F401101

General Info

Members Datasets Scaffolds Average Seq Length
311 194 622 321

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100002099|Ga0070706_1000020994
Length 354
Sequence MIETTANKDSVVRREQGRAAARYEEGETMAATIEASGVVKRFGKTLALDGLDLVAQHGEILAVLGPNGAGKTTFVRSVATLIRPDEGTLRVFGHDVLADPGAVRQTIGLAGQFAAIEPAMTGRENLEMVARLFGQGKKTARASTQKVLEQMGLAEAADRLARTYSGGMRRKLDLGASLVGSPKLLLLDEPTTGLDPRSRLDLWDAIKSLHDEGTDVLLTTQYLEEADHLASHMVVIDHGKAIATGTPAELKQSTGRSVIEVAVRERDDLAQVAKVLAQVHGGEPQIDDATRRVTISVEGGIELLRDALKHLEALDIVLDDVALRQPKLDEVFLALTGQVLEEDEEPKARKGRGA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
91 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
100 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2858868258 Micromonospora sp. MH33 Isolate Unclassified
194 2902582711 Micromonospora sp. AP08 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.32
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.65
Nodule 0
Rhizoplane 8.36
Rhizosphere 78.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100002099 3300005467 Bacteria 20324
2 JGI25407J50210_10007563 3300003373 Bacteria 2724
3 JGI25407J50210_10037881 3300003373 Bacteria 1238
4 Ga0068869_100082558 3300005334 Bacteria 2402
5 Ga0068868_100209364 3300005338 Bacteria 1629
6 Ga0070660_100008779 3300005339 Bacteria 7077
7 Ga0070660_100011477 3300005339 Bacteria 6298
8 Ga0070668_100015297 3300005347 Bacteria 5733
9 Ga0070659_100062758 3300005366 Bacteria 2938
10 Ga0070714_100003406 3300005435 Bacteria 11849
11 Ga0070714_100006732 3300005435 Bacteria 8905
12 Ga0070714_100067121 3300005435 Bacteria 3092
13 Ga0070713_100013100 3300005436 Bacteria 6111
14 Ga0070713_100183214 3300005436 Bacteria 1883
15 Ga0070710_10000262 3300005437 Bacteria 25066
16 Ga0070711_100003542 3300005439 Bacteria 9109
17 Ga0070711_100207263 3300005439 Bacteria 1516
18 Ga0070708_100000928 3300005445 Bacteria 22181
19 Ga0070708_100029110 3300005445 Bacteria 4761
20 Ga0070708_100051436 3300005445 Bacteria 3650
21 Ga0070706_100076702 3300005467 Bacteria 3093
22 Ga0070707_100124303 3300005468 Bacteria 2506
23 Ga0070707_100242373 3300005468 Bacteria 1754
24 Ga0070698_100010653 3300005471 Bacteria 9798
25 Ga0070698_100186217 3300005471 Bacteria 2014
26 Ga0070697_100110359 3300005536 Bacteria 2291
27 Ga0070686_100078987 3300005544 Bacteria 2174
28 Ga0068855_100037727 3300005563 Bacteria 5744
29 Ga0068860_100012215 3300005843 Bacteria 8462
30 Ga0068860_100030836 3300005843 Bacteria 5155
31 Ga0068862_100020337 3300005844 Bacteria 5544
32 Ga0081455_10003787 3300005937 Bacteria 17259
33 Ga0081455_10013150 3300005937 Bacteria 8201
34 Ga0081455_10016117 3300005937 Bacteria 7226
35 Ga0081538_10000367 3300005981 Bacteria 51530
36 Ga0081538_10002567 3300005981 Bacteria 17633
37 Ga0081538_10003409 3300005981 Bacteria 15038
38 Ga0081538_10003455 3300005981 Bacteria 14922
39 Ga0081538_10005516 3300005981 Bacteria 11364
40 Ga0081538_10005800 3300005981 Bacteria 11009
41 Ga0081538_10006260 3300005981 Bacteria 10523
42 Ga0081538_10007565 3300005981 Bacteria 9374
43 Ga0081538_10013557 3300005981 Bacteria 6446
44 Ga0081538_10042487 3300005981 Bacteria 2868
45 Ga0081538_10082831 3300005981 Bacteria 1699
46 Ga0081538_10096475 3300005981 Bacteria 1506
47 Ga0070717_10000809 3300006028 Bacteria 20570
48 Ga0070717_10002252 3300006028 Bacteria 13525
49 Ga0070717_10008290 3300006028 Bacteria 7758
50 Ga0070717_10097328 3300006028 Bacteria 2493
51 Ga0075365_10001951 3300006038 Bacteria 9743
52 Ga0075365_10002616 3300006038 Bacteria 8915
53 Ga0075365_10012509 3300006038 Bacteria 5044
54 Ga0075365_10026934 3300006038 Bacteria 3653
55 Ga0075365_10093916 3300006038 Bacteria 2046
56 Ga0075368_10030140 3300006042 Bacteria 2100
57 Ga0075363_100028398 3300006048 Bacteria 2877
58 Ga0075363_100041939 3300006048 Bacteria 2415
59 Ga0075363_100076094 3300006048 Bacteria 1829
60 Ga0075364_10007005 3300006051 Bacteria 6660
61 Ga0075364_10011059 3300006051 Bacteria 5476
62 Ga0075364_10069497 3300006051 Bacteria 2317
63 Ga0070715_10047305 3300006163 Bacteria 1833
64 Ga0070716_100000106 3300006173 Bacteria 33206
65 Ga0070716_100038579 3300006173 Bacteria 2646
66 Ga0070712_100004875 3300006175 Bacteria 8298
67 Ga0075367_10038653 3300006178 Bacteria 2779
68 Ga0075367_10047239 3300006178 Bacteria 2532
69 Ga0075428_100000863 3300006844 Bacteria 31877
70 Ga0075430_100000206 3300006846 Bacteria 40357
71 Ga0075430_100048729 3300006846 Bacteria 3577
72 Ga0075431_100000089 3300006847 Bacteria 56041
73 Ga0075431_100147681 3300006847 Bacteria 2422
74 Ga0075433_10066949 3300006852 Bacteria 3152
75 Ga0075434_100057585 3300006871 Bacteria 3862
76 Ga0075429_100012258 3300006880 Bacteria 7436
77 Ga0075429_100194938 3300006880 Bacteria 1774
78 Ga0068865_100053903 3300006881 Bacteria 2792
79 Ga0111539_10009626 3300009094 Bacteria 12200
80 Ga0111539_10110055 3300009094 Bacteria 3233
81 Ga0105245_10001182 3300009098 Bacteria 23670
82 Ga0114129_10000904 3300009147 Bacteria 38596
83 Ga0114129_10125489 3300009147 Bacteria 3529
84 Ga0105241_10030062 3300009174 Bacteria 4057
85 Ga0105237_10014217 3300009545 Bacteria 8333
86 Ga0105238_10045782 3300009551 Bacteria 4419
87 Ga0105249_10052399 3300009553 Bacteria 3726
88 Ga0105246_10000223 3300011119 Bacteria 28878
89 Ga0157374_10009284 3300013296 Bacteria 8435
90 Ga0157372_10013063 3300013307 Bacteria 8859
91 Ga0163163_10208335 3300014325 Bacteria 2004
92 Ga0182008_10014845 3300014497 Bacteria 4074
93 Ga0157377_10012550 3300014745 Bacteria 4263
94 Ga0213875_10019838 3300021388 Bacteria 3230
95 Ga0207692_10012411 3300025898 Bacteria 3659
96 Ga0207685_10003120 3300025905 Bacteria 3961
97 Ga0207699_10000228 3300025906 Bacteria 32185
98 Ga0207684_10002784 3300025910 Bacteria 17391
99 Ga0207654_10058027 3300025911 Bacteria 2252
100 Ga0207671_10028104 3300025914 Bacteria 4204
101 Ga0207693_10001196 3300025915 Bacteria 23192
102 Ga0207693_10017829 3300025915 Bacteria 5660
103 Ga0207693_10095006 3300025915 Bacteria 2336
104 Ga0207663_10103276 3300025916 Bacteria 1919
105 Ga0207657_10018645 3300025919 Bacteria 6616
106 Ga0207657_10032376 3300025919 Bacteria 4724
107 Ga0207646_10083031 3300025922 Bacteria 2865
108 Ga0207646_10155775 3300025922 Bacteria 2060
109 Ga0207694_10046816 3300025924 Bacteria 3343
110 Ga0207687_10000248 3300025927 Bacteria 36726
111 Ga0207687_10138220 3300025927 Bacteria 1845
112 Ga0207687_10217804 3300025927 Bacteria 1501
113 Ga0207700_10000309 3300025928 Bacteria 28645
114 Ga0207700_10102858 3300025928 Bacteria 2282
115 Ga0207664_10000203 3300025929 Bacteria 44815
116 Ga0207704_10037733 3300025938 Bacteria 2794
117 Ga0207665_10000170 3300025939 Bacteria 44106
118 Ga0207665_10037644 3300025939 Bacteria 3220
119 Ga0207667_10183734 3300025949 Bacteria 2147
120 Ga0207712_10016284 3300025961 Bacteria 4811
121 Ga0207677_10188333 3300026023 Bacteria 1630
122 Ga0207708_10277912 3300026075 Bacteria 1356
123 Ga0207641_10200877 3300026088 Bacteria 1838
124 Ga0207676_10355531 3300026095 Bacteria 1356
125 Ga0207675_100093790 3300026118 Bacteria 2824
126 Ga0209813_10009458 3300027866 Bacteria 2494
127 Ga0207428_10012511 3300027907 Bacteria 7451
128 Ga0207428_10022148 3300027907 Bacteria 5365
129 Ga0268266_10167707 3300028379 Bacteria 1991
130 Ga0268264_10003361 3300028381 Bacteria 13828
131 Ga0307408_100102384 3300031548 Bacteria 2184
132 Ga0307516_10104172 3300031730 Bacteria 2649
133 Ga0307405_10068354 3300031731 Bacteria 2273
134 Ga0316577_10013856 3300031733 Bacteria 4420
135 Ga0307410_10037996 3300031852 Bacteria 3150
136 Ga0307409_100015282 3300031995 Bacteria 5032
137 Ga0307409_100029713 3300031995 Bacteria 3915
138 Ga0307409_100149148 3300031995 Bacteria 2028
139 Ga0307416_100033314 3300032002 Bacteria 3904
140 Ga0307414_10136084 3300032004 Bacteria 1916
141 Ga0307415_100018280 3300032126 Bacteria 4229
142 Ga0307415_100021843 3300032126 Bacteria 3941
143 Ga0316585_10010543 3300032137 Bacteria 2713
144 Ga0316593_10046052 3300032168 Bacteria 1463
145 Ga0373926_0000582 3300035083 Bacteria 9836
146 Ga0373944_0001119 3300035089 Bacteria 6669
147 Ga0373923_0002809 3300035111 Bacteria 5453
148 Ga0373945_0002373 3300035116 Bacteria 5906
149 Ga0373946_0002640 3300035171 Bacteria 6334
150 Ga0316574_0015168 3300035398 Bacteria 4469
151 Ga0373935_0005200 3300035692 Bacteria 7662
152 Ga0373927_0004080 3300035695 Bacteria 10306
153 Ga0373947_0015907 3300035725 Bacteria 4321
154 Ga0316582_0020655 3300036647 Bacteria 3876
155 Ga0316584_0027204 3300036712 Bacteria 4208
156 Ga0373925_0017301 3300037068 Bacteria 5223
157 Ga0395899_0006474 3300037312 Bacteria 9074
158 Ga0395899_0100710 3300037312 Bacteria 2086
159 Ga0395900_0004528 3300037418 Bacteria 14707
160 Ga0395900_0040526 3300037418 Bacteria 4800
161 Ga0395898_0004690 3300037466 Bacteria 14880
162 Ga0395898_0032916 3300037466 Bacteria 5174
163 Ga0395905_0060443 3300037471 Bacteria 3543
164 Ga0395905_0273042 3300037471 Bacteria 1577
165 Ga0436364_0324998 3300037853 Bacteria 20353
166 Ga0436364_0769438 3300037853 Bacteria 6064
167 Ga0395901_0011610 3300038443 Bacteria 8923
168 Ga0395901_0027749 3300038443 Bacteria 5821
169 Ga0395901_0058288 3300038443 Bacteria 4017
170 Ga0395901_0112070 3300038443 Bacteria 2865
171 Ga0395901_0207953 3300038443 Bacteria 2049
172 Ga0395901_0351133 3300038443 Bacteria 1522
173 Ga0436365_0319663 3300039437 Bacteria 2904
174 Ga0436365_0479500 3300039437 Bacteria 1059
175 Ga0436365_1096982 3300039437 Bacteria 5110
176 Ga0436363_1187097 3300039450 Bacteria 4094
177 Ga0439454_000273 3300042011 Bacteria 3763
178 Ga0439435_0007077 3300042436 Bacteria 2550
179 Ga0439440_0003899 3300042993 Bacteria 2903
180 Ga0466961_0027859 3300044693 Bacteria 3633
181 Ga0466963_0001172 3300044694 Bacteria 13760
182 Ga0466963_0024780 3300044694 Bacteria 3821
183 Ga0466968_0034726 3300044735 Bacteria 2106
184 Ga0466959_0001345 3300045049 Bacteria 14988
185 Ga0466959_0079744 3300045049 Bacteria 2360
186 Ga0466958_0009821 3300045836 Bacteria 5340
187 Ga0466967_0001183 3300045976 Bacteria 14642
188 Ga0466967_0004938 3300045976 Bacteria 9120
189 Ga0466967_0010079 3300045976 Bacteria 7064
190 Ga0466967_0054284 3300045976 Bacteria 3525
191 Ga0495603_0026046 3300046455 Bacteria 3536
192 Ga0495629_0000843 3300046459 Bacteria 24754
193 Ga0495641_0011350 3300046461 Bacteria 5083
194 Ga0495639_0006312 3300046475 Bacteria 5092
195 Ga0495608_0013764 3300046511 Bacteria 5613
196 Ga0495637_0112485 3300046520 Bacteria 1054
197 Ga0495666_0008574 3300046526 Bacteria 5124
198 Ga0495665_0000674 3300046531 Bacteria 17494
199 Ga0495640_0013629 3300046533 Bacteria 6179
200 Ga0495640_0013720 3300046533 Bacteria 6156
201 Ga0495586_0001254 3300046535 Bacteria 14235
202 Ga0495667_0011717 3300046559 Bacteria 5937
203 Ga0495667_0054248 3300046559 Bacteria 2638
204 Ga0495634_0001511 3300046642 Bacteria 20558
205 Ga0495635_0000405 3300046663 Bacteria 27426
206 Ga0495588_0000551 3300046674 Bacteria 17985
207 Ga0495647_0000078 3300046681 Bacteria 23693
208 Ga0495658_0000145 3300046683 Bacteria 39297
209 Ga0495613_0002596 3300046689 Bacteria 13572
210 Ga0495613_0037381 3300046689 Bacteria 3599
211 Ga0495613_0077463 3300046689 Bacteria 2419
212 Ga0495624_0004163 3300046690 Bacteria 10630
213 Ga0495581_0006416 3300047315 Bacteria 6825
214 Ga0495674_0001355 3300047319 Bacteria 23880
215 Ga0495674_0007439 3300047319 Bacteria 10466
216 Ga0495680_0001316 3300047322 Bacteria 27084
217 Ga0495680_0002369 3300047322 Bacteria 19308
218 Ga0495684_0047040 3300047471 Bacteria 3301
219 Ga0495684_0066354 3300047471 Bacteria 2744
220 Ga0495593_0005098 3300047673 Bacteria 7767
221 Ga0496100_0001602 3300048903 Bacteria 11167
222 Ga0496100_0008798 3300048903 Bacteria 5647
223 Ga0496102_0001418 3300048905 Bacteria 21257
224 Ga0496102_0005376 3300048905 Bacteria 10875
225 Ga0496102_0349083 3300048905 Bacteria 1393
226 Ga0496103_0001481 3300048906 Bacteria 15689
227 Ga0496104_0010395 3300048907 Bacteria 8312
228 Ga0496106_0045955 3300048909 Bacteria 3281
229 Ga0496107_0000480 3300048910 Bacteria 21972
230 Ga0496108_0014693 3300048911 Bacteria 6390
231 Ga0496108_0028780 3300048911 Bacteria 4597
232 Ga0496108_0113215 3300048911 Bacteria 2322
233 Ga0496108_0230702 3300048911 Bacteria 1610
234 Ga0496109_0003434 3300048912 Bacteria 13231
235 Ga0496109_0031664 3300048912 Bacteria 4749
236 Ga0496109_0038069 3300048912 Bacteria 4347
237 Ga0496109_0250293 3300048912 Bacteria 1669
238 Ga0496109_0351988 3300048912 Bacteria 1391
239 Ga0496110_0011500 3300048913 Bacteria 7246
240 Ga0496111_0001231 3300048914 Bacteria 14309
241 Ga0496112_0019386 3300048915 Bacteria 6420
242 Ga0496113_0003631 3300048916 Bacteria 9273
243 Ga0496114_0110924 3300048917 Bacteria 2350
244 Ga0496114_0161142 3300048917 Bacteria 1951
245 Ga0496115_0005723 3300048918 Bacteria 9049
246 Ga0496115_0289396 3300048918 Bacteria 1344
247 Ga0501032_0004179 3300049569 Bacteria 10941
248 Ga0501033_0022427 3300049570 Bacteria 4763
249 Ga0501034_0002541 3300049571 Bacteria 21805
250 Ga0501034_0003221 3300049571 Bacteria 18681
251 Ga0501034_0048099 3300049571 Bacteria 4304
252 Ga0501034_0345630 3300049571 Bacteria 1417
253 Ga0501036_0044699 3300049572 Bacteria 3752
254 Ga0501036_0140212 3300049572 Bacteria 2040
255 Ga0501037_0008296 3300049573 Bacteria 7615
256 Ga0501039_0026858 3300049575 Bacteria 4425
257 Ga0501040_0007848 3300049576 Bacteria 6916
258 Ga0501040_0078776 3300049576 Bacteria 2280
259 Ga0501041_0058645 3300049577 Bacteria 2355
260 Ga0501043_0025067 3300049579 Bacteria 4679
261 Ga0501046_0059376 3300049580 Bacteria 2996
262 Ga0501046_0246212 3300049580 Bacteria 1317
263 Ga0501071_0004007 3300049587 Bacteria 9298
264 Ga0501071_0045582 3300049587 Bacteria 3148
265 Ga0501074_0002210 3300049590 Bacteria 13494
266 Ga0501075_0037680 3300049591 Bacteria 3613
267 Ga0501076_0085992 3300049592 Bacteria 2527
268 Ga0501081_0056485 3300049743 Bacteria 2713
269 Ga0501035_0022021 3300049822 Bacteria 5855
270 Ga0501044_0004853 3300049823 Bacteria 15037
271 Ga0501045_0087593 3300049824 Bacteria 2299
272 Ga0501045_0099663 3300049824 Bacteria 2150
273 nmdc:mga03683_11165_c1 3300050489 Bacteria 3242
274 nmdc:mga03n38_11461_c1 3300050490 Bacteria 3305
275 nmdc:mga03n38_72502_c1 3300050490 Bacteria 1597
276 nmdc:mga00v17_2320_c1 3300050491 Bacteria 9743
277 nmdc:mga00v17_3096_c1 3300050491 Bacteria 8554
278 nmdc:mga00v17_4813_c1 3300050491 Bacteria 6477
279 nmdc:mga00v17_62019_c1 3300050491 Bacteria 2299
280 nmdc:mga00v17_92060_c1 3300050491 Bacteria 1905
281 nmdc:mga0yw44_1684_c1 3300050492 Bacteria 8936
282 nmdc:mga0yw44_251358_c1 3300050492 Bacteria 1177
283 nmdc:mga0yw44_2794_c1 3300050492 Bacteria 7561
284 nmdc:mga0yw44_6235_c1 3300050492 Bacteria 5740
285 nmdc:mga0yw44_8538_c1 3300050492 Bacteria 5112
286 nmdc:mga06z11_44326_c1 3300050494 Bacteria 2242
287 nmdc:mga05p37_1336_c1 3300050507 Bacteria 28658
288 nmdc:mga05p37_223140_c1 3300050507 Bacteria 2274
289 nmdc:mga09592_39125_c1 3300050508 Bacteria 3983
290 nmdc:mga09592_63668_c1 3300050508 Bacteria 3122
291 nmdc:mga0qj67_47205_c1 3300050509 Bacteria 3402
292 nmdc:mga0qj67_8325_c1 3300050509 Bacteria 7688
293 nmdc:mga06r32_133244_c1 3300050510 Bacteria 2459
294 nmdc:mga06r32_1659_c1 3300050510 Bacteria 20102
295 nmdc:mga08y16_34595_c1 3300050511 Bacteria 5308
296 nmdc:mga0n895_156720_c1 3300050512 Bacteria 2308
297 nmdc:mga0n895_67431_c1 3300050512 Bacteria 3544
298 nmdc:mga0rr50_26839_c1 3300050513 Bacteria 4026
299 nmdc:mga0rr50_85057_c1 3300050513 Bacteria 2450
300 Ga0495601_0127541 3300053077 Bacteria 1656
301 Ga0495619_0002589 3300053085 Bacteria 11818
302 Ga0495619_0052996 3300053085 Bacteria 2682
303 Ga0495619_0063093 3300053085 Bacteria 2468
304 Ga0500604_0004821 3300053151 Bacteria 3576
305 Ga0501084_0182117 3300054114 Bacteria 1773
306 Ga0501082_0028205 3300060353 Bacteria 4837
307 Ga0466962_0037100 3300061719 Bacteria 2333
308 Ga0530510_0009982 3300061734 Bacteria 6661
309 Ga0530510_0283888 3300061734 Bacteria 1237
310 2858868587 2858868258 Bacteria 7683772
311 2902588343 2902582711 Bacteria 6187705
312 Ga0070706_100002099
313 JGI25407J50210_10007563
314 JGI25407J50210_10037881
315 Ga0068869_100082558
316 Ga0068868_100209364
317 Ga0070660_100008779
318 Ga0070660_100011477
319 Ga0070668_100015297
320 Ga0070659_100062758
321 Ga0070714_100003406
322 Ga0070714_100006732
323 Ga0070714_100067121
324 Ga0070713_100013100
325 Ga0070713_100183214
326 Ga0070710_10000262
327 Ga0070711_100003542
328 Ga0070711_100207263
329 Ga0070708_100000928
330 Ga0070708_100029110
331 Ga0070708_100051436
332 Ga0070706_100076702
333 Ga0070707_100124303
334 Ga0070707_100242373
335 Ga0070698_100010653
336 Ga0070698_100186217
337 Ga0070697_100110359
338 Ga0070686_100078987
339 Ga0068855_100037727
340 Ga0068860_100012215
341 Ga0068860_100030836
342 Ga0068862_100020337
343 Ga0081455_10003787
344 Ga0081455_10013150
345 Ga0081455_10016117
346 Ga0081538_10000367
347 Ga0081538_10002567
348 Ga0081538_10003409
349 Ga0081538_10003455
350 Ga0081538_10005516
351 Ga0081538_10005800
352 Ga0081538_10006260
353 Ga0081538_10007565
354 Ga0081538_10013557
355 Ga0081538_10042487
356 Ga0081538_10082831
357 Ga0081538_10096475
358 Ga0070717_10000809
359 Ga0070717_10002252
360 Ga0070717_10008290
361 Ga0070717_10097328
362 Ga0075365_10001951
363 Ga0075365_10002616
364 Ga0075365_10012509
365 Ga0075365_10026934
366 Ga0075365_10093916
367 Ga0075368_10030140
368 Ga0075363_100028398
369 Ga0075363_100041939
370 Ga0075363_100076094
371 Ga0075364_10007005
372 Ga0075364_10011059
373 Ga0075364_10069497
374 Ga0070715_10047305
375 Ga0070716_100000106
376 Ga0070716_100038579
377 Ga0070712_100004875
378 Ga0075367_10038653
379 Ga0075367_10047239
380 Ga0075428_100000863
381 Ga0075430_100000206
382 Ga0075430_100048729
383 Ga0075431_100000089
384 Ga0075431_100147681
385 Ga0075433_10066949
386 Ga0075434_100057585
387 Ga0075429_100012258
388 Ga0075429_100194938
389 Ga0068865_100053903
390 Ga0111539_10009626
391 Ga0111539_10110055
392 Ga0105245_10001182
393 Ga0114129_10000904
394 Ga0114129_10125489
395 Ga0105241_10030062
396 Ga0105237_10014217
397 Ga0105238_10045782
398 Ga0105249_10052399
399 Ga0105246_10000223
400 Ga0157374_10009284
401 Ga0157372_10013063
402 Ga0163163_10208335
403 Ga0182008_10014845
404 Ga0157377_10012550
405 Ga0213875_10019838
406 Ga0207692_10012411
407 Ga0207685_10003120
408 Ga0207699_10000228
409 Ga0207684_10002784
410 Ga0207654_10058027
411 Ga0207671_10028104
412 Ga0207693_10001196
413 Ga0207693_10017829
414 Ga0207693_10095006
415 Ga0207663_10103276
416 Ga0207657_10018645
417 Ga0207657_10032376
418 Ga0207646_10083031
419 Ga0207646_10155775
420 Ga0207694_10046816
421 Ga0207687_10000248
422 Ga0207687_10138220
423 Ga0207687_10217804
424 Ga0207700_10000309
425 Ga0207700_10102858
426 Ga0207664_10000203
427 Ga0207704_10037733
428 Ga0207665_10000170
429 Ga0207665_10037644
430 Ga0207667_10183734
431 Ga0207712_10016284
432 Ga0207677_10188333
433 Ga0207708_10277912
434 Ga0207641_10200877
435 Ga0207676_10355531
436 Ga0207675_100093790
437 Ga0209813_10009458
438 Ga0207428_10012511
439 Ga0207428_10022148
440 Ga0268266_10167707
441 Ga0268264_10003361
442 Ga0307408_100102384
443 Ga0307516_10104172
444 Ga0307405_10068354
445 Ga0316577_10013856
446 Ga0307410_10037996
447 Ga0307409_100015282
448 Ga0307409_100029713
449 Ga0307409_100149148
450 Ga0307416_100033314
451 Ga0307414_10136084
452 Ga0307415_100018280
453 Ga0307415_100021843
454 Ga0316585_10010543
455 Ga0316593_10046052
456 Ga0373926_0000582
457 Ga0373944_0001119
458 Ga0373923_0002809
459 Ga0373945_0002373
460 Ga0373946_0002640
461 Ga0316574_0015168
462 Ga0373935_0005200
463 Ga0373927_0004080
464 Ga0373947_0015907
465 Ga0316582_0020655
466 Ga0316584_0027204
467 Ga0373925_0017301
468 Ga0395899_0006474
469 Ga0395899_0100710
470 Ga0395900_0004528
471 Ga0395900_0040526
472 Ga0395898_0004690
473 Ga0395898_0032916
474 Ga0395905_0060443
475 Ga0395905_0273042
476 Ga0436364_0324998
477 Ga0436364_0769438
478 Ga0395901_0011610
479 Ga0395901_0027749
480 Ga0395901_0058288
481 Ga0395901_0112070
482 Ga0395901_0207953
483 Ga0395901_0351133
484 Ga0436365_0319663
485 Ga0436365_0479500
486 Ga0436365_1096982
487 Ga0436363_1187097
488 Ga0439454_000273
489 Ga0439435_0007077
490 Ga0439440_0003899
491 Ga0466961_0027859
492 Ga0466963_0001172
493 Ga0466963_0024780
494 Ga0466968_0034726
495 Ga0466959_0001345
496 Ga0466959_0079744
497 Ga0466958_0009821
498 Ga0466967_0001183
499 Ga0466967_0004938
500 Ga0466967_0010079
501 Ga0466967_0054284
502 Ga0495603_0026046
503 Ga0495629_0000843
504 Ga0495641_0011350
505 Ga0495639_0006312
506 Ga0495608_0013764
507 Ga0495637_0112485
508 Ga0495666_0008574
509 Ga0495665_0000674
510 Ga0495640_0013629
511 Ga0495640_0013720
512 Ga0495586_0001254
513 Ga0495667_0011717
514 Ga0495667_0054248
515 Ga0495634_0001511
516 Ga0495635_0000405
517 Ga0495588_0000551
518 Ga0495647_0000078
519 Ga0495658_0000145
520 Ga0495613_0002596
521 Ga0495613_0037381
522 Ga0495613_0077463
523 Ga0495624_0004163
524 Ga0495581_0006416
525 Ga0495674_0001355
526 Ga0495674_0007439
527 Ga0495680_0001316
528 Ga0495680_0002369
529 Ga0495684_0047040
530 Ga0495684_0066354
531 Ga0495593_0005098
532 Ga0496100_0001602
533 Ga0496100_0008798
534 Ga0496102_0001418
535 Ga0496102_0005376
536 Ga0496102_0349083
537 Ga0496103_0001481
538 Ga0496104_0010395
539 Ga0496106_0045955
540 Ga0496107_0000480
541 Ga0496108_0014693
542 Ga0496108_0028780
543 Ga0496108_0113215
544 Ga0496108_0230702
545 Ga0496109_0003434
546 Ga0496109_0031664
547 Ga0496109_0038069
548 Ga0496109_0250293
549 Ga0496109_0351988
550 Ga0496110_0011500
551 Ga0496111_0001231
552 Ga0496112_0019386
553 Ga0496113_0003631
554 Ga0496114_0110924
555 Ga0496114_0161142
556 Ga0496115_0005723
557 Ga0496115_0289396
558 Ga0501032_0004179
559 Ga0501033_0022427
560 Ga0501034_0002541
561 Ga0501034_0003221
562 Ga0501034_0048099
563 Ga0501034_0345630
564 Ga0501036_0044699
565 Ga0501036_0140212
566 Ga0501037_0008296
567 Ga0501039_0026858
568 Ga0501040_0007848
569 Ga0501040_0078776
570 Ga0501041_0058645
571 Ga0501043_0025067
572 Ga0501046_0059376
573 Ga0501046_0246212
574 Ga0501071_0004007
575 Ga0501071_0045582
576 Ga0501074_0002210
577 Ga0501075_0037680
578 Ga0501076_0085992
579 Ga0501081_0056485
580 Ga0501035_0022021
581 Ga0501044_0004853
582 Ga0501045_0087593
583 Ga0501045_0099663
584 nmdc:mga03683_11165_c1
585 nmdc:mga03n38_11461_c1
586 nmdc:mga03n38_72502_c1
587 nmdc:mga00v17_2320_c1
588 nmdc:mga00v17_3096_c1
589 nmdc:mga00v17_4813_c1
590 nmdc:mga00v17_62019_c1
591 nmdc:mga00v17_92060_c1
592 nmdc:mga0yw44_1684_c1
593 nmdc:mga0yw44_251358_c1
594 nmdc:mga0yw44_2794_c1
595 nmdc:mga0yw44_6235_c1
596 nmdc:mga0yw44_8538_c1
597 nmdc:mga06z11_44326_c1
598 nmdc:mga05p37_1336_c1
599 nmdc:mga05p37_223140_c1
600 nmdc:mga09592_39125_c1
601 nmdc:mga09592_63668_c1
602 nmdc:mga0qj67_47205_c1
603 nmdc:mga0qj67_8325_c1
604 nmdc:mga06r32_133244_c1
605 nmdc:mga06r32_1659_c1
606 nmdc:mga08y16_34595_c1
607 nmdc:mga0n895_156720_c1
608 nmdc:mga0n895_67431_c1
609 nmdc:mga0rr50_26839_c1
610 nmdc:mga0rr50_85057_c1
611 Ga0495601_0127541
612 Ga0495619_0002589
613 Ga0495619_0052996
614 Ga0495619_0063093
615 Ga0500604_0004821
616 Ga0501084_0182117
617 Ga0501082_0028205
618 Ga0466962_0037100
619 Ga0530510_0009982
620 Ga0530510_0283888
621 2858868587
622 2902588343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

192

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

134

225

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.963 4 226
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9561 3 218
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9474 3 218
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9355 4 212
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.929 4 225
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9692 2 226 3.40.50.300
1vplA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 4 226 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9558 4 218 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9506 5 225 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9501 2 224 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A429TR11-F1-model_v4 deleted 0.9635 2 166
AF-A0A485JMZ8-F1-model_v4 D-methionine ABC transporter ATP-binding protein (EC 3.6.3.-) 0.9631 99 224 GO:0005524
GO:0005886
GO:0016887
GO:0033232
AF-A0A511X0H7-F1-model_v4 ABC transporter domain-containing protein 0.9618 1 184 GO:0005524
GO:0016887
AF-A0A7V9BM48-F1-model_v4 ABC transporter ATP-binding protein 0.9574 3 140 GO:0005524
GO:0016887
AF-A0A2N6T693-F1-model_v4 ABC transporter 0.957 2 224 GO:0005524
GO:0006865
GO:0016887

Map