F400924

General Info

Members Datasets Scaffolds Average Seq Length
310 207 620 307

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0013974|Ga0501070_0013974_365_1399
Length 344
Sequence MKHCFALANNWFSSRCDEGRFGDREEDMAESANAHVERRIDALLKGAIDPHVHSGPSIAARGVDHVELLQQASQAGFAAVVTKDHDYSGVMTAALIRKHFPELKTKIYSSIVLNNVVGGLNPYAVEHTAALGGKIVWLPTLAAENHLRWQAQAQWTHPASTDRMRPVTPVKVLNDDKSVRDDAKEILDIVAKNDMVLASGHLHVSETWVVFEEAQRRGVKRLVFTHPEDIVDASLNDVKGIAAMGAFVEHSLCMFLDGSKFKSCEEEDLRKQIDAAGPDKTILCSDLGQVGTFSPLEGFRRGIKLCMDLGYDDEDIRKMVSTNAAHALGVDADVAAARSESAMN

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
96 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
105 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
146 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
153 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
154 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
184 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
187 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
188 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
196 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
197 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
198 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
199 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
200 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
201 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
202 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
203 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
204 2909042592 Labrys sp. LIt4 Isolate Nodule
205 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
206 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
207 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0
Isolates 3.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.65
Nodule 0.97
Rhizoplane 3.55
Rhizosphere 53.55
Stem 0
Stem Tuber 0
Unclassified 5.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0013974 3300049586 Bacteria 6760
2 JGI25406J46586_10011401 3300003203 Bacteria 3901
3 JGI25153J46596_10000005 3300003215 Bacteria 492839
4 JGI25153J46596_10010391 3300003215 Bacteria 4212
5 JGI25160J50197_1000298 3300003354 Bacteria 35290
6 JGI25161J50226_1000221 3300003374 Bacteria 35290
7 Ga0055525_1000096 3300003759 Bacteria 137836
8 Ga0055543_1000642 3300004625 Bacteria 18685
9 Ga0065165_1000983 3300005262 Bacteria 35328
10 Ga0070658_10028472 3300005327 Bacteria 4486
11 Ga0070683_100117861 3300005329 Bacteria 2507
12 Ga0070666_10002019 3300005335 Bacteria 12345
13 Ga0070680_100057260 3300005336 Bacteria 3186
14 Ga0070680_100091318 3300005336 Bacteria 2521
15 Ga0070660_100065014 3300005339 Bacteria 2838
16 Ga0070661_100352495 3300005344 Bacteria 1155
17 Ga0070669_100513098 3300005353 Bacteria 996
18 Ga0070714_100042915 3300005435 Bacteria 3822
19 Ga0070663_100027637 3300005455 Bacteria 3854
20 Ga0070663_100034178 3300005455 Unclassified 3519
21 Ga0070679_100244146 3300005530 Bacteria 1753
22 Ga0070684_100095931 3300005535 Bacteria 2643
23 Ga0068853_100097525 3300005539 Bacteria 2595
24 Ga0068853_100308141 3300005539 Unclassified 1465
25 Ga0070665_100001658 3300005548 Bacteria 25642
26 Ga0068855_100019389 3300005563 Bacteria 8171
27 Ga0068855_100034031 3300005563 Bacteria 6078
28 Ga0068857_100072107 3300005577 Bacteria 3078
29 Ga0068857_100276457 3300005577 Bacteria 1544
30 Ga0068856_100008146 3300005614 Bacteria 10223
31 Ga0068856_100086337 3300005614 Bacteria 3118
32 Ga0068852_100029343 3300005616 Bacteria 4518
33 Ga0068861_100084373 3300005719 Unclassified 2494
34 Ga0068863_100001030 3300005841 Bacteria 27842
35 Ga0068860_100000554 3300005843 Bacteria 45461
36 Ga0081455_10001596 3300005937 Bacteria 27703
37 Ga0081455_10133467 3300005937 Bacteria 1938
38 Ga0081538_10015936 3300005981 Bacteria 5793
39 Ga0081538_10024740 3300005981 Bacteria 4266
40 Ga0081540_1000065 3300005983 Bacteria 116905
41 Ga0081539_10003563 3300005985 Bacteria 18911
42 Ga0070717_10167865 3300006028 Unclassified 1907
43 Ga0075365_10003994 3300006038 Bacteria 7732
44 Ga0075365_10013110 3300006038 Bacteria 4944
45 Ga0075365_10019482 3300006038 Bacteria 4189
46 Ga0075365_10019663 3300006038 Bacteria 4173
47 Ga0075365_10032276 3300006038 Bacteria 3364
48 Ga0075368_10003040 3300006042 Bacteria 5552
49 Ga0075368_10004377 3300006042 Bacteria 4781
50 Ga0075363_100004572 3300006048 Bacteria 6068
51 Ga0075363_100006289 3300006048 Bacteria 5378
52 Ga0075363_100040607 3300006048 Bacteria 2453
53 Ga0075363_100198451 3300006048 Bacteria 1146
54 Ga0075364_10016754 3300006051 Bacteria 4564
55 Ga0075364_10057872 3300006051 Bacteria 2539
56 Ga0075364_10067439 3300006051 Bacteria 2352
57 Ga0075364_10149755 3300006051 Bacteria 1572
58 Ga0075362_10008595 3300006177 Bacteria 3914
59 Ga0075362_10053260 3300006177 Bacteria 1816
60 Ga0075367_10004705 3300006178 Bacteria 6706
61 Ga0075367_10004844 3300006178 Bacteria 6634
62 Ga0075367_10031505 3300006178 Bacteria 3045
63 Ga0075367_10034579 3300006178 Bacteria 2920
64 Ga0075367_10067868 3300006178 Bacteria 2138
65 Ga0075367_10182859 3300006178 Bacteria 1307
66 Ga0075369_10004965 3300006186 Bacteria 4952
67 Ga0075369_10015967 3300006186 Bacteria 3023
68 Ga0075369_10038172 3300006186 Bacteria 2048
69 Ga0075369_10071515 3300006186 Bacteria 1527
70 Ga0075366_10005165 3300006195 Bacteria 7065
71 Ga0075366_10111530 3300006195 Bacteria 1645
72 Ga0097621_100078831 3300006237 Bacteria 2737
73 Ga0075370_10027832 3300006353 Bacteria 3139
74 Ga0075370_10216229 3300006353 Bacteria 1132
75 Ga0075428_100199396 3300006844 Bacteria 2164
76 Ga0105240_10026797 3300009093 Bacteria 7559
77 Ga0105240_10071877 3300009093 Unclassified 4278
78 Ga0105240_10536610 3300009093 Bacteria 1296
79 Ga0114129_10136125 3300009147 Bacteria 3370
80 Ga0105243_10000235 3300009148 Bacteria 63396
81 Ga0105242_10563092 3300009176 Bacteria 1095
82 Ga0105237_10004761 3300009545 Bacteria 15602
83 Ga0105237_10208457 3300009545 Unclassified 1955
84 Ga0105238_10021585 3300009551 Bacteria 6558
85 Ga0105238_10179195 3300009551 Unclassified 2096
86 Ga0105239_10002028 3300010375 Bacteria 26278
87 Ga0157372_10054210 3300013307 Bacteria 4472
88 Ga0157372_10185404 3300013307 Bacteria 2409
89 Ga0157376_10082919 3300014969 Bacteria 2757
90 Ga0213876_10098507 3300021384 Bacteria 1549
91 Ga0213876_10114549 3300021384 Bacteria 1431
92 Ga0213875_10004449 3300021388 Bacteria 7687
93 Ga0213875_10004674 3300021388 Bacteria 7460
94 Ga0209436_104171 3300025208 Bacteria 3627
95 Ga0209563_100058 3300025230 Bacteria 302571
96 Ga0209233_1015053 3300025261 Bacteria 2165
97 Ga0209130_1000563 3300025284 Bacteria 36702
98 Ga0209758_1000001 3300025297 Bacteria 1981790
99 Ga0209758_1000669 3300025297 Bacteria 51286
100 Ga0209758_1002509 3300025297 Bacteria 18634
101 Ga0209758_1002991 3300025297 Bacteria 16204
102 Ga0207426_1000272 3300025302 Bacteria 107804
103 Ga0207426_1010674 3300025302 Bacteria 3550
104 Ga0209257_1035042 3300025304 Bacteria 1557
105 Ga0207680_10010587 3300025903 Unclassified 4620
106 Ga0207705_10023660 3300025909 Bacteria 4382
107 Ga0207705_10074362 3300025909 Bacteria 2466
108 Ga0207707_10051857 3300025912 Bacteria 3573
109 Ga0207695_10051768 3300025913 Bacteria 4308
110 Ga0207695_10229157 3300025913 Unclassified 1763
111 Ga0207671_10011037 3300025914 Bacteria 7394
112 Ga0207671_10198574 3300025914 Unclassified 1566
113 Ga0207660_10059926 3300025917 Bacteria 2734
114 Ga0207657_10156882 3300025919 Bacteria 1851
115 Ga0207681_10122425 3300025923 Bacteria 1910
116 Ga0207694_10004846 3300025924 Bacteria 10447
117 Ga0207694_10123363 3300025924 Unclassified 2070
118 Ga0207664_10035364 3300025929 Bacteria 3854
119 Ga0207706_10155086 3300025933 Bacteria 2014
120 Ga0207709_10001102 3300025935 Bacteria 19822
121 Ga0207665_10308851 3300025939 Bacteria 1184
122 Ga0207667_10006547 3300025949 Bacteria 14090
123 Ga0207667_10039538 3300025949 Bacteria 5027
124 Ga0207640_10106379 3300025981 Bacteria 1979
125 Ga0207658_10012527 3300025986 Bacteria 5793
126 Ga0207639_10047731 3300026041 Bacteria 3238
127 Ga0207639_10315307 3300026041 Unclassified 1387
128 Ga0207678_10009094 3300026067 Bacteria 8747
129 Ga0207678_10041065 3300026067 Unclassified 4010
130 Ga0207702_10019165 3300026078 Bacteria 5661
131 Ga0207702_10081369 3300026078 Bacteria 2812
132 Ga0207641_10000209 3300026088 Bacteria 75878
133 Ga0207674_10089132 3300026116 Bacteria 3077
134 Ga0207675_100338056 3300026118 Unclassified 1473
135 Ga0207698_10021996 3300026142 Bacteria 4421
136 Ga0268266_10000530 3300028379 Bacteria 53318
137 Ga0268264_10000044 3300028381 Bacteria 368079
138 Ga0307517_10000035 3300028786 Bacteria 172762
139 Ga0265339_10026188 3300031249 Bacteria 3342
140 Ga0307509_10000019 3300031507 Bacteria 256151
141 Ga0265314_10008261 3300031711 Bacteria 8939
142 Ga0265342_10011220 3300031712 Bacteria 6149
143 Ga0307510_10000011 3300033180 Bacteria 355464
144 Ga0373953_0029807 3300035117 Bacteria 2111
145 Ga0373957_0011420 3300035120 Bacteria 2965
146 Ga0373943_0029762 3300035170 Bacteria 2581
147 Ga0373933_0023211 3300035724 Bacteria 3542
148 Ga0373937_0111021 3300036401 Bacteria 2550
149 Ga0436364_0679392 3300037853 Bacteria 26409
150 Ga0436364_1368280 3300037853 Bacteria 8145
151 Ga0395901_0213799 3300038443 Unclassified 2017
152 Ga0436365_1703518 3300039437 Bacteria 4163
153 Ga0436361_0308292 3300039447 Bacteria 1481
154 Ga0436363_0967060 3300039450 Bacteria 4022
155 Ga0439453_0000231 3300041408 Bacteria 5558
156 Ga0439453_0001741 3300041408 Bacteria 2866
157 Ga0439443_007142 3300042003 Bacteria 1548
158 Ga0439435_0033190 3300042436 Bacteria 1412
159 Ga0466973_0095243 3300044659 Bacteria 2547
160 Ga0466964_0109132 3300044706 Bacteria 1232
161 Ga0466959_0097790 3300045049 Unclassified 2103
162 Ga0495638_0000558 3300046460 Bacteria 42376
163 Ga0495638_0014844 3300046460 Bacteria 5251
164 Ga0495651_0142465 3300046462 Bacteria 1736
165 Ga0495653_0059939 3300046463 Bacteria 2885
166 Ga0495607_0004389 3300046501 Bacteria 10395
167 Ga0495610_0003810 3300046512 Bacteria 11500
168 Ga0495616_0008108 3300046513 Bacteria 6254
169 Ga0495620_0008148 3300046515 Bacteria 5640
170 Ga0495630_0057969 3300046517 Bacteria 2903
171 Ga0495643_0100123 3300046522 Bacteria 1486
172 Ga0495648_0170717 3300046524 Bacteria 1115
173 Ga0495652_0137759 3300046529 Bacteria 1923
174 Ga0495654_0008174 3300046530 Bacteria 5796
175 Ga0495640_0027580 3300046533 Bacteria 4094
176 Ga0495587_0102987 3300046536 Bacteria 1643
177 Ga0495645_0235434 3300046543 Bacteria 1224
178 Ga0495667_0091589 3300046559 Bacteria 1969
179 Ga0495667_0176872 3300046559 Bacteria 1370
180 Ga0495667_0248723 3300046559 Bacteria 1131
181 Ga0495668_0080395 3300046616 Bacteria 1789
182 Ga0495635_0001982 3300046663 Bacteria 13921
183 Ga0495661_0017761 3300046665 Bacteria 4689
184 Ga0495623_0010129 3300046679 Bacteria 6102
185 Ga0495646_0048338 3300046680 Bacteria 2585
186 Ga0495600_0025287 3300046809 Bacteria 3826
187 Ga0495600_0040125 3300046809 Bacteria 3049
188 Ga0495604_0053696 3300047317 Bacteria 3112
189 Ga0495674_0042024 3300047319 Bacteria 4081
190 Ga0495674_0052802 3300047319 Bacteria 3575
191 Ga0495680_0059426 3300047322 Bacteria 2951
192 Ga0495687_000080 3300047443 Bacteria 147467
193 Ga0495675_0047983 3300047444 Bacteria 2716
194 Ga0495684_0109203 3300047471 Bacteria 2089
195 Ga0495686_0056458 3300047472 Bacteria 2453
196 Ga0495686_0068048 3300047472 Bacteria 2197
197 Ga0495602_0052167 3300048088 Bacteria 3635
198 Ga0496104_0000306 3300048907 Bacteria 43669
199 Ga0496104_0052262 3300048907 Bacteria 3859
200 Ga0496104_0276521 3300048907 Bacteria 1592
201 Ga0496105_0062140 3300048908 Bacteria 3082
202 Ga0496105_0142505 3300048908 Bacteria 1972
203 Ga0496105_0344232 3300048908 Bacteria 1192
204 Ga0496108_0047946 3300048911 Bacteria 3572
205 Ga0496110_0306673 3300048913 Bacteria 1446
206 Ga0496114_0055310 3300048917 Bacteria 3310
207 Ga0496115_0144616 3300048918 Bacteria 1962
208 Ga0496116_0003806 3300048919 Bacteria 14746
209 Ga0496117_0002577 3300048920 Bacteria 22566
210 Ga0496118_0007352 3300048921 Bacteria 11712
211 Ga0496118_0137844 3300048921 Bacteria 1553
212 Ga0496119_0103816 3300048922 Bacteria 1591
213 Ga0496120_0042742 3300048923 Bacteria 2645
214 Ga0496121_0000643 3300048924 Bacteria 65217
215 Ga0496121_0004299 3300048924 Bacteria 19303
216 Ga0496122_0002467 3300048925 Bacteria 26154
217 Ga0496123_0002639 3300048926 Bacteria 21715
218 Ga0496125_0000101 3300048928 Bacteria 202248
219 Ga0496125_0000756 3300048928 Bacteria 52960
220 Ga0496125_0001227 3300048928 Bacteria 38397
221 Ga0496125_0020530 3300048928 Bacteria 6198
222 Ga0496126_0028141 3300048929 Bacteria 5359
223 Ga0496126_0060531 3300048929 Bacteria 3404
224 Ga0496126_0062119 3300048929 Bacteria 3353
225 Ga0496126_0408444 3300048929 Bacteria 1100
226 Ga0501033_0566285 3300049570 Bacteria 782
227 Ga0501034_0039679 3300049571 Bacteria 4769
228 Ga0501034_0141849 3300049571 Bacteria 2381
229 Ga0501037_0022913 3300049573 Bacteria 4618
230 Ga0501038_0177284 3300049574 Bacteria 1722
231 Ga0501043_0276403 3300049579 Bacteria 1288
232 Ga0501047_0022149 3300049581 Bacteria 6105
233 Ga0501047_0038869 3300049581 Bacteria 4603
234 Ga0501047_0385678 3300049581 Bacteria 1235
235 Ga0501069_0067433 3300049585 Bacteria 2002
236 Ga0501069_0089299 3300049585 Bacteria 1742
237 Ga0501070_0016217 3300049586 Bacteria 6260
238 Ga0501070_0027888 3300049586 Bacteria 4737
239 Ga0501070_0042371 3300049586 Bacteria 3791
240 Ga0501073_0096917 3300049589 Bacteria 2048
241 Ga0501083_0072295 3300049744 Bacteria 2293
242 Ga0501035_0000505 3300049822 Bacteria 44014
243 Ga0501044_0054756 3300049823 Bacteria 4099
244 Ga0501044_0166293 3300049823 Bacteria 2180
245 Ga0501044_0463229 3300049823 Bacteria 1173
246 nmdc:mga03683_46554_c1 3300050489 Bacteria 1798
247 nmdc:mga03n38_31176_c1 3300050490 Bacteria 2247
248 nmdc:mga03n38_57147_c1 3300050490 Bacteria 1193
249 nmdc:mga03n38_9005_c1 3300050490 Bacteria 3609
250 nmdc:mga00v17_137124_c1 3300050491 Bacteria 1567
251 nmdc:mga00v17_14172_c1 3300050491 Bacteria 4444
252 nmdc:mga00v17_24567_c1 3300050491 Bacteria 3497
253 nmdc:mga00v17_44869_c1 3300050491 Bacteria 2668
254 nmdc:mga0yw44_1173_c1 3300050492 Bacteria 10203
255 nmdc:mga0yw44_5640_c1 3300050492 Bacteria 5952
256 nmdc:mga0yw44_5743_c1 3300050492 Bacteria 5913
257 nmdc:mga0k408_2078_c1 3300050493 Bacteria 10710
258 nmdc:mga0k408_85624_c1 3300050493 Bacteria 1850
259 nmdc:mga06z11_10375_c1 3300050494 Bacteria 3967
260 nmdc:mga06z11_14354_c1 3300050494 Bacteria 3506
261 nmdc:mga06z11_36526_c1 3300050494 Bacteria 2426
262 nmdc:mga04h51_12065_c1 3300050495 Bacteria 2416
263 nmdc:mga04h51_2439_c2 3300050495 Bacteria 2345
264 nmdc:mga07m45_224475_c1 3300050496 Bacteria 1093
265 nmdc:mga07m45_27317_c1 3300050496 Bacteria 3143
266 nmdc:mga08y16_370385_c1 3300050511 Bacteria 1469
267 nmdc:mga0sz30_29949_c1 3300050516 Bacteria 2247
268 nmdc:mga0sz30_87778_c1 3300050516 Bacteria 1351
269 Ga0495601_0005106 3300053077 Bacteria 7625
270 Ga0495601_0037036 3300053077 Bacteria 3049
271 Ga0495601_0216375 3300053077 Bacteria 1251
272 Ga0495595_0006079 3300053084 Bacteria 4906
273 Ga0495595_0086288 3300053084 Bacteria 1501
274 Ga0495619_0007411 3300053085 Bacteria 6953
275 Ga0495619_0291560 3300053085 Bacteria 1130
276 Ga0500643_003069 3300053087 Bacteria 8214
277 Ga0500566_0001508 3300053094 Bacteria 13655
278 Ga0500641_0000109 3300053096 Bacteria 31691
279 Ga0500641_0003059 3300053096 Bacteria 5930
280 Ga0500650_0001237 3300053098 Bacteria 7520
281 Ga0500556_0000003 3300053104 Bacteria 679379
282 Ga0500569_007767 3300053109 Bacteria 2423
283 Ga0500593_006141 3300053117 Bacteria 4793
284 Ga0500595_000118 3300053119 Bacteria 52764
285 Ga0500595_000864 3300053119 Bacteria 17307
286 Ga0500595_003176 3300053119 Bacteria 7779
287 Ga0500595_049268 3300053119 Bacteria 1312
288 Ga0500652_000921 3300053131 Bacteria 9694
289 Ga0500658_0026567 3300053134 Bacteria 2231
290 Ga0500568_0001594 3300053139 Bacteria 14345
291 Ga0500568_0029217 3300053139 Bacteria 2290
292 Ga0500604_0000208 3300053151 Bacteria 16819
293 Ga0500616_0000114 3300053153 Bacteria 148574
294 Ga0500616_0013170 3300053153 Bacteria 4815
295 Ga0500622_0004534 3300053156 Bacteria 8676
296 Ga0500622_0078595 3300053156 Unclassified 1655
297 Ga0500627_0002402 3300053158 Bacteria 5549
298 Ga0500636_0004993 3300053177 Bacteria 7528
299 Ga0500596_015721 3300053735 Bacteria 1136
300 2603857612 2602042107 Bacteria 6226103
301 2643727755 2643221541 Bacteria 5498788
302 2643754843 2643221547 Bacteria 4740017
303 2644043295 2643221606 Bacteria 5588032
304 2644395273 2643221671 Bacteria 5496681
305 2874172994 2874168670 Bacteria 8062617
306 2894237587 2894232714 Bacteria 8834183
307 2909042783 2909042592 Bacteria 6499737
308 2917700127 2917699015 Bacteria 7043791
309 2919076601 2919073203 Bacteria 6531949
310 2919140049 2919138771 Bacteria 5281312
311 Ga0501070_0013974
312 JGI25406J46586_10011401
313 JGI25153J46596_10000005
314 JGI25153J46596_10010391
315 JGI25160J50197_1000298
316 JGI25161J50226_1000221
317 Ga0055525_1000096
318 Ga0055543_1000642
319 Ga0065165_1000983
320 Ga0070658_10028472
321 Ga0070683_100117861
322 Ga0070666_10002019
323 Ga0070680_100057260
324 Ga0070680_100091318
325 Ga0070660_100065014
326 Ga0070661_100352495
327 Ga0070669_100513098
328 Ga0070714_100042915
329 Ga0070663_100027637
330 Ga0070663_100034178
331 Ga0070679_100244146
332 Ga0070684_100095931
333 Ga0068853_100097525
334 Ga0068853_100308141
335 Ga0070665_100001658
336 Ga0068855_100019389
337 Ga0068855_100034031
338 Ga0068857_100072107
339 Ga0068857_100276457
340 Ga0068856_100008146
341 Ga0068856_100086337
342 Ga0068852_100029343
343 Ga0068861_100084373
344 Ga0068863_100001030
345 Ga0068860_100000554
346 Ga0081455_10001596
347 Ga0081455_10133467
348 Ga0081538_10015936
349 Ga0081538_10024740
350 Ga0081540_1000065
351 Ga0081539_10003563
352 Ga0070717_10167865
353 Ga0075365_10003994
354 Ga0075365_10013110
355 Ga0075365_10019482
356 Ga0075365_10019663
357 Ga0075365_10032276
358 Ga0075368_10003040
359 Ga0075368_10004377
360 Ga0075363_100004572
361 Ga0075363_100006289
362 Ga0075363_100040607
363 Ga0075363_100198451
364 Ga0075364_10016754
365 Ga0075364_10057872
366 Ga0075364_10067439
367 Ga0075364_10149755
368 Ga0075362_10008595
369 Ga0075362_10053260
370 Ga0075367_10004705
371 Ga0075367_10004844
372 Ga0075367_10031505
373 Ga0075367_10034579
374 Ga0075367_10067868
375 Ga0075367_10182859
376 Ga0075369_10004965
377 Ga0075369_10015967
378 Ga0075369_10038172
379 Ga0075369_10071515
380 Ga0075366_10005165
381 Ga0075366_10111530
382 Ga0097621_100078831
383 Ga0075370_10027832
384 Ga0075370_10216229
385 Ga0075428_100199396
386 Ga0105240_10026797
387 Ga0105240_10071877
388 Ga0105240_10536610
389 Ga0114129_10136125
390 Ga0105243_10000235
391 Ga0105242_10563092
392 Ga0105237_10004761
393 Ga0105237_10208457
394 Ga0105238_10021585
395 Ga0105238_10179195
396 Ga0105239_10002028
397 Ga0157372_10054210
398 Ga0157372_10185404
399 Ga0157376_10082919
400 Ga0213876_10098507
401 Ga0213876_10114549
402 Ga0213875_10004449
403 Ga0213875_10004674
404 Ga0209436_104171
405 Ga0209563_100058
406 Ga0209233_1015053
407 Ga0209130_1000563
408 Ga0209758_1000001
409 Ga0209758_1000669
410 Ga0209758_1002509
411 Ga0209758_1002991
412 Ga0207426_1000272
413 Ga0207426_1010674
414 Ga0209257_1035042
415 Ga0207680_10010587
416 Ga0207705_10023660
417 Ga0207705_10074362
418 Ga0207707_10051857
419 Ga0207695_10051768
420 Ga0207695_10229157
421 Ga0207671_10011037
422 Ga0207671_10198574
423 Ga0207660_10059926
424 Ga0207657_10156882
425 Ga0207681_10122425
426 Ga0207694_10004846
427 Ga0207694_10123363
428 Ga0207664_10035364
429 Ga0207706_10155086
430 Ga0207709_10001102
431 Ga0207665_10308851
432 Ga0207667_10006547
433 Ga0207667_10039538
434 Ga0207640_10106379
435 Ga0207658_10012527
436 Ga0207639_10047731
437 Ga0207639_10315307
438 Ga0207678_10009094
439 Ga0207678_10041065
440 Ga0207702_10019165
441 Ga0207702_10081369
442 Ga0207641_10000209
443 Ga0207674_10089132
444 Ga0207675_100338056
445 Ga0207698_10021996
446 Ga0268266_10000530
447 Ga0268264_10000044
448 Ga0307517_10000035
449 Ga0265339_10026188
450 Ga0307509_10000019
451 Ga0265314_10008261
452 Ga0265342_10011220
453 Ga0307510_10000011
454 Ga0373953_0029807
455 Ga0373957_0011420
456 Ga0373943_0029762
457 Ga0373933_0023211
458 Ga0373937_0111021
459 Ga0436364_0679392
460 Ga0436364_1368280
461 Ga0395901_0213799
462 Ga0436365_1703518
463 Ga0436361_0308292
464 Ga0436363_0967060
465 Ga0439453_0000231
466 Ga0439453_0001741
467 Ga0439443_007142
468 Ga0439435_0033190
469 Ga0466973_0095243
470 Ga0466964_0109132
471 Ga0466959_0097790
472 Ga0495638_0000558
473 Ga0495638_0014844
474 Ga0495651_0142465
475 Ga0495653_0059939
476 Ga0495607_0004389
477 Ga0495610_0003810
478 Ga0495616_0008108
479 Ga0495620_0008148
480 Ga0495630_0057969
481 Ga0495643_0100123
482 Ga0495648_0170717
483 Ga0495652_0137759
484 Ga0495654_0008174
485 Ga0495640_0027580
486 Ga0495587_0102987
487 Ga0495645_0235434
488 Ga0495667_0091589
489 Ga0495667_0176872
490 Ga0495667_0248723
491 Ga0495668_0080395
492 Ga0495635_0001982
493 Ga0495661_0017761
494 Ga0495623_0010129
495 Ga0495646_0048338
496 Ga0495600_0025287
497 Ga0495600_0040125
498 Ga0495604_0053696
499 Ga0495674_0042024
500 Ga0495674_0052802
501 Ga0495680_0059426
502 Ga0495687_000080
503 Ga0495675_0047983
504 Ga0495684_0109203
505 Ga0495686_0056458
506 Ga0495686_0068048
507 Ga0495602_0052167
508 Ga0496104_0000306
509 Ga0496104_0052262
510 Ga0496104_0276521
511 Ga0496105_0062140
512 Ga0496105_0142505
513 Ga0496105_0344232
514 Ga0496108_0047946
515 Ga0496110_0306673
516 Ga0496114_0055310
517 Ga0496115_0144616
518 Ga0496116_0003806
519 Ga0496117_0002577
520 Ga0496118_0007352
521 Ga0496118_0137844
522 Ga0496119_0103816
523 Ga0496120_0042742
524 Ga0496121_0000643
525 Ga0496121_0004299
526 Ga0496122_0002467
527 Ga0496123_0002639
528 Ga0496125_0000101
529 Ga0496125_0000756
530 Ga0496125_0001227
531 Ga0496125_0020530
532 Ga0496126_0028141
533 Ga0496126_0060531
534 Ga0496126_0062119
535 Ga0496126_0408444
536 Ga0501033_0566285
537 Ga0501034_0039679
538 Ga0501034_0141849
539 Ga0501037_0022913
540 Ga0501038_0177284
541 Ga0501043_0276403
542 Ga0501047_0022149
543 Ga0501047_0038869
544 Ga0501047_0385678
545 Ga0501069_0067433
546 Ga0501069_0089299
547 Ga0501070_0016217
548 Ga0501070_0027888
549 Ga0501070_0042371
550 Ga0501073_0096917
551 Ga0501083_0072295
552 Ga0501035_0000505
553 Ga0501044_0054756
554 Ga0501044_0166293
555 Ga0501044_0463229
556 nmdc:mga03683_46554_c1
557 nmdc:mga03n38_31176_c1
558 nmdc:mga03n38_57147_c1
559 nmdc:mga03n38_9005_c1
560 nmdc:mga00v17_137124_c1
561 nmdc:mga00v17_14172_c1
562 nmdc:mga00v17_24567_c1
563 nmdc:mga00v17_44869_c1
564 nmdc:mga0yw44_1173_c1
565 nmdc:mga0yw44_5640_c1
566 nmdc:mga0yw44_5743_c1
567 nmdc:mga0k408_2078_c1
568 nmdc:mga0k408_85624_c1
569 nmdc:mga06z11_10375_c1
570 nmdc:mga06z11_14354_c1
571 nmdc:mga06z11_36526_c1
572 nmdc:mga04h51_12065_c1
573 nmdc:mga04h51_2439_c2
574 nmdc:mga07m45_224475_c1
575 nmdc:mga07m45_27317_c1
576 nmdc:mga08y16_370385_c1
577 nmdc:mga0sz30_29949_c1
578 nmdc:mga0sz30_87778_c1
579 Ga0495601_0005106
580 Ga0495601_0037036
581 Ga0495601_0216375
582 Ga0495595_0006079
583 Ga0495595_0086288
584 Ga0495619_0007411
585 Ga0495619_0291560
586 Ga0500643_003069
587 Ga0500566_0001508
588 Ga0500641_0000109
589 Ga0500641_0003059
590 Ga0500650_0001237
591 Ga0500556_0000003
592 Ga0500569_007767
593 Ga0500593_006141
594 Ga0500595_000118
595 Ga0500595_000864
596 Ga0500595_003176
597 Ga0500595_049268
598 Ga0500652_000921
599 Ga0500658_0026567
600 Ga0500568_0001594
601 Ga0500568_0029217
602 Ga0500604_0000208
603 Ga0500616_0000114
604 Ga0500616_0013170
605 Ga0500622_0004534
606 Ga0500622_0078595
607 Ga0500627_0002402
608 Ga0500636_0004993
609 Ga0500596_015721
610 2603857612
611 2643727755
612 2643754843
613 2644043295
614 2644395273
615 2874172994
616 2894237587
617 2909042783
618 2917700127
619 2919076601
620 2919140049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19799

DUF6282

Family of unknown function (DUF6282)

46

249

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gg7-assembly1.cif.gz_A crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans 0.7031 19 299
1xrf-assembly1.cif.gz_A the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution 0.7025 16 299
3gg7-assembly1.cif.gz_A crystal structure of an uncharacterized metalloprotein from deinococcus radiodurans 0.6932 19 299
2i5g-assembly1.cif.gz_B crystal strcuture of amidohydrolase from pseudomonas aeruginosa 0.6912 9 298
6gde-assembly1.cif.gz_A dihydroorotase from aquifex aeolicus standard (p,t) 0.6759 16 299
ID Description Score Start End Superfamily
af_Q9F1K0_1_146_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7491 18 85 3.20.20.140
af_P0AFQ7_2_265_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.706 18 305 3.20.20.140
3gg7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.7031 19 299 3.20.20.140
1xrfA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.701 18 299 3.20.20.140
3gg7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.6932 19 299 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A0A0EBE7-F1-model_v4 Cytosolic protein 0.9878 8 299
AF-A0A7W9Y8N7-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9742 67 300
AF-A0A3D3Q8J4-F1-model_v4 Cytosolic protein 0.9739 9 302
AF-A0A1K2F7E1-F1-model_v4 deleted 0.9736 8 299
AF-A0A321LWQ8-F1-model_v4 Cytosolic protein 0.9725 11 306

Map