Ga0105246_10283701 3300011119 Unclassified 1330
125 Ga0157372_11754591 3300013307 Unclassified 714
126 Ga0163163_10463802 3300014325 Bacteria 1327
127 Ga0157379_10352805 3300014968 Bacteria 1347
128 Ga0207643_10117305 3300025908 Bacteria 1573
129 Ga0207684_10311529 3300025910 Bacteria 1357
130 Ga0207684_10903072 3300025910 Unclassified 742
131 Ga0207662_10403873 3300025918 Bacteria 927
132 Ga0207646_10087215 3300025922 Bacteria 2793
133 Ga0207646_10219303 3300025922 Unclassified 1718
134 Ga0207706_10556210 3300025933 Bacteria 987
135 Ga0207686_10228788 3300025934 Bacteria 1347
136 Ga0207670_10166225 3300025936 Unclassified 1651
137 Ga0207712_10039795 3300025961 Bacteria 3222
138 Ga0207712_10209362 3300025961 Unclassified 1552
139 Ga0207712_10438463 3300025961 Bacteria 1105
140 Ga0207678_10954224 3300026067 Unclassified 759
141 Ga0207708_10638870 3300026075 Unclassified 905
142 Ga0207676_10076366 3300026095 Bacteria 2707
143 Ga0207676_11025288 3300026095 Bacteria 814
144 Ga0207674_10346357 3300026116 Bacteria 1437
145 Ga0207675_100177018 3300026118 Bacteria 2041
146 Ga0268265_10075482 3300028380 Bacteria 2640
147 Ga0268265_11589415 3300028380 Unclassified 659
148 Ga0268264_10117797 3300028381 Bacteria 2336
149 Ga0316575_10020372 3300031665 Bacteria 2545
150 Ga0316579_10000054 3300031691 Bacteria 27557
151 Ga0316576_10021811 3300031727 Bacteria 4436
152 Ga0316576_10022219 3300031727 Bacteria 4403
153 Ga0316576_10561026 3300031727 Bacteria 836
154 Ga0316578_10000025 3300031728 Bacteria 29963
155 Ga0316578_10009934 3300031728 Bacteria 4917
156 Ga0316577_10008278 3300031733 Bacteria 5570
157 Ga0316577_10060338 3300031733 Bacteria 2117
158 Ga0307407_10282208 3300031903 Bacteria 1151
159 Ga0307412_10347980 3300031911 Bacteria 1189
160 Ga0307409_100880857 3300031995 Bacteria 908
161 Ga0307416_100612501 3300032002 Unclassified 1170
162 Ga0307416_100766097 3300032002 Bacteria 1059
163 Ga0307416_101973143 3300032002 Bacteria 686
164 Ga0307416_102077872 3300032002 Unclassified 670
165 Ga0316583_10000129 3300032133 Bacteria 17653
166 Ga0316585_10000016 3300032137 Bacteria 25117
167 Ga0316580_10000127 3300032139 Bacteria 14527
168 Ga0316596_1004193 3300033541 Bacteria 3216
169 Ga0373928_0201020 3300035084 Unclassified 575
170 Ga0373932_0041817 3300035112 Bacteria 1326
171 Ga0373932_0052824 3300035112 Bacteria 1211
172 Ga0373961_0037789 3300035241 Bacteria 1381
173 Ga0373961_0374115 3300035241 Unclassified 542
174 Ga0316574_0006618 3300035398 Bacteria 6280
175 Ga0316574_0022931 3300035398 Unclassified 3722
176 Ga0316582_0003499 3300036647 Bacteria 7707
177 Ga0316582_0387190 3300036647 Bacteria 963
178 Ga0316582_0476800 3300036647 Unclassified 860
179 Ga0316584_0001487 3300036712 Bacteria 14096
180 Ga0316584_0036049 3300036712 Bacteria 3670
181 Ga0316581_0011568 3300037588 Bacteria 2470
182 Ga0242420_012794 3300038996 Bacteria 1424
183 Ga0242420_097728 3300038996 Unclassified 622
184 Ga0451800_0985563 3300041459 Unclassified 1983
185 Ga0451577_0001442 3300042876 Bacteria 31672
186 Ga0451577_0010019 3300042876 Bacteria 9078
187 Ga0451577_0050988 3300042876 Unclassified 3694
188 Ga0451577_0132319 3300042876 Bacteria 2238
189 Ga0451577_0248011 3300042876 Bacteria 1612
190 Ga0451577_0300373 3300042876 Bacteria 1455
191 Ga0451577_0484711 3300042876 Bacteria 1123
192 Ga0451577_0719214 3300042876 Unclassified 904
193 Ga0451577_0965886 3300042876 Unclassified 766
194 Ga0451577_1026736 3300042876 Bacteria 740
195 Ga0453683_0000474 3300044673 Bacteria 46200
196 Ga0453683_0010530 3300044673 Bacteria 6124
197 Ga0453683_0011964 3300044673 Bacteria 5701
198 Ga0453683_0060533 3300044673 Bacteria 2367
199 Ga0453683_0061360 3300044673 Bacteria 2351
200 Ga0453683_0241062 3300044673 Unclassified 1152
201 Ga0453683_0529935 3300044673 Unclassified 765
202 Ga0453683_0584091 3300044673 Unclassified 728
203 Ga0453683_1019156 3300044673 Bacteria 550
204 Ga0453684_0000012 3300044712 Bacteria 1062512
205 Ga0453684_0000263 3300044712 Bacteria 226494
206 Ga0453684_0001019 3300044712 Bacteria 90275
207 Ga0453684_0001447 3300044712 Bacteria 67554
208 Ga0453684_0003484 3300044712 Bacteria 35348
209 Ga0453684_0004019 3300044712 Bacteria 32024
210 Ga0453684_0004534 3300044712 Bacteria 29139
211 Ga0453684_0026409 3300044712 Bacteria 8388
212 Ga0453684_0039021 3300044712 Bacteria 6477
213 Ga0453684_0096098 3300044712 Bacteria 3641
214 Ga0453684_0109074 3300044712 Bacteria 3368
215 Ga0453684_0109259 3300044712 Bacteria 3364
216 Ga0453684_0138885 3300044712 Unclassified 2905
217 Ga0453684_0144572 3300044712 Bacteria 2835
218 Ga0453684_0165110 3300044712 Unclassified 2615
219 Ga0453684_0169904 3300044712 Unclassified 2571
220 Ga0453684_0231211 3300044712 Bacteria 2135
221 Ga0453684_0238220 3300044712 Unclassified 2096
222 Ga0453684_0312052 3300044712 Bacteria 1784
223 Ga0453684_0338877 3300044712 Bacteria 1698
224 Ga0453684_0352817 3300044712 Bacteria 1658
225 Ga0453684_0408522 3300044712 Bacteria 1519
226 Ga0453684_0448595 3300044712 Bacteria 1436
227 Ga0453684_0690985 3300044712 Bacteria 1110
228 Ga0453684_0714659 3300044712 Bacteria 1088
229 Ga0453684_0914787 3300044712 Unclassified 938
230 Ga0453684_0991183 3300044712 Unclassified 894
231 Ga0453684_1016370 3300044712 Bacteria 881
232 Ga0453684_1074603 3300044712 Unclassified 852
233 Ga0453684_1339542 3300044712 Bacteria 745
234 Ga0453684_1439159 3300044712 Bacteria 713
235 Ga0453684_1772523 3300044712 Bacteria 628
236 Ga0451576_0006756 3300045051 Bacteria 13966
237 Ga0451576_0007343 3300045051 Bacteria 13215
238 Ga0451576_0011787 3300045051 Bacteria 9901
239 Ga0451576_0012302 3300045051 Bacteria 9625
240 Ga0451576_0036108 3300045051 Bacteria 5241
241 Ga0451576_0060686 3300045051 Bacteria 3944
242 Ga0451576_0126961 3300045051 Bacteria 2658
243 Ga0451576_0180798 3300045051 Bacteria 2202
244 Ga0451576_0320510 3300045051 Bacteria 1622
245 Ga0451576_0406406 3300045051 Bacteria 1428
246 Ga0451576_1318019 3300045051 Unclassified 752
247 Ga0451576_1340753 3300045051 Unclassified 745
248 Ga0451576_1798491 3300045051 Unclassified 633
249 Ga0451576_1937833 3300045051 Unclassified 608
250 Ga0451576_2476320 3300045051 Bacteria 530
251 Ga0496108_0264879 3300048911 Bacteria 1496
252 Ga0501294_039993 3300049517 Unclassified 576
253 Ga0501038_1352544 3300049574 Unclassified 513
254 Ga0501039_0664291 3300049575 Unclassified 816
255 Ga0501039_1130630 3300049575 Bacteria 607
256 Ga0501040_0075845 3300049576 Bacteria 2324
257 Ga0501046_0887864 3300049580 Unclassified 622
258 Ga0501048_0963765 3300049582 Bacteria 614
259 Ga0501072_0417508 3300049588 Unclassified 1064
260 Ga0501072_0978683 3300049588 Unclassified 660
261 Ga0501074_0543859 3300049590 Bacteria 822
262 Ga0501075_0524027 3300049591 Bacteria 904
263 Ga0501075_1024183 3300049591 Unclassified 627
264 Ga0501076_0145647 3300049592 Bacteria 1926
265 Ga0501227_071027 3300049665 Bacteria 904
266 Ga0501079_0391401 3300049741 Bacteria 1090
267 Ga0501080_0625529 3300049742 Bacteria 954
268 Ga0501080_0863205 3300049742 Bacteria 791
269 Ga0501081_1229362 3300049743 Unclassified 568
270 nmdc:mga05p37_12096_c1 3300050507 Bacteria 10301
271 nmdc:mga05p37_12995_c1 3300050507 Bacteria 9963
272 nmdc:mga05p37_1426740_c1 3300050507 Unclassified 695
273 nmdc:mga05p37_1465199_c1 3300050507 Unclassified 682
274 nmdc:mga05p37_2774_c1 3300050507 Bacteria 20369
275 nmdc:mga05p37_296526_c1 3300050507 Bacteria 1923
276 nmdc:mga05p37_412650_c1 3300050507 Bacteria 1574
277 nmdc:mga05p37_453104_c1 3300050507 Bacteria 1484
278 nmdc:mga05p37_86517_c1 3300050507 Bacteria 3863
279 nmdc:mga05p37_917399_c1 3300050507 Bacteria 942
280 nmdc:mga09592_1191_c1 3300050508 Bacteria 20784
281 nmdc:mga09592_130679_c1 3300050508 Bacteria 2160
282 nmdc:mga09592_2388_c1 3300050508 Bacteria 15167
283 nmdc:mga09592_327060_c1 3300050508 Bacteria 1328
284 nmdc:mga09592_90179_c1 3300050508 Bacteria 2619
285 nmdc:mga0qj67_349439_c1 3300050509 Bacteria 1195
286 nmdc:mga0qj67_478592_c1 3300050509 Bacteria 1002
287 nmdc:mga0qj67_77394_c1 3300050509 Plasmid 2661
288 nmdc:mga06r32_685719_c1 3300050510 Bacteria 991
289 nmdc:mga06r32_815123_c1 3300050510 Unclassified 893
290 nmdc:mga06r32_969523_c1 3300050510 Bacteria 804
291 nmdc:mga0n895_76574_c1 3300050512 Unclassified 3326
292 nmdc:mga0n895_961814_c1 3300050512 Bacteria 837
293 nmdc:mga0a205_237776_c1 3300050515 Unclassified 1703
294 nmdc:mga0a205_689616_c1 3300050515 Unclassified 871
295 Ga0501084_0245954 3300054114 Bacteria 1510
296 Ga0501084_0297869 3300054114 Bacteria 1362
297 Ga0501082_0391268 3300060353 Bacteria 1213
298 Ga0501082_1046933 3300060353 Unclassified 713
299 Ga0530510_1070469 3300061734 Unclassified 618
300 Ga0114129_10031840
301 SwRhRL3b_contig_1167537
302 SwRhRL3b_contig_812620
303 SwRhRL2b_contig_3367869
304 JGI25406J46586_10007476
305 Ga0065704_10000299
306 Ga0065704_10122873
307 Ga0065704_10131424
308 Ga0065704_10138538
309 Ga0065707_10000487
310 Ga0065707_10084273
311 Ga0065707_10087045
312 Ga0065707_10091181
313 Ga0065707_10186949
314 Ga0065707_10231683
315 Ga0065707_10581978
316 Ga0068869_100584947
317 Ga0070689_100229513
318 Ga0070689_100496403
319 Ga0070689_100614062
320 Ga0070687_100549587
321 Ga0070688_100780797
322 Ga0070701_10680756
323 Ga0070705_100045416
324 Ga0070700_100528894
325 Ga0070694_100118591
326 Ga0070694_100119245
327 Ga0070694_100266853
328 Ga0070694_100292877
329 Ga0070694_100443521
330 Ga0070706_100120873
331 Ga0070706_100373176
332 Ga0070707_100128718
333 Ga0070707_100154671
334 Ga0070707_100599190
335 Ga0070698_100040270
336 Ga0070698_100068718
337 Ga0070698_100134596
338 Ga0070698_100198456
339 Ga0070698_100658571
340 Ga0070699_100026594
341 Ga0070699_100056768
342 Ga0070699_100126348
343 Ga0070699_100458586
344 Ga0070699_100918797
345 Ga0070697_100212810
346 Ga0070695_101022863
347 Ga0070696_100241025
348 Ga0070696_100289122
349 Ga0070704_100178464
350 Ga0070704_100260273
351 Ga0070704_100339749
352 Ga0070704_100553580
353 Ga0070704_101183084
354 Ga0068857_100660928
355 Ga0068859_100077593
356 Ga0068859_100102786
357 Ga0068859_100105467
358 Ga0068859_101078534
359 Ga0068864_100039895
360 Ga0068861_101279952
361 Ga0068862_100022516
362 Ga0068862_100100548
363 Ga0068862_100119949
364 Ga0068862_100257206
365 Ga0081539_10000596
366 Ga0081539_10012335
367 Ga0075428_100075166
368 Ga0075428_100172027
369 Ga0075428_101182382
370 Ga0075428_101199736
371 Ga0075428_101466754
372 Ga0075428_101672578
373 Ga0075428_102030838
374 Ga0075430_100066455
375 Ga0075430_100085240
376 Ga0075430_100435544
377 Ga0075431_100246166
378 Ga0075431_100426329
379 Ga0075431_100586322
380 Ga0075433_10169854
381 Ga0075433_11431223
382 Ga0075434_101160158
383 Ga0075429_100003533
384 Ga0075429_100007554
385 Ga0075429_100171652
386 Ga0075429_100277170
387 Ga0075429_100358479
388 Ga0075429_100439959
389 Ga0075429_100590986
390 Ga0075429_100595719
391 Ga0097620_100077592
392 Ga0097620_100102788
393 Ga0097620_100105464
394 Ga0097620_101078221
395 Ga0111539_10119363
396 Ga0111539_11186760
397 Ga0105247_10328060
398 Ga0114129_10001121
399 Ga0114129_10054363
400 Ga0114129_10057406
401 Ga0114129_10065384
402 Ga0114129_10088305
403 Ga0114129_10097796
404 Ga0114129_10285047
405 Ga0114129_10341060
406 Ga0114129_11078380
407 Ga0114129_11080532
408 Ga0114129_12050666
409 Ga0105243_10018424
410 Ga0105243_10296937
411 Ga0105243_10303160
412 Ga0105243_10713157
413 Ga0105243_11446882
414 Ga0105241_10164238
415 Ga0105242_10227890
416 Ga0105237_10616942
417 Ga0105249_10037686
418 Ga0105249_10661554
419 Ga0105249_12054612
420 Ga0105246_10012192
421 Ga0105246_10044379
422 Ga0105246_10255304
423 Ga0105246_10283701
424 Ga0157372_11754591
425 Ga0163163_10463802
426 Ga0157379_10352805
427 Ga0207643_10117305
428 Ga0207684_10311529
429 Ga0207684_10903072
430 Ga0207662_10403873
431 Ga0207646_10087215
432 Ga0207646_10219303
433 Ga0207706_10556210
434 Ga0207686_10228788
435 Ga0207670_10166225
436 Ga0207712_10039795
437 Ga0207712_10209362
438 Ga0207712_10438463
439 Ga0207678_10954224
440 Ga0207708_10638870
441 Ga0207676_10076366
442 Ga0207676_11025288
443 Ga0207674_10346357
444 Ga0207675_100177018
445 Ga0268265_10075482
446 Ga0268265_11589415
447 Ga0268264_10117797
448 Ga0316575_10020372
449 Ga0316579_10000054
450 Ga0316576_10021811
451 Ga0316576_10022219
452 Ga0316576_10561026
453 Ga0316578_10000025
454 Ga0316578_10009934
455 Ga0316577_10008278
456 Ga0316577_10060338
457 Ga0307407_10282208
458 Ga0307412_10347980
459 Ga0307409_100880857
460 Ga0307416_100612501
461 Ga0307416_100766097
462 Ga0307416_101973143
463 Ga0307416_102077872
464 Ga0316583_10000129
465 Ga0316585_10000016
466 Ga0316580_10000127
467 Ga0316596_1004193
468 Ga0373928_0201020
469 Ga0373932_0041817
470 Ga0373932_0052824
471 Ga0373961_0037789
472 Ga0373961_0374115
473 Ga0316574_0006618
474 Ga0316574_0022931
475 Ga0316582_0003499
476 Ga0316582_0387190
477 Ga0316582_0476800
478 Ga0316584_0001487
479 Ga0316584_0036049
480 Ga0316581_0011568
481 Ga0242420_012794
482 Ga0242420_097728
483 Ga0451800_0985563
484 Ga0451577_0001442
485 Ga0451577_0010019
486 Ga0451577_0050988
487 Ga0451577_0132319
488 Ga0451577_0248011
489 Ga0451577_0300373
490 Ga0451577_0484711
491 Ga0451577_0719214
492 Ga0451577_0965886
493 Ga0451577_1026736
494 Ga0453683_0000474
495 Ga0453683_0010530
496 Ga0453683_0011964
497 Ga0453683_0060533
498 Ga0453683_0061360
499 Ga0453683_0241062
500 Ga0453683_0529935
501 Ga0453683_0584091
502 Ga0453683_1019156
503 Ga0453684_0000012
504 Ga0453684_0000263
505 Ga0453684_0001019
506 Ga0453684_0001447
507 Ga0453684_0003484
508 Ga0453684_0004019
509 Ga0453684_0004534
510 Ga0453684_0026409
511 Ga0453684_0039021
512 Ga0453684_0096098
513 Ga0453684_0109074
514 Ga0453684_0109259
515 Ga0453684_0138885
516 Ga0453684_0144572
517 Ga0453684_0165110
518 Ga0453684_0169904
519 Ga0453684_0231211
520 Ga0453684_0238220
521 Ga0453684_0312052
522 Ga0453684_0338877
523 Ga0453684_0352817
524 Ga0453684_0408522
525 Ga0453684_0448595
526 Ga0453684_0690985
527 Ga0453684_0714659
528 Ga0453684_0914787
529 Ga0453684_0991183
530 Ga0453684_1016370
531 Ga0453684_1074603
532 Ga0453684_1339542
533 Ga0453684_1439159
534 Ga0453684_1772523
535 Ga0451576_0006756
536 Ga0451576_0007343
537 Ga0451576_0011787
538 Ga0451576_0012302
539 Ga0451576_0036108
540 Ga0451576_0060686
541 Ga0451576_0126961
542 Ga0451576_0180798
543 Ga0451576_0320510
544 Ga0451576_0406406
545 Ga0451576_1318019
546 Ga0451576_1340753
547 Ga0451576_1798491
548 Ga0451576_1937833
549 Ga0451576_2476320
550 Ga0496108_0264879
551 Ga0501294_039993
552 Ga0501038_1352544
553 Ga0501039_0664291
554 Ga0501039_1130630
555 Ga0501040_0075845
556 Ga0501046_0887864
557 Ga0501048_0963765
558 Ga0501072_0417508
559 Ga0501072_0978683
560 Ga0501074_0543859
561 Ga0501075_0524027
562 Ga0501075_1024183
563 Ga0501076_0145647
564 Ga0501227_071027
565 Ga0501079_0391401
566 Ga0501080_0625529
567 Ga0501080_0863205
568 Ga0501081_1229362
569 nmdc:mga05p37_12096_c1
570 nmdc:mga05p37_12995_c1
571 nmdc:mga05p37_1426740_c1
572 nmdc:mga05p37_1465199_c1
573 nmdc:mga05p37_2774_c1
574 nmdc:mga05p37_296526_c1
575 nmdc:mga05p37_412650_c1
576 nmdc:mga05p37_453104_c1
577 nmdc:mga05p37_86517_c1
578 nmdc:mga05p37_917399_c1
579 nmdc:mga09592_1191_c1
580 nmdc:mga09592_130679_c1
581 nmdc:mga09592_2388_c1
582 nmdc:mga09592_327060_c1
583 nmdc:mga09592_90179_c1
584 nmdc:mga0qj67_349439_c1
585 nmdc:mga0qj67_478592_c1
586 nmdc:mga0qj67_77394_c1
587 nmdc:mga06r32_685719_c1
588 nmdc:mga06r32_815123_c1
589 nmdc:mga06r32_969523_c1
590 nmdc:mga0n895_76574_c1
591 nmdc:mga0n895_961814_c1
592 nmdc:mga0a205_237776_c1
593 nmdc:mga0a205_689616_c1
594 Ga0501084_0245954
595 Ga0501084_0297869
596 Ga0501082_0391268
597 Ga0501082_1046933
598 Ga0530510_1070469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6441 8 155
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6347 8 154
3cex-assembly1.cif.gz_A crystal structure of the conserved protein of locus ef_3021 from enterococcus faecalis 0.6198 4 152
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6125 8 154
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.6001 8 155
ID Description Score Start End Superfamily
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6644 4 152 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6595 10 152 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6513 10 152 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.638 4 152 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6345 37 152 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2M8NM91-F1-model_v4 DinB-like domain-containing protein 0.9564 1 156
AF-A0A7X9J7A0-F1-model_v4 DinB family protein 0.9531 1 156
AF-A0A136L779-F1-model_v4 DinB superfamily protein 0.9468 3 157
AF-A0A2M8NM91-F1-model_v4 DinB-like domain-containing protein 0.9446 1 156
AF-A0A7X9J7A0-F1-model_v4 DinB family protein 0.9414 1 156

Map