F401082

General Info

Members Datasets Scaffolds Average Seq Length
311 218 622 114

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_11539000|Ga0070709_115390001
Length 118
Sequence VPSLTVRDARLRRHRRVRGKVQGTAERPRLVVHRSNRGITAQLVDDLSGKTLASASWLALKNSFKGDKSEQAAEVGKLLATSAKQAGVESCVFDRAGYLYHGRVKALADGAREGGLKF

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
102 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
136 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
137 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
138 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
139 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
143 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 7.72
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 0.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_11539000 3300005434 Bacteria 541
2 Ga0070676_10348207 3300005328 Bacteria 1018
3 Ga0070683_100184472 3300005329 Bacteria 1980
4 Ga0070683_100415891 3300005329 Bacteria 1282
5 Ga0070683_101948788 3300005329 Bacteria 564
6 Ga0070670_100091757 3300005331 Bacteria 2611
7 Ga0070677_10391005 3300005333 Bacteria 731
8 Ga0068869_101607158 3300005334 Bacteria 579
9 Ga0070680_101299446 3300005336 Bacteria 629
10 Ga0070660_100031640 3300005339 Bacteria 3975
11 Ga0070687_100625448 3300005343 Bacteria 743
12 Ga0070668_102065851 3300005347 Bacteria 526
13 Ga0070668_102148362 3300005347 Bacteria 516
14 Ga0070671_100527714 3300005355 Bacteria 1017
15 Ga0070671_100837403 3300005355 Bacteria 802
16 Ga0070671_100928750 3300005355 Bacteria 761
17 Ga0070674_100081984 3300005356 Bacteria 2306
18 Ga0070674_100106394 3300005356 Bacteria 2053
19 Ga0070673_100508902 3300005364 Bacteria 1090
20 Ga0070659_100078995 3300005366 Bacteria 2626
21 Ga0070714_100101757 3300005435 Bacteria 2532
22 Ga0070708_100597060 3300005445 Bacteria 1041
23 Ga0070708_101966099 3300005445 Bacteria 542
24 Ga0070678_100467280 3300005456 Bacteria 1108
25 Ga0070681_10187317 3300005458 Bacteria 1989
26 Ga0070681_10818473 3300005458 Bacteria 848
27 Ga0068867_101529629 3300005459 Bacteria 622
28 Ga0070706_100340682 3300005467 Bacteria 1398
29 Ga0070707_100259252 3300005468 Bacteria 1691
30 Ga0070698_100072613 3300005471 Bacteria 3449
31 Ga0070698_102028109 3300005471 Bacteria 529
32 Ga0070679_100462915 3300005530 Bacteria 1213
33 Ga0070679_100464954 3300005530 Bacteria 1209
34 Ga0070679_101339692 3300005530 Bacteria 662
35 Ga0070684_100036714 3300005535 Bacteria 4199
36 Ga0070684_100348218 3300005535 Bacteria 1362
37 Ga0070664_100440187 3300005564 Bacteria 1196
38 Ga0068857_100035784 3300005577 Bacteria 4398
39 Ga0068857_100432327 3300005577 Bacteria 1229
40 Ga0068854_102174797 3300005578 Bacteria 513
41 Ga0070702_101416501 3300005615 Bacteria 569
42 Ga0068859_101381194 3300005617 Bacteria 777
43 Ga0068866_10164784 3300005718 Bacteria 1296
44 Ga0068861_101103338 3300005719 Bacteria 763
45 Ga0068851_10858534 3300005834 Bacteria 567
46 Ga0068870_10040559 3300005840 Bacteria 2414
47 Ga0068870_10073954 3300005840 Bacteria 1865
48 Ga0068870_10140268 3300005840 Bacteria 1414
49 Ga0068862_101343958 3300005844 Bacteria 717
50 Ga0081538_10054863 3300005981 Bacteria 2351
51 Ga0075365_10179639 3300006038 Bacteria 1479
52 Ga0075365_10945067 3300006038 Bacteria 608
53 Ga0075363_100247462 3300006048 Bacteria 1026
54 Ga0075364_10044999 3300006051 Bacteria 2872
55 Ga0070712_100009868 3300006175 Bacteria 6018
56 Ga0075367_10167011 3300006178 Bacteria 1370
57 Ga0068871_100412239 3300006358 Bacteria 1205
58 Ga0075428_100478561 3300006844 Bacteria 1333
59 Ga0075428_102286034 3300006844 Unclassified 557
60 Ga0075430_100210890 3300006846 Bacteria 1612
61 Ga0075431_100119473 3300006847 Bacteria 2720
62 Ga0075431_100625606 3300006847 Bacteria 1059
63 Ga0075431_101533847 3300006847 Bacteria 624
64 Ga0075429_100476587 3300006880 Bacteria 1093
65 Ga0075429_100805760 3300006880 Bacteria 822
66 Ga0068865_100076824 3300006881 Bacteria 2385
67 Ga0097620_101381329 3300006931 Bacteria 777
68 Ga0111539_10008690 3300009094 Bacteria 12890
69 Ga0111539_10272487 3300009094 Bacteria 1970
70 Ga0111539_11736980 3300009094 Bacteria 724
71 Ga0111539_11749948 3300009094 Bacteria 721
72 Ga0105245_10064649 3300009098 Bacteria 3307
73 Ga0114129_11344663 3300009147 Bacteria 884
74 Ga0114129_11552063 3300009147 Bacteria 812
75 Ga0114129_12150965 3300009147 Bacteria 672
76 Ga0105243_10106677 3300009148 Bacteria 2335
77 Ga0105243_11112785 3300009148 Bacteria 799
78 Ga0105241_10651595 3300009174 Bacteria 956
79 Ga0105242_10027808 3300009176 Bacteria 4496
80 Ga0105242_10326908 3300009176 Bacteria 1408
81 Ga0105248_13191308 3300009177 Bacteria 522
82 Ga0105238_11236753 3300009551 Bacteria 772
83 Ga0105246_10300769 3300011119 Bacteria 1295
84 Ga0157343_1008639 3300012488 Bacteria 737
85 Ga0157373_10737599 3300013100 Bacteria 723
86 Ga0157369_12454220 3300013105 Bacteria 528
87 Ga0157372_12257291 3300013307 Bacteria 625
88 Ga0157380_11507584 3300014326 Bacteria 726
89 Ga0182008_10347389 3300014497 Bacteria 786
90 Ga0157377_10322505 3300014745 Bacteria 1027
91 Ga0157376_11773889 3300014969 Bacteria 653
92 Ga0207656_10529266 3300025321 Bacteria 599
93 Ga0207642_10535547 3300025899 Bacteria 721
94 Ga0207643_10018007 3300025908 Bacteria 3868
95 Ga0207643_10019179 3300025908 Bacteria 3747
96 Ga0207643_10052899 3300025908 Bacteria 2307
97 Ga0207705_10039676 3300025909 Bacteria 3375
98 Ga0207707_10912716 3300025912 Bacteria 725
99 Ga0207693_10016946 3300025915 Bacteria 5818
100 Ga0207693_11052779 3300025915 Bacteria 619
101 Ga0207660_10302092 3300025917 Bacteria 1274
102 Ga0207662_10961639 3300025918 Bacteria 606
103 Ga0207657_10037964 3300025919 Bacteria 4295
104 Ga0207652_10139918 3300025921 Bacteria 2164
105 Ga0207652_10460375 3300025921 Bacteria 1146
106 Ga0207652_10910397 3300025921 Bacteria 777
107 Ga0207646_10879065 3300025922 Bacteria 796
108 Ga0207681_11324003 3300025923 Bacteria 605
109 Ga0207694_10682167 3300025924 Bacteria 866
110 Ga0207650_10030694 3300025925 Bacteria 3874
111 Ga0207650_10494916 3300025925 Bacteria 1021
112 Ga0207659_10165434 3300025926 Bacteria 1741
113 Ga0207659_10363080 3300025926 Bacteria 1204
114 Ga0207687_10043098 3300025927 Bacteria 3108
115 Ga0207687_11443002 3300025927 Bacteria 591
116 Ga0207664_10025458 3300025929 Bacteria 4459
117 Ga0207644_10679523 3300025931 Bacteria 858
118 Ga0207644_10834534 3300025931 Bacteria 771
119 Ga0207690_10057796 3300025932 Bacteria 2622
120 Ga0207706_11364653 3300025933 Bacteria 583
121 Ga0207686_10599897 3300025934 Bacteria 866
122 Ga0207686_10902259 3300025934 Bacteria 713
123 Ga0207709_10960006 3300025935 Bacteria 697
124 Ga0207670_11768980 3300025936 Bacteria 526
125 Ga0207669_10036280 3300025937 Bacteria 2815
126 Ga0207669_10454033 3300025937 Bacteria 1016
127 Ga0207704_10071929 3300025938 Bacteria 2196
128 Ga0207704_10631816 3300025938 Bacteria 880
129 Ga0207665_11455504 3300025939 Bacteria 545
130 Ga0207661_10190988 3300025944 Bacteria 1795
131 Ga0207661_10574928 3300025944 Bacteria 1033
132 Ga0207661_12045769 3300025944 Bacteria 519
133 Ga0207679_10050795 3300025945 Bacteria 3032
134 Ga0207708_10889835 3300026075 Bacteria 770
135 Ga0207702_11386476 3300026078 Bacteria 697
136 Ga0207648_10705975 3300026089 Bacteria 935
137 Ga0207648_11167938 3300026089 Bacteria 723
138 Ga0207674_10055770 3300026116 Bacteria 4016
139 Ga0207674_10635340 3300026116 Bacteria 1031
140 Ga0207683_10161304 3300026121 Bacteria 2027
141 Ga0209998_10073575 3300027717 Bacteria 819
142 Ga0265337_1116110 3300028556 Bacteria 726
143 Ga0265318_10054833 3300028577 Bacteria 1493
144 Ga0265322_10150181 3300028654 Bacteria 666
145 Ga0265336_10117450 3300028666 Bacteria 792
146 Ga0265338_10005459 3300028800 Bacteria 16591
147 Ga0265338_10047331 3300028800 Bacteria 3928
148 Ga0265330_10100540 3300031235 Bacteria 1238
149 Ga0265332_10062018 3300031238 Bacteria 1598
150 Ga0265325_10056621 3300031241 Bacteria 2001
151 Ga0265340_10191684 3300031247 Bacteria 921
152 Ga0265339_10012975 3300031249 Bacteria 5066
153 Ga0265331_10186058 3300031250 Bacteria 937
154 Ga0265327_10079687 3300031251 Bacteria 1620
155 Ga0265316_10628028 3300031344 Bacteria 760
156 Ga0265314_10013932 3300031711 Bacteria 6467
157 Ga0265314_10045145 3300031711 Bacteria 3117
158 Ga0265342_10008559 3300031712 Bacteria 7316
159 Ga0265342_10551064 3300031712 Bacteria 585
160 Ga0307406_10758511 3300031901 Bacteria 815
161 Ga0307409_100149941 3300031995 Bacteria 2023
162 Ga0307415_100483029 3300032126 Bacteria 1079
163 Ga0316583_10026202 3300032133 Bacteria 2081
164 Ga0373923_0035905 3300035111 Bacteria 2021
165 Ga0373936_0309545 3300035113 Bacteria 714
166 Ga0373954_0155834 3300035118 Bacteria 1117
167 Ga0373956_0296276 3300035119 Bacteria 770
168 Ga0373961_0238540 3300035241 Bacteria 654
169 Ga0373961_0394436 3300035241 Bacteria 530
170 Ga0373924_0302324 3300035410 Bacteria 710
171 Ga0373931_0186408 3300035691 Bacteria 1232
172 Ga0373933_0335817 3300035724 Bacteria 980
173 Ga0373937_0072853 3300036401 Bacteria 3168
174 Ga0395899_0013274 3300037312 Bacteria 6304
175 Ga0395899_0166219 3300037312 Bacteria 1556
176 Ga0395900_0006166 3300037418 Bacteria 12518
177 Ga0395900_0068593 3300037418 Bacteria 3644
178 Ga0395900_0098793 3300037418 Bacteria 2999
179 Ga0395900_0812738 3300037418 Bacteria 862
180 Ga0395900_1401620 3300037418 Bacteria 612
181 Ga0395898_0006119 3300037466 Bacteria 12900
182 Ga0395898_0124933 3300037466 Bacteria 2465
183 Ga0395898_1627933 3300037466 Bacteria 569
184 Ga0395905_0000698 3300037471 Bacteria 44490
185 Ga0395905_0107384 3300037471 Bacteria 2621
186 Ga0395905_0740282 3300037471 Bacteria 885
187 Ga0395901_0000608 3300038443 Bacteria 41717
188 Ga0395901_0035361 3300038443 Bacteria 5160
189 Ga0395901_0950365 3300038443 Bacteria 838
190 Ga0436362_1178442 3300039453 Bacteria 582
191 Ga0439454_028348 3300042011 Bacteria 865
192 Ga0439455_0163430 3300042012 Bacteria 637
193 Ga0439456_150771 3300042013 Bacteria 542
194 Ga0450914_016891 3300042118 Bacteria 778
195 Ga0450920_002132 3300042122 Bacteria 3348
196 Ga0450920_008164 3300042122 Bacteria 1910
197 Ga0450906_033441 3300042145 Bacteria 908
198 Ga0450907_001870 3300042146 Bacteria 4312
199 Ga0450907_007418 3300042146 Bacteria 1830
200 Ga0439458_0063044 3300042157 Bacteria 928
201 Ga0439458_0161841 3300042157 Bacteria 603
202 Ga0450908_038581 3300042184 Bacteria 828
203 Ga0450916_019684 3300042530 Bacteria 918
204 Ga0450918_025454 3300042531 Bacteria 1037
205 Ga0450918_025464 3300042531 Bacteria 1037
206 Ga0450918_092978 3300042531 Bacteria 584
207 Ga0466966_0002996 3300044684 Bacteria 11129
208 Ga0466966_0856557 3300044684 Bacteria 548
209 Ga0466961_0805949 3300044693 Bacteria 560
210 Ga0466963_0555044 3300044694 Bacteria 811
211 Ga0466963_0947975 3300044694 Bacteria 606
212 Ga0466963_0968349 3300044694 Bacteria 599
213 Ga0466964_0536256 3300044706 Bacteria 633
214 Ga0466971_0285740 3300044719 Bacteria 790
215 Ga0466968_0561136 3300044735 Bacteria 574
216 Ga0466957_0173966 3300044842 Bacteria 1403
217 Ga0466957_1203364 3300044842 Bacteria 548
218 Ga0466959_0010188 3300045049 Bacteria 6710
219 Ga0466958_0267208 3300045836 Bacteria 1095
220 Ga0466958_0433300 3300045836 Bacteria 850
221 Ga0466967_0933302 3300045976 Bacteria 863
222 Ga0495592_0245800 3300046454 Bacteria 1185
223 Ga0495651_0053284 3300046462 Bacteria 3115
224 Ga0495653_0044412 3300046463 Bacteria 3448
225 Ga0495584_0510157 3300046491 Bacteria 613
226 Ga0495596_0158043 3300046500 Bacteria 881
227 Ga0495607_0319875 3300046501 Bacteria 724
228 Ga0495608_0009908 3300046511 Bacteria 6652
229 Ga0495618_0145468 3300046514 Bacteria 1515
230 Ga0495628_0193234 3300046516 Bacteria 1536
231 Ga0495631_0425698 3300046518 Bacteria 565
232 Ga0495637_0085197 3300046520 Bacteria 1254
233 Ga0495644_0473106 3300046523 Bacteria 500
234 Ga0495587_0440184 3300046536 Bacteria 722
235 Ga0495609_0260789 3300046538 Bacteria 712
236 Ga0495667_0053184 3300046559 Bacteria 2667
237 Ga0495656_0323177 3300046615 Bacteria 795
238 Ga0495634_0086411 3300046642 Bacteria 2043
239 Ga0495635_0137906 3300046663 Bacteria 1662
240 Ga0495659_0373477 3300046664 Bacteria 612
241 Ga0495661_0429151 3300046665 Bacteria 639
242 Ga0495657_0034973 3300046675 Bacteria 3486
243 Ga0495599_0278440 3300046678 Bacteria 1014
244 Ga0495599_0666041 3300046678 Bacteria 602
245 Ga0495646_0312417 3300046680 Bacteria 829
246 Ga0495589_0169313 3300046794 Bacteria 1039
247 Ga0495589_0460185 3300046794 Bacteria 582
248 Ga0495600_0510851 3300046809 Bacteria 737
249 Ga0495680_0021028 3300047322 Bacteria 5469
250 Ga0495675_0315633 3300047444 Bacteria 925
251 Ga0495684_0090954 3300047471 Bacteria 2311
252 Ga0495684_0222314 3300047471 Bacteria 1384
253 Ga0496100_1507065 3300048903 Bacteria 531
254 Ga0496101_0156701 3300048904 Bacteria 1745
255 Ga0496101_1467206 3300048904 Bacteria 531
256 Ga0496103_0301865 3300048906 Bacteria 1030
257 Ga0496105_1289477 3300048908 Bacteria 534
258 Ga0496106_0252319 3300048909 Bacteria 1411
259 Ga0496106_0505462 3300048909 Bacteria 971
260 Ga0496106_1082040 3300048909 Bacteria 629
261 Ga0496107_0005694 3300048910 Bacteria 8526
262 Ga0496107_1097132 3300048910 Bacteria 575
263 Ga0496109_0089833 3300048912 Bacteria 2841
264 Ga0496109_0166658 3300048912 Bacteria 2066
265 Ga0496109_0472580 3300048912 Bacteria 1184
266 Ga0496110_0203004 3300048913 Bacteria 1801
267 Ga0496111_0125452 3300048914 Bacteria 1897
268 Ga0496112_0023618 3300048915 Bacteria 5878
269 Ga0496112_0093540 3300048915 Bacteria 2976
270 Ga0496112_0325016 3300048915 Bacteria 1482
271 Ga0496112_1028809 3300048915 Bacteria 743
272 Ga0496112_1161988 3300048915 Bacteria 689
273 Ga0496113_0596731 3300048916 Bacteria 884
274 Ga0496114_0249641 3300048917 Bacteria 1561
275 Ga0496114_1327323 3300048917 Bacteria 606
276 Ga0496115_0478717 3300048918 Bacteria 1003
277 Ga0501040_0326816 3300049576 Bacteria 1097
278 Ga0501046_0607546 3300049580 Bacteria 776
279 Ga0501067_0069254 3300049583 Bacteria 1953
280 Ga0501067_0590672 3300049583 Bacteria 622
281 Ga0501068_0017184 3300049584 Bacteria 4180
282 Ga0501068_0055462 3300049584 Bacteria 2401
283 Ga0501068_0636473 3300049584 Bacteria 696
284 Ga0501069_0088552 3300049585 Bacteria 1749
285 Ga0501069_0281121 3300049585 Bacteria 974
286 Ga0501070_0164943 3300049586 Bacteria 1826
287 Ga0501071_0136960 3300049587 Bacteria 1822
288 Ga0501071_0636164 3300049587 Bacteria 821
289 Ga0501075_0138840 3300049591 Bacteria 1852
290 Ga0501080_1128325 3300049742 Bacteria 676
291 Ga0501080_1716278 3300049742 Bacteria 529
292 Ga0501081_1073932 3300049743 Bacteria 609
293 Ga0501035_1523834 3300049822 Bacteria 509
294 Ga0501045_0449086 3300049824 Bacteria 958
295 nmdc:mga03n38_888539_c1 3300050490 Bacteria 523
296 nmdc:mga00v17_29338_c1 3300050491 Bacteria 2255
297 nmdc:mga0yw44_1253453_c1 3300050492 Bacteria 500
298 nmdc:mga06z11_49760_c1 3300050494 Bacteria 2139
299 nmdc:mga05p37_1667281_c1 3300050507 Bacteria 624
300 nmdc:mga05p37_1719955_c1 3300050507 Bacteria 610
301 nmdc:mga05p37_183984_c1 3300050507 Bacteria 2541
302 nmdc:mga09592_1118808_c1 3300050508 Bacteria 654
303 nmdc:mga09592_539013_c1 3300050508 Bacteria 1003
304 nmdc:mga06r32_1820353_c1 3300050510 Bacteria 544
305 nmdc:mga06r32_196750_c1 3300050510 Bacteria 2003
306 nmdc:mga0n895_113561_c1 3300050512 Bacteria 2726
307 Ga0495595_0291983 3300053084 Bacteria 819
308 Ga0495619_0380078 3300053085 Bacteria 976
309 Ga0495619_0607336 3300053085 Bacteria 748
310 Ga0466962_0736146 3300061719 Bacteria 507
311 Ga0530510_1446348 3300061734 Bacteria 528
312 Ga0070709_11539000
313 Ga0070676_10348207
314 Ga0070683_100184472
315 Ga0070683_100415891
316 Ga0070683_101948788
317 Ga0070670_100091757
318 Ga0070677_10391005
319 Ga0068869_101607158
320 Ga0070680_101299446
321 Ga0070660_100031640
322 Ga0070687_100625448
323 Ga0070668_102065851
324 Ga0070668_102148362
325 Ga0070671_100527714
326 Ga0070671_100837403
327 Ga0070671_100928750
328 Ga0070674_100081984
329 Ga0070674_100106394
330 Ga0070673_100508902
331 Ga0070659_100078995
332 Ga0070714_100101757
333 Ga0070708_100597060
334 Ga0070708_101966099
335 Ga0070678_100467280
336 Ga0070681_10187317
337 Ga0070681_10818473
338 Ga0068867_101529629
339 Ga0070706_100340682
340 Ga0070707_100259252
341 Ga0070698_100072613
342 Ga0070698_102028109
343 Ga0070679_100462915
344 Ga0070679_100464954
345 Ga0070679_101339692
346 Ga0070684_100036714
347 Ga0070684_100348218
348 Ga0070664_100440187
349 Ga0068857_100035784
350 Ga0068857_100432327
351 Ga0068854_102174797
352 Ga0070702_101416501
353 Ga0068859_101381194
354 Ga0068866_10164784
355 Ga0068861_101103338
356 Ga0068851_10858534
357 Ga0068870_10040559
358 Ga0068870_10073954
359 Ga0068870_10140268
360 Ga0068862_101343958
361 Ga0081538_10054863
362 Ga0075365_10179639
363 Ga0075365_10945067
364 Ga0075363_100247462
365 Ga0075364_10044999
366 Ga0070712_100009868
367 Ga0075367_10167011
368 Ga0068871_100412239
369 Ga0075428_100478561
370 Ga0075428_102286034
371 Ga0075430_100210890
372 Ga0075431_100119473
373 Ga0075431_100625606
374 Ga0075431_101533847
375 Ga0075429_100476587
376 Ga0075429_100805760
377 Ga0068865_100076824
378 Ga0097620_101381329
379 Ga0111539_10008690
380 Ga0111539_10272487
381 Ga0111539_11736980
382 Ga0111539_11749948
383 Ga0105245_10064649
384 Ga0114129_11344663
385 Ga0114129_11552063
386 Ga0114129_12150965
387 Ga0105243_10106677
388 Ga0105243_11112785
389 Ga0105241_10651595
390 Ga0105242_10027808
391 Ga0105242_10326908
392 Ga0105248_13191308
393 Ga0105238_11236753
394 Ga0105246_10300769
395 Ga0157343_1008639
396 Ga0157373_10737599
397 Ga0157369_12454220
398 Ga0157372_12257291
399 Ga0157380_11507584
400 Ga0182008_10347389
401 Ga0157377_10322505
402 Ga0157376_11773889
403 Ga0207656_10529266
404 Ga0207642_10535547
405 Ga0207643_10018007
406 Ga0207643_10019179
407 Ga0207643_10052899
408 Ga0207705_10039676
409 Ga0207707_10912716
410 Ga0207693_10016946
411 Ga0207693_11052779
412 Ga0207660_10302092
413 Ga0207662_10961639
414 Ga0207657_10037964
415 Ga0207652_10139918
416 Ga0207652_10460375
417 Ga0207652_10910397
418 Ga0207646_10879065
419 Ga0207681_11324003
420 Ga0207694_10682167
421 Ga0207650_10030694
422 Ga0207650_10494916
423 Ga0207659_10165434
424 Ga0207659_10363080
425 Ga0207687_10043098
426 Ga0207687_11443002
427 Ga0207664_10025458
428 Ga0207644_10679523
429 Ga0207644_10834534
430 Ga0207690_10057796
431 Ga0207706_11364653
432 Ga0207686_10599897
433 Ga0207686_10902259
434 Ga0207709_10960006
435 Ga0207670_11768980
436 Ga0207669_10036280
437 Ga0207669_10454033
438 Ga0207704_10071929
439 Ga0207704_10631816
440 Ga0207665_11455504
441 Ga0207661_10190988
442 Ga0207661_10574928
443 Ga0207661_12045769
444 Ga0207679_10050795
445 Ga0207708_10889835
446 Ga0207702_11386476
447 Ga0207648_10705975
448 Ga0207648_11167938
449 Ga0207674_10055770
450 Ga0207674_10635340
451 Ga0207683_10161304
452 Ga0209998_10073575
453 Ga0265337_1116110
454 Ga0265318_10054833
455 Ga0265322_10150181
456 Ga0265336_10117450
457 Ga0265338_10005459
458 Ga0265338_10047331
459 Ga0265330_10100540
460 Ga0265332_10062018
461 Ga0265325_10056621
462 Ga0265340_10191684
463 Ga0265339_10012975
464 Ga0265331_10186058
465 Ga0265327_10079687
466 Ga0265316_10628028
467 Ga0265314_10013932
468 Ga0265314_10045145
469 Ga0265342_10008559
470 Ga0265342_10551064
471 Ga0307406_10758511
472 Ga0307409_100149941
473 Ga0307415_100483029
474 Ga0316583_10026202
475 Ga0373923_0035905
476 Ga0373936_0309545
477 Ga0373954_0155834
478 Ga0373956_0296276
479 Ga0373961_0238540
480 Ga0373961_0394436
481 Ga0373924_0302324
482 Ga0373931_0186408
483 Ga0373933_0335817
484 Ga0373937_0072853
485 Ga0395899_0013274
486 Ga0395899_0166219
487 Ga0395900_0006166
488 Ga0395900_0068593
489 Ga0395900_0098793
490 Ga0395900_0812738
491 Ga0395900_1401620
492 Ga0395898_0006119
493 Ga0395898_0124933
494 Ga0395898_1627933
495 Ga0395905_0000698
496 Ga0395905_0107384
497 Ga0395905_0740282
498 Ga0395901_0000608
499 Ga0395901_0035361
500 Ga0395901_0950365
501 Ga0436362_1178442
502 Ga0439454_028348
503 Ga0439455_0163430
504 Ga0439456_150771
505 Ga0450914_016891
506 Ga0450920_002132
507 Ga0450920_008164
508 Ga0450906_033441
509 Ga0450907_001870
510 Ga0450907_007418
511 Ga0439458_0063044
512 Ga0439458_0161841
513 Ga0450908_038581
514 Ga0450916_019684
515 Ga0450918_025454
516 Ga0450918_025464
517 Ga0450918_092978
518 Ga0466966_0002996
519 Ga0466966_0856557
520 Ga0466961_0805949
521 Ga0466963_0555044
522 Ga0466963_0947975
523 Ga0466963_0968349
524 Ga0466964_0536256
525 Ga0466971_0285740
526 Ga0466968_0561136
527 Ga0466957_0173966
528 Ga0466957_1203364
529 Ga0466959_0010188
530 Ga0466958_0267208
531 Ga0466958_0433300
532 Ga0466967_0933302
533 Ga0495592_0245800
534 Ga0495651_0053284
535 Ga0495653_0044412
536 Ga0495584_0510157
537 Ga0495596_0158043
538 Ga0495607_0319875
539 Ga0495608_0009908
540 Ga0495618_0145468
541 Ga0495628_0193234
542 Ga0495631_0425698
543 Ga0495637_0085197
544 Ga0495644_0473106
545 Ga0495587_0440184
546 Ga0495609_0260789
547 Ga0495667_0053184
548 Ga0495656_0323177
549 Ga0495634_0086411
550 Ga0495635_0137906
551 Ga0495659_0373477
552 Ga0495661_0429151
553 Ga0495657_0034973
554 Ga0495599_0278440
555 Ga0495599_0666041
556 Ga0495646_0312417
557 Ga0495589_0169313
558 Ga0495589_0460185
559 Ga0495600_0510851
560 Ga0495680_0021028
561 Ga0495675_0315633
562 Ga0495684_0090954
563 Ga0495684_0222314
564 Ga0496100_1507065
565 Ga0496101_0156701
566 Ga0496101_1467206
567 Ga0496103_0301865
568 Ga0496105_1289477
569 Ga0496106_0252319
570 Ga0496106_0505462
571 Ga0496106_1082040
572 Ga0496107_0005694
573 Ga0496107_1097132
574 Ga0496109_0089833
575 Ga0496109_0166658
576 Ga0496109_0472580
577 Ga0496110_0203004
578 Ga0496111_0125452
579 Ga0496112_0023618
580 Ga0496112_0093540
581 Ga0496112_0325016
582 Ga0496112_1028809
583 Ga0496112_1161988
584 Ga0496113_0596731
585 Ga0496114_0249641
586 Ga0496114_1327323
587 Ga0496115_0478717
588 Ga0501040_0326816
589 Ga0501046_0607546
590 Ga0501067_0069254
591 Ga0501067_0590672
592 Ga0501068_0017184
593 Ga0501068_0055462
594 Ga0501068_0636473
595 Ga0501069_0088552
596 Ga0501069_0281121
597 Ga0501070_0164943
598 Ga0501071_0136960
599 Ga0501071_0636164
600 Ga0501075_0138840
601 Ga0501080_1128325
602 Ga0501080_1716278
603 Ga0501081_1073932
604 Ga0501035_1523834
605 Ga0501045_0449086
606 nmdc:mga03n38_888539_c1
607 nmdc:mga00v17_29338_c1
608 nmdc:mga0yw44_1253453_c1
609 nmdc:mga06z11_49760_c1
610 nmdc:mga05p37_1667281_c1
611 nmdc:mga05p37_1719955_c1
612 nmdc:mga05p37_183984_c1
613 nmdc:mga09592_1118808_c1
614 nmdc:mga09592_539013_c1
615 nmdc:mga06r32_1820353_c1
616 nmdc:mga06r32_196750_c1
617 nmdc:mga0n895_113561_c1
618 Ga0495595_0291983
619 Ga0495619_0380078
620 Ga0495619_0607336
621 Ga0466962_0736146
622 Ga0530510_1446348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

4

118

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w2e-assembly1.cif.gz_S crystal structure of elongation factor 4 (ef4/lepa) bound to the thermus thermophilus 70s ribosome 0.893 26 116
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8516 27 116
5dm7-assembly1.cif.gz_L crystal structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with hygromycin a 0.8445 27 113
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8432 27 116
4woi-assembly2.cif.gz_CO 4,5-linked aminoglycoside antibiotics regulate the bacterial ribosome by targeting dynamic conformational processes within intersubunit bridge b2 0.8362 26 116
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9093 20 116 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9066 27 116 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8996 20 116 3.30.420.100
4dhcS01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.883 27 116 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8808 20 116 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A0G2B147-F1-model_v4 Large ribosomal subunit protein uL18 0.9273 20 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A0G1DKC5-F1-model_v4 Large ribosomal subunit protein uL18 0.9244 21 116 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A0G1LBK0-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9219 21 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A840DMP2-F1-model_v4 deleted 0.9183 21 116
AF-A0A1F5KL99-F1-model_v4 Large ribosomal subunit protein uL18 0.9179 20 116 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904

Map