F401164

General Info

Members Datasets Scaffolds Average Seq Length
311 202 622 215

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10001309|Ga0105240_1000130932
Length 225
Sequence MQPTSNSNGFLKSTQAKVLTGVLIAQALLFYGLSRAEGKAVNTPLNQLSRHLGKWTMSGDEGYVDQETRDVLKADEILTRSYQSSATPIPANLFVAYFRTQRTGQAPHSPKNCLPGNGWSESESGHILVDIPGRATPIEINRYLVAKGENKSIVLYWYQSRDRVVASEYRAKMYTAVDAMRYNRTDTALVRVVVPVPNGDSKAATDAAVDFVKDFFNPLRQHFPA

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0
Rhizoplane 0.64
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 27.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10001309 3300009093 Bacteria 42943
2 Ga0065707_10191329 3300005295 Unclassified 1359
3 Ga0070658_10278344 3300005327 Bacteria 1424
4 Ga0070683_100196989 3300005329 Bacteria 1913
5 Ga0070690_100091392 3300005330 Bacteria 2005
6 Ga0070670_100009996 3300005331 Bacteria 8096
7 Ga0068869_100870366 3300005334 Unclassified 778
8 Ga0070680_100000784 3300005336 Bacteria 22302
9 Ga0070680_100032288 3300005336 Bacteria 4214
10 Ga0070682_100000929 3300005337 Bacteria 17089
11 Ga0070682_100227516 3300005337 Unclassified 1331
12 Ga0070660_100001177 3300005339 Bacteria 17700
13 Ga0070687_100021543 3300005343 Bacteria 3032
14 Ga0070692_10017584 3300005345 Bacteria 3422
15 Ga0070673_100109322 3300005364 Bacteria 2290
16 Ga0070659_100004129 3300005366 Bacteria 10352
17 Ga0070667_100079655 3300005367 Bacteria 2800
18 Ga0070667_100174142 3300005367 Bacteria 1901
19 Ga0070703_10008191 3300005406 Bacteria 2939
20 Ga0070709_10013166 3300005434 Unclassified 4644
21 Ga0070714_100005201 3300005435 Bacteria 9901
22 Ga0070714_100046671 3300005435 Unclassified 3676
23 Ga0070713_100006420 3300005436 Bacteria 8149
24 Ga0070713_100128152 3300005436 Bacteria 2235
25 Ga0070710_10165804 3300005437 Unclassified 1373
26 Ga0070701_10154254 3300005438 Bacteria 1325
27 Ga0070711_100084843 3300005439 Bacteria 2267
28 Ga0070705_100000851 3300005440 Bacteria 17148
29 Ga0070694_100002301 3300005444 Bacteria 11298
30 Ga0070694_100239085 3300005444 Bacteria 1369
31 Ga0070694_100320040 3300005444 Bacteria 1194
32 Ga0070694_100499885 3300005444 Bacteria 967
33 Ga0070663_100008520 3300005455 Bacteria 6312
34 Ga0070662_100069638 3300005457 Unclassified 2590
35 Ga0070681_10014068 3300005458 Bacteria 7963
36 Ga0070681_10051816 3300005458 Bacteria 4093
37 Ga0068867_100082338 3300005459 Unclassified 2427
38 Ga0070706_100011434 3300005467 Bacteria 8250
39 Ga0070706_100037292 3300005467 Bacteria 4490
40 Ga0070707_100600315 3300005468 Bacteria 1063
41 Ga0070679_100075925 3300005530 Bacteria 3350
42 Ga0068853_100173339 3300005539 Unclassified 1953
43 Ga0070672_100262339 3300005543 Unclassified 1457
44 Ga0070695_100024463 3300005545 Bacteria 3720
45 Ga0070696_100003616 3300005546 Bacteria 10295
46 Ga0070693_100000046 3300005547 Bacteria 46884
47 Ga0070665_100057175 3300005548 Bacteria 3911
48 Ga0070704_100154513 3300005549 Unclassified 1808
49 Ga0068855_100021519 3300005563 Bacteria 7733
50 Ga0068855_100054551 3300005563 Bacteria 4698
51 Ga0070664_100069417 3300005564 Bacteria 3015
52 Ga0068857_100059063 3300005577 Unclassified 3406
53 Ga0068854_100078604 3300005578 Bacteria 2431
54 Ga0068856_100023343 3300005614 Bacteria 6013
55 Ga0068856_100034621 3300005614 Bacteria 4946
56 Ga0068852_100014777 3300005616 Bacteria 6028
57 Ga0068859_100244093 3300005617 Unclassified 1885
58 Ga0068859_100689706 3300005617 Unclassified 1112
59 Ga0068861_100073839 3300005719 Unclassified 2651
60 Ga0068870_10002853 3300005840 Bacteria 7273
61 Ga0068860_100168473 3300005843 Unclassified 2115
62 Ga0068860_100199226 3300005843 Bacteria 1940
63 Ga0068860_100721431 3300005843 Unclassified 1007
64 Ga0068862_100091421 3300005844 Bacteria 2651
65 Ga0081539_10037190 3300005985 Unclassified 2902
66 Ga0070717_10069749 3300006028 Bacteria 2928
67 Ga0070717_10247986 3300006028 Unclassified 1572
68 Ga0068871_100331447 3300006358 Unclassified 1342
69 Ga0068871_100735171 3300006358 Bacteria 906
70 Ga0075430_100269616 3300006846 Unclassified 1409
71 Ga0075431_100075454 3300006847 Unclassified 3479
72 Ga0075431_100325464 3300006847 Unclassified 1549
73 Ga0075433_10052732 3300006852 Bacteria 3544
74 Ga0075434_100035584 3300006871 Bacteria 4923
75 Ga0075434_100235495 3300006871 Unclassified 1851
76 Ga0075434_101167220 3300006871 Bacteria 782
77 Ga0075429_100336061 3300006880 Unclassified 1322
78 Ga0068865_100296593 3300006881 Unclassified 1292
79 Ga0097620_100244090 3300006931 Unclassified 1885
80 Ga0097620_100689629 3300006931 Unclassified 1112
81 Ga0075435_100270765 3300007076 Bacteria 1448
82 Ga0105240_10000772 3300009093 Bacteria 58085
83 Ga0105240_10021606 3300009093 Bacteria 8559
84 Ga0105240_10032036 3300009093 Bacteria 6808
85 Ga0105240_10695769 3300009093 Unclassified 1110
86 Ga0111539_10014667 3300009094 Bacteria 9778
87 Ga0114129_10012198 3300009147 Bacteria 12228
88 Ga0105241_10001382 3300009174 Bacteria 18533
89 Ga0105248_10972677 3300009177 Unclassified 959
90 Ga0105248_10991704 3300009177 Unclassified 949
91 Ga0105237_10001398 3300009545 Bacteria 31871
92 Ga0105237_10117252 3300009545 Unclassified 2656
93 Ga0105249_10025359 3300009553 Bacteria 5336
94 Ga0105239_10205628 3300010375 Bacteria 2206
95 Ga0105239_10429462 3300010375 Unclassified 1497
96 Ga0105246_10148027 3300011119 Bacteria 1774
97 Ga0157373_10065973 3300013100 Unclassified 2561
98 Ga0157370_10001006 3300013104 Bacteria 35575
99 Ga0157370_10200559 3300013104 Bacteria 1851
100 Ga0157369_10002585 3300013105 Bacteria 21657
101 Ga0157374_10297933 3300013296 Bacteria 1595
102 Ga0157374_10371355 3300013296 Bacteria 1424
103 Ga0157374_10621512 3300013296 Unclassified 1091
104 Ga0157374_10728898 3300013296 Bacteria 1005
105 Ga0157378_10089135 3300013297 Bacteria 2801
106 Ga0157378_10501222 3300013297 Unclassified 1213
107 Ga0157372_10005394 3300013307 Bacteria 13597
108 Ga0157372_10186066 3300013307 Unclassified 2405
109 Ga0157375_11567992 3300013308 Unclassified 778
110 Ga0157376_10045519 3300014969 Bacteria 3613
111 Ga0206356_11903148 3300020070 Bacteria 1407
112 Ga0213876_10184997 3300021384 Bacteria 1108
113 Ga0213875_10024611 3300021388 Bacteria 2870
114 Ga0207653_10002013 3300025885 Bacteria 6488
115 Ga0207692_10171509 3300025898 Unclassified 1257
116 Ga0207688_10048044 3300025901 Unclassified 2384
117 Ga0207699_10022927 3300025906 Bacteria 3391
118 Ga0207643_10005701 3300025908 Bacteria 6662
119 Ga0207684_10031799 3300025910 Bacteria 4490
120 Ga0207654_10001491 3300025911 Bacteria 12367
121 Ga0207707_10009449 3300025912 Bacteria 8456
122 Ga0207707_10031320 3300025912 Unclassified 4654
123 Ga0207695_10003418 3300025913 Bacteria 22408
124 Ga0207695_10097132 3300025913 Unclassified 2947
125 Ga0207695_10440349 3300025913 Bacteria 1187
126 Ga0207671_10027151 3300025914 Unclassified 4281
127 Ga0207671_10477313 3300025914 Bacteria 994
128 Ga0207663_10087993 3300025916 Bacteria 2053
129 Ga0207660_10002023 3300025917 Bacteria 13483
130 Ga0207660_10019811 3300025917 Unclassified 4504
131 Ga0207662_10148927 3300025918 Unclassified 1487
132 Ga0207657_10013275 3300025919 Bacteria 8082
133 Ga0207649_10021533 3300025920 Bacteria 3713
134 Ga0207652_10001449 3300025921 Bacteria 20999
135 Ga0207650_10453827 3300025925 Bacteria 1067
136 Ga0207700_10002000 3300025928 Bacteria 11620
137 Ga0207664_10058071 3300025929 Unclassified 3077
138 Ga0207690_10006155 3300025932 Bacteria 7108
139 Ga0207706_10092533 3300025933 Unclassified 2659
140 Ga0207704_10314123 3300025938 Bacteria 1206
141 Ga0207665_10110666 3300025939 Bacteria 1930
142 Ga0207711_10513095 3300025941 Bacteria 1118
143 Ga0207689_10000263 3300025942 Bacteria 47220
144 Ga0207679_10002904 3300025945 Bacteria 10631
145 Ga0207667_10039351 3300025949 Bacteria 5039
146 Ga0207667_10054536 3300025949 Unclassified 4204
147 Ga0207712_10012972 3300025961 Bacteria 5336
148 Ga0207640_10075920 3300025981 Unclassified 2279
149 Ga0207658_10341434 3300025986 Bacteria 1302
150 Ga0207678_10020727 3300026067 Bacteria 5763
151 Ga0207702_10007282 3300026078 Bacteria 9465
152 Ga0207702_10508599 3300026078 Bacteria 1175
153 Ga0207641_10131105 3300026088 Bacteria 2251
154 Ga0207648_10100143 3300026089 Unclassified 2538
155 Ga0207674_10001443 3300026116 Bacteria 30692
156 Ga0207675_100021429 3300026118 Bacteria 6020
157 Ga0207698_10023275 3300026142 Bacteria 4324
158 Ga0209974_10037131 3300027876 Bacteria 1617
159 Ga0207428_10006607 3300027907 Bacteria 10671
160 Ga0268266_10047948 3300028379 Bacteria 3661
161 Ga0268266_10286508 3300028379 Unclassified 1533
162 Ga0268264_10016125 3300028381 Bacteria 6122
163 Ga0265325_10004547 3300031241 Bacteria 8739
164 Ga0265316_10005487 3300031344 Bacteria 12309
165 Ga0265316_10034578 3300031344 Bacteria 4104
166 Ga0265342_10184260 3300031712 Unclassified 1142
167 Ga0373926_0032508 3300035083 Unclassified 1841
168 Ga0373934_0016080 3300035086 Bacteria 2842
169 Ga0373923_0141683 3300035111 Unclassified 1087
170 Ga0373953_0126146 3300035117 Unclassified 1089
171 Ga0373954_0031922 3300035118 Unclassified 2433
172 Ga0373956_0204827 3300035119 Unclassified 935
173 Ga0373946_0164513 3300035171 Unclassified 1044
174 Ga0373955_0126548 3300035172 Unclassified 1489
175 Ga0373931_0279611 3300035691 Bacteria 1024
176 Ga0373935_0011594 3300035692 Bacteria 5293
177 Ga0373935_0030771 3300035692 Unclassified 3327
178 Ga0373927_0015590 3300035695 Bacteria 5020
179 Ga0373927_0124097 3300035695 Bacteria 1686
180 Ga0373947_0024618 3300035725 Unclassified 3508
181 Ga0373947_0093497 3300035725 Bacteria 1879
182 Ga0373937_0048899 3300036401 Unclassified 3872
183 Ga0373937_0171046 3300036401 Bacteria 2039
184 Ga0373925_0014651 3300037068 Bacteria 5665
185 Ga0436364_0771651 3300037853 Bacteria 3572
186 Ga0436364_1386002 3300037853 Bacteria 892
187 Ga0436365_0223586 3300039437 Bacteria 4014
188 Ga0436365_0940719 3300039437 Bacteria 3646
189 Ga0439448_0006214 3300042005 Bacteria 3428
190 Ga0439455_0033514 3300042012 Bacteria 1288
191 Ga0439459_0003751 3300042438 Bacteria 2425
192 Ga0451577_0010605 3300042876 Bacteria 8787
193 Ga0451577_0099687 3300042876 Unclassified 2595
194 Ga0453683_0060582 3300044673 Bacteria 2367
195 Ga0453683_0216347 3300044673 Bacteria 1218
196 Ga0453684_0143241 3300044712 Bacteria 2850
197 Ga0453684_0152340 3300044712 Bacteria 2746
198 Ga0451576_0001564 3300045051 Bacteria 38535
199 Ga0451576_0121217 3300045051 Unclassified 2723
200 Ga0451576_1204209 3300045051 Unclassified 791
201 Ga0495638_0008198 3300046460 Bacteria 7428
202 Ga0495651_0281221 3300046462 Bacteria 1124
203 Ga0495653_0112792 3300046463 Bacteria 1951
204 Ga0495580_0006536 3300046472 Bacteria 9484
205 Ga0495580_0023145 3300046472 Unclassified 4565
206 Ga0495664_0113845 3300046477 Bacteria 1634
207 Ga0495594_0267190 3300046499 Bacteria 974
208 Ga0495608_0465394 3300046511 Unclassified 768
209 Ga0495665_0192208 3300046531 Bacteria 1059
210 Ga0495665_0264155 3300046531 Bacteria 885
211 Ga0495611_0228989 3300046648 Unclassified 864
212 Ga0495604_0352773 3300047317 Bacteria 977
213 Ga0495636_0026901 3300047318 Unclassified 2342
214 Ga0496102_0284597 3300048905 Bacteria 1558
215 Ga0496107_0258817 3300048910 Bacteria 1295
216 Ga0501031_0001195 3300049568 Bacteria 15832
217 Ga0501031_0021194 3300049568 Bacteria 4238
218 Ga0501031_0031220 3300049568 Bacteria 3475
219 Ga0501032_0000272 3300049569 Bacteria 43505
220 Ga0501032_0000627 3300049569 Bacteria 28602
221 Ga0501032_0003738 3300049569 Bacteria 11542
222 Ga0501032_0014625 3300049569 Bacteria 5559
223 Ga0501033_0007351 3300049570 Bacteria 8578
224 Ga0501033_0226310 3300049570 Bacteria 1330
225 Ga0501034_0039290 3300049571 Bacteria 4793
226 Ga0501034_0060342 3300049571 Bacteria 3809
227 Ga0501034_0183365 3300049571 Unclassified 2057
228 Ga0501034_0212302 3300049571 Bacteria 1890
229 Ga0501036_0000619 3300049572 Bacteria 25855
230 Ga0501036_0001196 3300049572 Bacteria 19786
231 Ga0501036_0016448 3300049572 Bacteria 6177
232 Ga0501036_0052230 3300049572 Bacteria 3461
233 Ga0501037_0151616 3300049573 Bacteria 1656
234 Ga0501037_0165114 3300049573 Bacteria 1577
235 Ga0501038_0001075 3300049574 Bacteria 24676
236 Ga0501038_0001107 3300049574 Bacteria 24411
237 Ga0501038_0036787 3300049574 Bacteria 4295
238 Ga0501038_0060691 3300049574 Bacteria 3236
239 Ga0501038_0077096 3300049574 Bacteria 2815
240 Ga0501039_0000316 3300049575 Bacteria 34073
241 Ga0501039_0006742 3300049575 Bacteria 8739
242 Ga0501043_0000476 3300049579 Bacteria 35781
243 Ga0501043_0001132 3300049579 Bacteria 23416
244 Ga0501043_0064359 3300049579 Bacteria 2879
245 Ga0501046_0000820 3300049580 Bacteria 30334
246 Ga0501046_0020963 3300049580 Bacteria 5396
247 Ga0501047_0000086 3300049581 Bacteria 118021
248 Ga0501047_0096998 3300049581 Unclassified 2826
249 Ga0501047_0250534 3300049581 Bacteria 1619
250 Ga0501047_0486379 3300049581 Unclassified 1062
251 Ga0501048_0022537 3300049582 Bacteria 4605
252 Ga0501048_0027297 3300049582 Bacteria 4151
253 Ga0501048_0050127 3300049582 Bacteria 2973
254 Ga0501048_0434463 3300049582 Bacteria 939
255 Ga0501067_0004899 3300049583 Bacteria 7436
256 Ga0501067_0062730 3300049583 Bacteria 2057
257 Ga0501067_0349345 3300049583 Bacteria 824
258 Ga0501068_0015730 3300049584 Bacteria 4350
259 Ga0501068_0022035 3300049584 Bacteria 3723
260 Ga0501068_0029337 3300049584 Bacteria 3256
261 Ga0501069_0000873 3300049585 Bacteria 14348
262 Ga0501070_0039702 3300049586 Bacteria 3924
263 Ga0501070_0044620 3300049586 Bacteria 3687
264 Ga0501070_0060830 3300049586 Bacteria 3130
265 Ga0501072_0008294 3300049588 Bacteria 7891
266 Ga0501072_0148361 3300049588 Unclassified 1870
267 Ga0501073_0005072 3300049589 Bacteria 9877
268 Ga0501073_0011667 3300049589 Bacteria 6418
269 Ga0501073_0043152 3300049589 Bacteria 3180
270 Ga0501074_0077006 3300049590 Unclassified 2394
271 Ga0501074_0122290 3300049590 Bacteria 1861
272 Ga0501076_0008666 3300049592 Bacteria 7467
273 Ga0501076_0321046 3300049592 Bacteria 1270
274 Ga0501077_0006334 3300049593 Bacteria 7252
275 Ga0501249_010258 3300049679 Bacteria 1957
276 Ga0501225_0035395 3300049705 Unclassified 1375
277 Ga0501079_0297034 3300049741 Unclassified 1263
278 Ga0501080_0024036 3300049742 Bacteria 5649
279 Ga0501080_0095114 3300049742 Bacteria 2766
280 Ga0501080_0130630 3300049742 Unclassified 2325
281 Ga0501081_0252897 3300049743 Bacteria 1287
282 Ga0501083_0017368 3300049744 Bacteria 5016
283 Ga0501083_0035746 3300049744 Bacteria 3393
284 Ga0501083_0132740 3300049744 Bacteria 1632
285 Ga0501268_005371 3300049765 Unclassified 1842
286 Ga0501035_0020551 3300049822 Bacteria 6064
287 Ga0501035_0054648 3300049822 Bacteria 3567
288 Ga0501035_0157380 3300049822 Unclassified 1968
289 Ga0501044_0001953 3300049823 Bacteria 23844
290 Ga0501044_0087469 3300049823 Unclassified 3147
291 Ga0501045_0080058 3300049824 Bacteria 2409
292 nmdc:mga00v17_244260_c1 3300050491 Unclassified 1164
293 nmdc:mga0k408_172723_c1 3300050493 Bacteria 1288
294 nmdc:mga09592_639090_c1 3300050508 Unclassified 909
295 nmdc:mga0qj67_461662_c1 3300050509 Unclassified 1022
296 nmdc:mga06r32_524909_c1 3300050510 Bacteria 1159
297 nmdc:mga08y16_2283_c1 3300050511 Bacteria 19654
298 nmdc:mga0n895_48818_c1 3300050512 Unclassified 4145
299 nmdc:mga0n895_995568_c1 3300050512 Bacteria 820
300 nmdc:mga0a205_100975_c1 3300050515 Bacteria 2784
301 nmdc:mga0a205_979189_c1 3300050515 Unclassified 693
302 Ga0500568_0000979 3300053139 Bacteria 19669
303 Ga0500611_007083 3300053727 Bacteria 1667
304 Ga0501084_0007238 3300054114 Bacteria 9148
305 Ga0501084_0010057 3300054114 Bacteria 7818
306 Ga0501084_1224666 3300054114 Bacteria 630
307 Ga0501082_0001124 3300060353 Bacteria 23646
308 Ga0501082_0037672 3300060353 Bacteria 4170
309 Ga0501082_0271310 3300060353 Bacteria 1476
310 Ga0501082_0371389 3300060353 Bacteria 1248
311 Ga0501082_0967283 3300060353 Archaea 744
312 Ga0105240_10001309
313 Ga0065707_10191329
314 Ga0070658_10278344
315 Ga0070683_100196989
316 Ga0070690_100091392
317 Ga0070670_100009996
318 Ga0068869_100870366
319 Ga0070680_100000784
320 Ga0070680_100032288
321 Ga0070682_100000929
322 Ga0070682_100227516
323 Ga0070660_100001177
324 Ga0070687_100021543
325 Ga0070692_10017584
326 Ga0070673_100109322
327 Ga0070659_100004129
328 Ga0070667_100079655
329 Ga0070667_100174142
330 Ga0070703_10008191
331 Ga0070709_10013166
332 Ga0070714_100005201
333 Ga0070714_100046671
334 Ga0070713_100006420
335 Ga0070713_100128152
336 Ga0070710_10165804
337 Ga0070701_10154254
338 Ga0070711_100084843
339 Ga0070705_100000851
340 Ga0070694_100002301
341 Ga0070694_100239085
342 Ga0070694_100320040
343 Ga0070694_100499885
344 Ga0070663_100008520
345 Ga0070662_100069638
346 Ga0070681_10014068
347 Ga0070681_10051816
348 Ga0068867_100082338
349 Ga0070706_100011434
350 Ga0070706_100037292
351 Ga0070707_100600315
352 Ga0070679_100075925
353 Ga0068853_100173339
354 Ga0070672_100262339
355 Ga0070695_100024463
356 Ga0070696_100003616
357 Ga0070693_100000046
358 Ga0070665_100057175
359 Ga0070704_100154513
360 Ga0068855_100021519
361 Ga0068855_100054551
362 Ga0070664_100069417
363 Ga0068857_100059063
364 Ga0068854_100078604
365 Ga0068856_100023343
366 Ga0068856_100034621
367 Ga0068852_100014777
368 Ga0068859_100244093
369 Ga0068859_100689706
370 Ga0068861_100073839
371 Ga0068870_10002853
372 Ga0068860_100168473
373 Ga0068860_100199226
374 Ga0068860_100721431
375 Ga0068862_100091421
376 Ga0081539_10037190
377 Ga0070717_10069749
378 Ga0070717_10247986
379 Ga0068871_100331447
380 Ga0068871_100735171
381 Ga0075430_100269616
382 Ga0075431_100075454
383 Ga0075431_100325464
384 Ga0075433_10052732
385 Ga0075434_100035584
386 Ga0075434_100235495
387 Ga0075434_101167220
388 Ga0075429_100336061
389 Ga0068865_100296593
390 Ga0097620_100244090
391 Ga0097620_100689629
392 Ga0075435_100270765
393 Ga0105240_10000772
394 Ga0105240_10021606
395 Ga0105240_10032036
396 Ga0105240_10695769
397 Ga0111539_10014667
398 Ga0114129_10012198
399 Ga0105241_10001382
400 Ga0105248_10972677
401 Ga0105248_10991704
402 Ga0105237_10001398
403 Ga0105237_10117252
404 Ga0105249_10025359
405 Ga0105239_10205628
406 Ga0105239_10429462
407 Ga0105246_10148027
408 Ga0157373_10065973
409 Ga0157370_10001006
410 Ga0157370_10200559
411 Ga0157369_10002585
412 Ga0157374_10297933
413 Ga0157374_10371355
414 Ga0157374_10621512
415 Ga0157374_10728898
416 Ga0157378_10089135
417 Ga0157378_10501222
418 Ga0157372_10005394
419 Ga0157372_10186066
420 Ga0157375_11567992
421 Ga0157376_10045519
422 Ga0206356_11903148
423 Ga0213876_10184997
424 Ga0213875_10024611
425 Ga0207653_10002013
426 Ga0207692_10171509
427 Ga0207688_10048044
428 Ga0207699_10022927
429 Ga0207643_10005701
430 Ga0207684_10031799
431 Ga0207654_10001491
432 Ga0207707_10009449
433 Ga0207707_10031320
434 Ga0207695_10003418
435 Ga0207695_10097132
436 Ga0207695_10440349
437 Ga0207671_10027151
438 Ga0207671_10477313
439 Ga0207663_10087993
440 Ga0207660_10002023
441 Ga0207660_10019811
442 Ga0207662_10148927
443 Ga0207657_10013275
444 Ga0207649_10021533
445 Ga0207652_10001449
446 Ga0207650_10453827
447 Ga0207700_10002000
448 Ga0207664_10058071
449 Ga0207690_10006155
450 Ga0207706_10092533
451 Ga0207704_10314123
452 Ga0207665_10110666
453 Ga0207711_10513095
454 Ga0207689_10000263
455 Ga0207679_10002904
456 Ga0207667_10039351
457 Ga0207667_10054536
458 Ga0207712_10012972
459 Ga0207640_10075920
460 Ga0207658_10341434
461 Ga0207678_10020727
462 Ga0207702_10007282
463 Ga0207702_10508599
464 Ga0207641_10131105
465 Ga0207648_10100143
466 Ga0207674_10001443
467 Ga0207675_100021429
468 Ga0207698_10023275
469 Ga0209974_10037131
470 Ga0207428_10006607
471 Ga0268266_10047948
472 Ga0268266_10286508
473 Ga0268264_10016125
474 Ga0265325_10004547
475 Ga0265316_10005487
476 Ga0265316_10034578
477 Ga0265342_10184260
478 Ga0373926_0032508
479 Ga0373934_0016080
480 Ga0373923_0141683
481 Ga0373953_0126146
482 Ga0373954_0031922
483 Ga0373956_0204827
484 Ga0373946_0164513
485 Ga0373955_0126548
486 Ga0373931_0279611
487 Ga0373935_0011594
488 Ga0373935_0030771
489 Ga0373927_0015590
490 Ga0373927_0124097
491 Ga0373947_0024618
492 Ga0373947_0093497
493 Ga0373937_0048899
494 Ga0373937_0171046
495 Ga0373925_0014651
496 Ga0436364_0771651
497 Ga0436364_1386002
498 Ga0436365_0223586
499 Ga0436365_0940719
500 Ga0439448_0006214
501 Ga0439455_0033514
502 Ga0439459_0003751
503 Ga0451577_0010605
504 Ga0451577_0099687
505 Ga0453683_0060582
506 Ga0453683_0216347
507 Ga0453684_0143241
508 Ga0453684_0152340
509 Ga0451576_0001564
510 Ga0451576_0121217
511 Ga0451576_1204209
512 Ga0495638_0008198
513 Ga0495651_0281221
514 Ga0495653_0112792
515 Ga0495580_0006536
516 Ga0495580_0023145
517 Ga0495664_0113845
518 Ga0495594_0267190
519 Ga0495608_0465394
520 Ga0495665_0192208
521 Ga0495665_0264155
522 Ga0495611_0228989
523 Ga0495604_0352773
524 Ga0495636_0026901
525 Ga0496102_0284597
526 Ga0496107_0258817
527 Ga0501031_0001195
528 Ga0501031_0021194
529 Ga0501031_0031220
530 Ga0501032_0000272
531 Ga0501032_0000627
532 Ga0501032_0003738
533 Ga0501032_0014625
534 Ga0501033_0007351
535 Ga0501033_0226310
536 Ga0501034_0039290
537 Ga0501034_0060342
538 Ga0501034_0183365
539 Ga0501034_0212302
540 Ga0501036_0000619
541 Ga0501036_0001196
542 Ga0501036_0016448
543 Ga0501036_0052230
544 Ga0501037_0151616
545 Ga0501037_0165114
546 Ga0501038_0001075
547 Ga0501038_0001107
548 Ga0501038_0036787
549 Ga0501038_0060691
550 Ga0501038_0077096
551 Ga0501039_0000316
552 Ga0501039_0006742
553 Ga0501043_0000476
554 Ga0501043_0001132
555 Ga0501043_0064359
556 Ga0501046_0000820
557 Ga0501046_0020963
558 Ga0501047_0000086
559 Ga0501047_0096998
560 Ga0501047_0250534
561 Ga0501047_0486379
562 Ga0501048_0022537
563 Ga0501048_0027297
564 Ga0501048_0050127
565 Ga0501048_0434463
566 Ga0501067_0004899
567 Ga0501067_0062730
568 Ga0501067_0349345
569 Ga0501068_0015730
570 Ga0501068_0022035
571 Ga0501068_0029337
572 Ga0501069_0000873
573 Ga0501070_0039702
574 Ga0501070_0044620
575 Ga0501070_0060830
576 Ga0501072_0008294
577 Ga0501072_0148361
578 Ga0501073_0005072
579 Ga0501073_0011667
580 Ga0501073_0043152
581 Ga0501074_0077006
582 Ga0501074_0122290
583 Ga0501076_0008666
584 Ga0501076_0321046
585 Ga0501077_0006334
586 Ga0501249_010258
587 Ga0501225_0035395
588 Ga0501079_0297034
589 Ga0501080_0024036
590 Ga0501080_0095114
591 Ga0501080_0130630
592 Ga0501081_0252897
593 Ga0501083_0017368
594 Ga0501083_0035746
595 Ga0501083_0132740
596 Ga0501268_005371
597 Ga0501035_0020551
598 Ga0501035_0054648
599 Ga0501035_0157380
600 Ga0501044_0001953
601 Ga0501044_0087469
602 Ga0501045_0080058
603 nmdc:mga00v17_244260_c1
604 nmdc:mga0k408_172723_c1
605 nmdc:mga09592_639090_c1
606 nmdc:mga0qj67_461662_c1
607 nmdc:mga06r32_524909_c1
608 nmdc:mga08y16_2283_c1
609 nmdc:mga0n895_48818_c1
610 nmdc:mga0n895_995568_c1
611 nmdc:mga0a205_100975_c1
612 nmdc:mga0a205_979189_c1
613 Ga0500568_0000979
614 Ga0500611_007083
615 Ga0501084_0007238
616 Ga0501084_0010057
617 Ga0501084_1224666
618 Ga0501082_0001124
619 Ga0501082_0037672
620 Ga0501082_0271310
621 Ga0501082_0371389
622 Ga0501082_0967283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11984

DUF3485

Protein of unknown function (DUF3485)

18

222

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vh5-assembly1.cif.gz_A cryo-em structure of the hexameric plasma membrane h+-atpase in the autoinhibited state (ph 7.4, c1 symmetry) 0.6353 46 85
4eoi-assembly2.cif.gz_C thr 160 phosphorylated cdk2 k89d, q131e - human cyclin a3 complex with the inhibitor ro3306 0.5413 42 96
6bsd-assembly1.cif.gz_A ddr1 bound to dasatinib 0.5183 38 101
6qpg-assembly2.cif.gz_E influenza a virus polymerase heterotrimer a/nt/60/1968(h3n2) in complex with nanobody nb8205 0.5138 173 203
6xrr-assembly2.cif.gz_B structure of sciw bound to the rhs1 transmembrane domain from salmonella typhimurium 0.506 78 199
ID Description Score Start End Superfamily
af_I1LZQ3_37_168_2.30.29.230 Mainly Beta;Roll;PH-domain like; 0.7273 98 144 2.30.29.230
af_G5EDU1_421_606_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.6818 45 85 3.40.1110.10
af_P05030_388_532_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.6679 45 85 3.40.1110.10
af_P34208_6_340_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.6606 42 85 1.10.510.10
af_Q95XA9_296_928_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6459 95 144 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V6V4D2-F1-model_v4 EpsI family protein 0.954 84 213
AF-A0A1E7HJ13-F1-model_v4 EpsI family protein 0.9515 25 213
AF-A0A7V5F0D2-F1-model_v4 EpsI family protein 0.9505 62 213
AF-A0A2U3JUY8-F1-model_v4 Methanolan biosynthesis EpsI domain-containing protein 0.948 54 212
AF-A0A3C1MZJ2-F1-model_v4 EpsI family protein 0.9465 25 213

Map