F400724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 310 | 204 | 308 | 309 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10081836|Ga0157370_100818364 |
| Length | 326 |
| Sequence | LRVPFCGESGDDVVFMRLITYASGPSLAPRIGVRVGHRVLDIENGSRIDGEPLPNSMKGLLREGRGALSRVQALVRKAQSGAGRFGAAMLEERAIRFLPPVPDPDKFLCVGKNYRAHLEELKKNDLIKEMPEEVTGFVKLNSCLVGHDAKVAIPAAVKHLDYEPELVFVIGRRALGVKGEDAMEYAVGVTILNDLTDRDMQKREVASGSRFWTSKNAPGFGPLGPEIVTMDEIDDPYDLWLTCSVNGEERMRVNTRDQIWKLPAILEHFSRTIPIEPGDMFSTGAPGGVAVGKPNAKDLFLKPGDVVECSIEGITTLRTLIVSPTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 2 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 127 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 128 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 129 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 131 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 133 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 134 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 135 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 136 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 146 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 147 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.35 |
| Metatranscriptomes | 0 |
| Isolates | 0.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.61 |
| Rhizosphere | 97.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10095302 | 3300005295 | Bacteria | 3392 |
| 2 | Ga0070658_10001621 | 3300005327 | Bacteria | 19019 |
| 3 | Ga0070658_10065346 | 3300005327 | Bacteria | 2969 |
| 4 | Ga0070690_100062059 | 3300005330 | Bacteria | 2410 |
| 5 | Ga0070690_100182227 | 3300005330 | Bacteria | 1452 |
| 6 | Ga0070670_100125487 | 3300005331 | Bacteria | 2215 |
| 7 | Ga0070670_100206484 | 3300005331 | Bacteria | 1707 |
| 8 | Ga0068869_100006459 | 3300005334 | Bacteria | 7440 |
| 9 | Ga0070666_10007429 | 3300005335 | Bacteria | 6756 |
| 10 | Ga0070689_100261996 | 3300005340 | Bacteria | 1429 |
| 11 | Ga0070687_100008231 | 3300005343 | Bacteria | 4403 |
| 12 | Ga0070687_100208907 | 3300005343 | Bacteria | 1188 |
| 13 | Ga0070661_100090989 | 3300005344 | Bacteria | 2259 |
| 14 | Ga0070692_10155528 | 3300005345 | Bacteria | 1306 |
| 15 | Ga0070692_10248632 | 3300005345 | Bacteria | 1063 |
| 16 | Ga0070669_100079600 | 3300005353 | Bacteria | 2437 |
| 17 | Ga0070669_100121220 | 3300005353 | Unclassified | 1995 |
| 18 | Ga0070675_100012086 | 3300005354 | Bacteria | 6767 |
| 19 | Ga0070675_100024991 | 3300005354 | Bacteria | 4787 |
| 20 | Ga0070675_100058394 | 3300005354 | Bacteria | 3182 |
| 21 | Ga0070675_100340385 | 3300005354 | Bacteria | 1328 |
| 22 | Ga0070674_100006443 | 3300005356 | Bacteria | 6850 |
| 23 | Ga0070673_100046817 | 3300005364 | Bacteria | 3361 |
| 24 | Ga0070673_100094900 | 3300005364 | Bacteria | 2446 |
| 25 | Ga0070688_100002512 | 3300005365 | Bacteria | 9275 |
| 26 | Ga0070659_100028198 | 3300005366 | Bacteria | 4334 |
| 27 | Ga0070667_100008560 | 3300005367 | Bacteria | 8479 |
| 28 | Ga0070667_100166504 | 3300005367 | Bacteria | 1944 |
| 29 | Ga0070713_100421954 | 3300005436 | Bacteria | 1249 |
| 30 | Ga0070711_100266559 | 3300005439 | Bacteria | 1350 |
| 31 | Ga0070700_100023382 | 3300005441 | Bacteria | 3613 |
| 32 | Ga0070700_100069671 | 3300005441 | Bacteria | 2240 |
| 33 | Ga0070663_100100776 | 3300005455 | Bacteria | 2155 |
| 34 | Ga0070678_100102035 | 3300005456 | Bacteria | 2225 |
| 35 | Ga0070678_100105285 | 3300005456 | Bacteria | 2195 |
| 36 | Ga0070662_100036011 | 3300005457 | Bacteria | 3498 |
| 37 | Ga0070681_10176885 | 3300005458 | Bacteria | 2056 |
| 38 | Ga0068867_100032160 | 3300005459 | Bacteria | 3792 |
| 39 | Ga0070685_10218713 | 3300005466 | Bacteria | 1247 |
| 40 | Ga0070698_100478668 | 3300005471 | Bacteria | 1182 |
| 41 | Ga0070699_100109110 | 3300005518 | Bacteria | 2429 |
| 42 | Ga0070699_100143175 | 3300005518 | Bacteria | 2112 |
| 43 | Ga0070679_100024406 | 3300005530 | Bacteria | 5924 |
| 44 | Ga0070697_100018941 | 3300005536 | Bacteria | 5431 |
| 45 | Ga0070672_100047870 | 3300005543 | Bacteria | 3319 |
| 46 | Ga0070672_100099453 | 3300005543 | Bacteria | 2357 |
| 47 | Ga0070704_100024399 | 3300005549 | Bacteria | 3968 |
| 48 | Ga0068855_100016737 | 3300005563 | Bacteria | 8818 |
| 49 | Ga0068855_100034018 | 3300005563 | Bacteria | 6079 |
| 50 | Ga0068855_100209951 | 3300005563 | Bacteria | 2188 |
| 51 | Ga0068855_100401544 | 3300005563 | Bacteria | 1502 |
| 52 | Ga0068857_100064214 | 3300005577 | Bacteria | 3264 |
| 53 | Ga0068854_100143265 | 3300005578 | Bacteria | 1836 |
| 54 | Ga0068852_100001192 | 3300005616 | Bacteria | 17243 |
| 55 | Ga0068852_100014793 | 3300005616 | Bacteria | 6024 |
| 56 | Ga0068852_100044025 | 3300005616 | Bacteria | 3788 |
| 57 | Ga0068859_100005588 | 3300005617 | Bacteria | 12807 |
| 58 | Ga0068866_10001401 | 3300005718 | Bacteria | 10379 |
| 59 | Ga0068861_100028310 | 3300005719 | Bacteria | 4087 |
| 60 | Ga0068861_100031457 | 3300005719 | Bacteria | 3899 |
| 61 | Ga0068851_10000587 | 3300005834 | Bacteria | 15782 |
| 62 | Ga0068851_10044043 | 3300005834 | Bacteria | 2251 |
| 63 | Ga0068863_100003315 | 3300005841 | Bacteria | 15893 |
| 64 | Ga0068863_100008170 | 3300005841 | Bacteria | 10221 |
| 65 | Ga0068863_100022319 | 3300005841 | Bacteria | 6043 |
| 66 | Ga0068863_100085559 | 3300005841 | Bacteria | 2988 |
| 67 | Ga0068858_100021110 | 3300005842 | Bacteria | 6083 |
| 68 | Ga0068858_100234528 | 3300005842 | Bacteria | 1740 |
| 69 | Ga0068860_100000943 | 3300005843 | Bacteria | 32232 |
| 70 | Ga0068860_100025434 | 3300005843 | Bacteria | 5711 |
| 71 | Ga0081539_10046080 | 3300005985 | Bacteria | 2501 |
| 72 | Ga0070716_100014162 | 3300006173 | Bacteria | 4082 |
| 73 | Ga0097621_100011088 | 3300006237 | Bacteria | 6628 |
| 74 | Ga0097621_100053970 | 3300006237 | Bacteria | 3276 |
| 75 | Ga0068871_100011704 | 3300006358 | Bacteria | 6442 |
| 76 | Ga0068871_100035278 | 3300006358 | Bacteria | 3972 |
| 77 | Ga0068871_100244818 | 3300006358 | Bacteria | 1560 |
| 78 | Ga0075428_100305772 | 3300006844 | Bacteria | 1709 |
| 79 | Ga0075430_100157641 | 3300006846 | Bacteria | 1889 |
| 80 | Ga0075430_100284298 | 3300006846 | Bacteria | 1368 |
| 81 | Ga0075431_100113743 | 3300006847 | Bacteria | 2794 |
| 82 | Ga0075429_100010286 | 3300006880 | Bacteria | 8096 |
| 83 | Ga0068865_100003992 | 3300006881 | Bacteria | 8854 |
| 84 | Ga0075436_100006861 | 3300006914 | Bacteria | 7788 |
| 85 | Ga0097620_100005588 | 3300006931 | Bacteria | 12807 |
| 86 | Ga0099794_10018055 | 3300007265 | Bacteria | 3157 |
| 87 | Ga0105240_10065254 | 3300009093 | Bacteria | 4520 |
| 88 | Ga0105240_10110137 | 3300009093 | Bacteria | 3333 |
| 89 | Ga0111539_10295957 | 3300009094 | Bacteria | 1883 |
| 90 | Ga0105245_10245868 | 3300009098 | Bacteria | 1736 |
| 91 | Ga0105245_10465039 | 3300009098 | Bacteria | 1276 |
| 92 | Ga0114129_10012711 | 3300009147 | Bacteria | 11983 |
| 93 | Ga0105243_10007692 | 3300009148 | Bacteria | 8282 |
| 94 | Ga0105242_10057452 | 3300009176 | Bacteria | 3187 |
| 95 | Ga0105248_10000999 | 3300009177 | Bacteria | 31268 |
| 96 | Ga0105248_10165913 | 3300009177 | Bacteria | 2490 |
| 97 | Ga0105248_10211506 | 3300009177 | Bacteria | 2185 |
| 98 | Ga0105238_10001013 | 3300009551 | Bacteria | 28671 |
| 99 | Ga0105249_10405698 | 3300009553 | Bacteria | 1394 |
| 100 | Ga0157370_10081836 | 3300013104 | Bacteria | 3038 |
| 101 | Ga0157370_10130695 | 3300013104 | Bacteria | 2342 |
| 102 | Ga0157370_10199859 | 3300013104 | Bacteria | 1854 |
| 103 | Ga0157369_10001365 | 3300013105 | Bacteria | 30097 |
| 104 | Ga0157374_10068075 | 3300013296 | Bacteria | 3349 |
| 105 | Ga0157378_10750633 | 3300013297 | Bacteria | 999 |
| 106 | Ga0163162_10217031 | 3300013306 | Bacteria | 2043 |
| 107 | Ga0157372_10001111 | 3300013307 | Bacteria | 29223 |
| 108 | Ga0157372_10094461 | 3300013307 | Bacteria | 3405 |
| 109 | Ga0157372_10131295 | 3300013307 | Bacteria | 2882 |
| 110 | Ga0157375_10018138 | 3300013308 | Bacteria | 6377 |
| 111 | Ga0157375_10067716 | 3300013308 | Bacteria | 3568 |
| 112 | Ga0157375_10400834 | 3300013308 | Bacteria | 1538 |
| 113 | Ga0157380_10008057 | 3300014326 | Bacteria | 7507 |
| 114 | Ga0157380_10042615 | 3300014326 | Bacteria | 3548 |
| 115 | Ga0157380_10076349 | 3300014326 | Bacteria | 2727 |
| 116 | Ga0183362_10006 | 3300015683 | Bacteria | 287231 |
| 117 | Ga0207656_10001841 | 3300025321 | Bacteria | 7045 |
| 118 | Ga0207656_10035463 | 3300025321 | Bacteria | 2089 |
| 119 | Ga0207642_10003046 | 3300025899 | Bacteria | 5250 |
| 120 | Ga0207688_10020739 | 3300025901 | Bacteria | 3588 |
| 121 | Ga0207680_10010472 | 3300025903 | Bacteria | 4639 |
| 122 | Ga0207645_10056151 | 3300025907 | Bacteria | 2514 |
| 123 | Ga0207643_10008699 | 3300025908 | Bacteria | 5444 |
| 124 | Ga0207705_10004382 | 3300025909 | Bacteria | 10668 |
| 125 | Ga0207705_10168316 | 3300025909 | Bacteria | 1649 |
| 126 | Ga0207707_10080970 | 3300025912 | Bacteria | 2835 |
| 127 | Ga0207707_10156814 | 3300025912 | Bacteria | 1991 |
| 128 | Ga0207695_10025942 | 3300025913 | Bacteria | 6549 |
| 129 | Ga0207695_10078862 | 3300025913 | Bacteria | 3340 |
| 130 | Ga0207662_10026718 | 3300025918 | Bacteria | 3331 |
| 131 | Ga0207662_10075516 | 3300025918 | Bacteria | 2047 |
| 132 | Ga0207662_10136455 | 3300025918 | Bacteria | 1551 |
| 133 | Ga0207657_10185651 | 3300025919 | Bacteria | 1679 |
| 134 | Ga0207681_10000823 | 3300025923 | Bacteria | 20454 |
| 135 | Ga0207681_10105444 | 3300025923 | Unclassified | 2041 |
| 136 | Ga0207694_10042199 | 3300025924 | Bacteria | 3518 |
| 137 | Ga0207659_10009234 | 3300025926 | Bacteria | 6158 |
| 138 | Ga0207644_10000586 | 3300025931 | Bacteria | 23293 |
| 139 | Ga0207706_10021976 | 3300025933 | Bacteria | 5727 |
| 140 | Ga0207706_10029538 | 3300025933 | Bacteria | 4893 |
| 141 | Ga0207709_10014703 | 3300025935 | Bacteria | 4326 |
| 142 | Ga0207669_10004595 | 3300025937 | Bacteria | 6091 |
| 143 | Ga0207704_10016933 | 3300025938 | Bacteria | 3763 |
| 144 | Ga0207665_10003906 | 3300025939 | Bacteria | 9975 |
| 145 | Ga0207691_10024246 | 3300025940 | Bacteria | 5706 |
| 146 | Ga0207691_10120350 | 3300025940 | Bacteria | 2327 |
| 147 | Ga0207691_10148681 | 3300025940 | Bacteria | 2061 |
| 148 | Ga0207711_10037929 | 3300025941 | Bacteria | 4096 |
| 149 | Ga0207689_10005490 | 3300025942 | Bacteria | 11344 |
| 150 | Ga0207689_10172306 | 3300025942 | Bacteria | 1784 |
| 151 | Ga0207679_10288832 | 3300025945 | Bacteria | 1409 |
| 152 | Ga0207667_10264803 | 3300025949 | Bacteria | 1758 |
| 153 | Ga0207667_10269916 | 3300025949 | Bacteria | 1739 |
| 154 | Ga0207667_10349178 | 3300025949 | Bacteria | 1509 |
| 155 | Ga0207651_10137578 | 3300025960 | Bacteria | 1881 |
| 156 | Ga0207712_10009065 | 3300025961 | Bacteria | 6293 |
| 157 | Ga0207668_10008446 | 3300025972 | Bacteria | 6137 |
| 158 | Ga0207703_10004489 | 3300026035 | Bacteria | 11458 |
| 159 | Ga0207678_10098417 | 3300026067 | Bacteria | 2499 |
| 160 | Ga0207708_10023765 | 3300026075 | Bacteria | 4633 |
| 161 | Ga0207708_10087811 | 3300026075 | Bacteria | 2395 |
| 162 | Ga0207641_10009743 | 3300026088 | Bacteria | 7914 |
| 163 | Ga0207641_10262790 | 3300026088 | Bacteria | 1617 |
| 164 | Ga0207648_10004320 | 3300026089 | Bacteria | 14631 |
| 165 | Ga0207648_10007947 | 3300026089 | Bacteria | 10346 |
| 166 | Ga0207676_10029000 | 3300026095 | Bacteria | 4139 |
| 167 | Ga0207676_10326883 | 3300026095 | Bacteria | 1410 |
| 168 | Ga0207674_10248018 | 3300026116 | Bacteria | 1727 |
| 169 | Ga0207675_100002298 | 3300026118 | Bacteria | 18983 |
| 170 | Ga0207675_100039345 | 3300026118 | Bacteria | 4413 |
| 171 | Ga0207683_10254100 | 3300026121 | Bacteria | 1604 |
| 172 | Ga0207698_10000307 | 3300026142 | Bacteria | 29443 |
| 173 | Ga0207698_10037999 | 3300026142 | Bacteria | 3552 |
| 174 | Ga0207698_10070862 | 3300026142 | Bacteria | 2763 |
| 175 | Ga0207698_10126778 | 3300026142 | Bacteria | 2172 |
| 176 | Ga0209588_1019512 | 3300027671 | Bacteria | 2117 |
| 177 | Ga0268265_10113719 | 3300028380 | Bacteria | 2215 |
| 178 | Ga0268265_10152741 | 3300028380 | Bacteria | 1949 |
| 179 | Ga0268264_10001228 | 3300028381 | Bacteria | 24612 |
| 180 | Ga0268264_10013510 | 3300028381 | Bacteria | 6724 |
| 181 | Ga0307408_100219356 | 3300031548 | Bacteria | 1551 |
| 182 | Ga0307408_100412944 | 3300031548 | Bacteria | 1162 |
| 183 | Ga0307410_10127826 | 3300031852 | Bacteria | 1863 |
| 184 | Ga0307412_10074929 | 3300031911 | Bacteria | 2320 |
| 185 | Ga0307412_10262937 | 3300031911 | Bacteria | 1346 |
| 186 | Ga0307412_10328442 | 3300031911 | Bacteria | 1220 |
| 187 | Ga0307412_10346377 | 3300031911 | Bacteria | 1191 |
| 188 | Ga0307409_100002795 | 3300031995 | Bacteria | 9224 |
| 189 | Ga0307409_100365095 | 3300031995 | Bacteria | 1367 |
| 190 | Ga0307416_100135390 | 3300032002 | Bacteria | 2227 |
| 191 | Ga0307411_10417206 | 3300032005 | Bacteria | 1114 |
| 192 | Ga0307415_100052750 | 3300032126 | Bacteria | 2767 |
| 193 | Ga0307415_100179770 | 3300032126 | Bacteria | 1659 |
| 194 | Ga0373934_0006261 | 3300035086 | Bacteria | 4411 |
| 195 | Ga0373934_0032818 | 3300035086 | Bacteria | 2037 |
| 196 | Ga0373923_0051585 | 3300035111 | Bacteria | 1726 |
| 197 | Ga0373954_0000275 | 3300035118 | Bacteria | 18758 |
| 198 | Ga0373954_0011793 | 3300035118 | Bacteria | 3879 |
| 199 | Ga0373956_0011601 | 3300035119 | Bacteria | 3632 |
| 200 | Ga0373957_0047272 | 3300035120 | Bacteria | 1636 |
| 201 | Ga0373960_0038517 | 3300035121 | Bacteria | 1371 |
| 202 | Ga0373943_0202235 | 3300035170 | Unclassified | 1100 |
| 203 | Ga0373943_0247500 | 3300035170 | Bacteria | 1000 |
| 204 | Ga0373946_0018642 | 3300035171 | Bacteria | 2667 |
| 205 | Ga0373955_0011840 | 3300035172 | Bacteria | 4174 |
| 206 | Ga0373955_0052935 | 3300035172 | Bacteria | 2215 |
| 207 | Ga0373942_0001205 | 3300035207 | Bacteria | 6822 |
| 208 | Ga0373924_0004192 | 3300035410 | Bacteria | 5022 |
| 209 | Ga0373924_0009906 | 3300035410 | Bacteria | 3505 |
| 210 | Ga0373935_0018116 | 3300035692 | Bacteria | 4280 |
| 211 | Ga0373933_0001890 | 3300035724 | Bacteria | 12080 |
| 212 | Ga0373937_0019578 | 3300036401 | Bacteria | 6058 |
| 213 | Ga0373937_0032062 | 3300036401 | Bacteria | 4764 |
| 214 | Ga0373937_0041276 | 3300036401 | Bacteria | 4208 |
| 215 | Ga0373937_0047482 | 3300036401 | Bacteria | 3928 |
| 216 | Ga0373925_0017633 | 3300037068 | Bacteria | 5180 |
| 217 | Ga0373925_0128906 | 3300037068 | Bacteria | 1971 |
| 218 | Ga0395899_0001183 | 3300037312 | Bacteria | 23006 |
| 219 | Ga0395899_0001844 | 3300037312 | Bacteria | 17542 |
| 220 | Ga0395900_0021359 | 3300037418 | Bacteria | 6618 |
| 221 | Ga0395900_0086708 | 3300037418 | Bacteria | 3217 |
| 222 | Ga0395898_0003427 | 3300037466 | Bacteria | 17759 |
| 223 | Ga0395898_0007015 | 3300037466 | Bacteria | 11971 |
| 224 | Ga0395905_0000345 | 3300037471 | Bacteria | 65974 |
| 225 | Ga0395905_0015915 | 3300037471 | Bacteria | 7146 |
| 226 | Ga0395905_0028050 | 3300037471 | Bacteria | 5308 |
| 227 | Ga0395901_0011126 | 3300038443 | Bacteria | 9120 |
| 228 | Ga0395901_0302714 | 3300038443 | Bacteria | 1657 |
| 229 | Ga0451853_2788413 | 3300041512 | Bacteria | 1085 |
| 230 | Ga0451577_0418599 | 3300042876 | Bacteria | 1216 |
| 231 | Ga0453684_0030044 | 3300044712 | Bacteria | 7691 |
| 232 | Ga0453684_0180747 | 3300044712 | Bacteria | 2476 |
| 233 | Ga0453684_0522312 | 3300044712 | Bacteria | 1311 |
| 234 | Ga0466957_0003426 | 3300044842 | Bacteria | 8707 |
| 235 | Ga0466959_0164252 | 3300045049 | Bacteria | 1560 |
| 236 | Ga0495592_0004252 | 3300046454 | Bacteria | 10458 |
| 237 | Ga0495592_0189990 | 3300046454 | Bacteria | 1392 |
| 238 | Ga0495641_0027076 | 3300046461 | Bacteria | 2791 |
| 239 | Ga0495651_0122292 | 3300046462 | Bacteria | 1910 |
| 240 | Ga0495651_0263947 | 3300046462 | Unclassified | 1170 |
| 241 | Ga0495653_0070250 | 3300046463 | Bacteria | 2621 |
| 242 | Ga0495580_0077545 | 3300046472 | Bacteria | 2317 |
| 243 | Ga0495580_0124340 | 3300046472 | Bacteria | 1790 |
| 244 | Ga0495585_0000166 | 3300046492 | Bacteria | 71084 |
| 245 | Ga0495618_0114376 | 3300046514 | Bacteria | 1727 |
| 246 | Ga0495628_0000277 | 3300046516 | Bacteria | 45973 |
| 247 | Ga0495628_0002586 | 3300046516 | Bacteria | 16269 |
| 248 | Ga0495628_0316374 | 3300046516 | Bacteria | 1152 |
| 249 | Ga0495630_0039576 | 3300046517 | Bacteria | 3524 |
| 250 | Ga0495652_0001564 | 3300046529 | Bacteria | 25037 |
| 251 | Ga0495652_0228768 | 3300046529 | Bacteria | 1392 |
| 252 | Ga0495665_0087166 | 3300046531 | Bacteria | 1640 |
| 253 | Ga0495640_0031252 | 3300046533 | Bacteria | 3801 |
| 254 | Ga0495621_0026851 | 3300046539 | Bacteria | 1946 |
| 255 | Ga0495645_0000603 | 3300046543 | Bacteria | 24774 |
| 256 | Ga0495667_0057132 | 3300046559 | Bacteria | 2566 |
| 257 | Ga0495635_0237449 | 3300046663 | Bacteria | 1230 |
| 258 | Ga0495635_0347366 | 3300046663 | Unclassified | 990 |
| 259 | Ga0495657_0213728 | 3300046675 | Bacteria | 1171 |
| 260 | Ga0495599_0106490 | 3300046678 | Bacteria | 1747 |
| 261 | Ga0495646_0176975 | 3300046680 | Bacteria | 1173 |
| 262 | Ga0495658_0011617 | 3300046683 | Bacteria | 4435 |
| 263 | Ga0495658_0055346 | 3300046683 | Bacteria | 2260 |
| 264 | Ga0495613_0050915 | 3300046689 | Bacteria | 3054 |
| 265 | Ga0495624_0080244 | 3300046690 | Bacteria | 2022 |
| 266 | Ga0495600_0014499 | 3300046809 | Bacteria | 4967 |
| 267 | Ga0495674_0127324 | 3300047319 | Bacteria | 2147 |
| 268 | Ga0495680_0055952 | 3300047322 | Bacteria | 3057 |
| 269 | Ga0496104_0047314 | 3300048907 | Bacteria | 4054 |
| 270 | Ga0496105_0080224 | 3300048908 | Bacteria | 2695 |
| 271 | Ga0496106_0428607 | 3300048909 | Unclassified | 1063 |
| 272 | Ga0496109_0365174 | 3300048912 | Bacteria | 1364 |
| 273 | Ga0496114_0042922 | 3300048917 | Bacteria | 3749 |
| 274 | Ga0501034_0064295 | 3300049571 | Bacteria | 3683 |
| 275 | Ga0501039_0053978 | 3300049575 | Bacteria | 3111 |
| 276 | Ga0501040_0199824 | 3300049576 | Bacteria | 1419 |
| 277 | Ga0501041_0150273 | 3300049577 | Bacteria | 1454 |
| 278 | Ga0501047_0001536 | 3300049581 | Bacteria | 22571 |
| 279 | Ga0501068_0181327 | 3300049584 | Bacteria | 1331 |
| 280 | Ga0501069_0004850 | 3300049585 | Bacteria | 6966 |
| 281 | Ga0501070_0007516 | 3300049586 | Bacteria | 9259 |
| 282 | Ga0501070_0009848 | 3300049586 | Bacteria | 8081 |
| 283 | Ga0501070_0119434 | 3300049586 | Bacteria | 2179 |
| 284 | Ga0501071_0102199 | 3300049587 | Bacteria | 2114 |
| 285 | Ga0501072_0021852 | 3300049588 | Bacteria | 4963 |
| 286 | Ga0501072_0109681 | 3300049588 | Bacteria | 2197 |
| 287 | Ga0501073_0000778 | 3300049589 | Bacteria | 22693 |
| 288 | Ga0501074_0006250 | 3300049590 | Bacteria | 8603 |
| 289 | Ga0501074_0019509 | 3300049590 | Bacteria | 4923 |
| 290 | Ga0501079_0004640 | 3300049741 | Bacteria | 10176 |
| 291 | Ga0501080_0022290 | 3300049742 | Bacteria | 5866 |
| 292 | Ga0501080_0197894 | 3300049742 | Bacteria | 1845 |
| 293 | Ga0501080_0211810 | 3300049742 | Bacteria | 1776 |
| 294 | Ga0501083_0000259 | 3300049744 | Bacteria | 33650 |
| 295 | Ga0501044_0074441 | 3300049823 | Bacteria | 3450 |
| 296 | nmdc:mga05p37_355_c1 | 3300050507 | Bacteria | 49150 |
| 297 | nmdc:mga09592_4260_c1 | 3300050508 | Bacteria | 11553 |
| 298 | nmdc:mga0qj67_83736_c1 | 3300050509 | Bacteria | 2557 |
| 299 | nmdc:mga08y16_130288_c1 | 3300050511 | Bacteria | 2616 |
| 300 | nmdc:mga08x19_2801_c1 | 3300050514 | Bacteria | 10514 |
| 301 | nmdc:mga0a205_218455_c1 | 3300050515 | Bacteria | 1792 |
| 302 | Ga0495601_0003518 | 3300053077 | Bacteria | 9000 |
| 303 | Ga0495601_0008392 | 3300053077 | Bacteria | 6101 |
| 304 | Ga0495601_0447349 | 3300053077 | Archaea | 836 |
| 305 | Ga0495612_0066263 | 3300053078 | Bacteria | 1501 |
| 306 | Ga0495619_0080629 | 3300053085 | Bacteria | 2190 |
| 307 | Ga0495619_0270880 | 3300053085 | Bacteria | 1177 |
| 308 | Ga0501082_0294744 | 3300060353 | Bacteria | 1412 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005365 | Ga0070688_100002512 | Ga0070688_1000025123 | 249 |
| 2 | 3300046663 | Ga0495635_0347366 | Ga0495635_0347366_176_973 | 259 |
| 3 | 3300013297 | Ga0157378_10750633 | Ga0157378_107506332 | 260 |
| 4 | 3300046680 | Ga0495646_0176975 | Ga0495646_0176975_36_851 | 260 |
| 5 | 3300048912 | Ga0496109_0365174 | Ga0496109_0365174_316_1137 | 260 |
| 6 | 3300049571 | Ga0501034_0064295 | Ga0501034_0064295_2854_3666 | 260 |
| 7 | 3300049742 | Ga0501080_0211810 | Ga0501080_0211810_25_858 | 260 |
| 8 | 3300053085 | Ga0495619_0270880 | Ga0495619_0270880_11_817 | 260 |
| 9 | 3300005471 | Ga0070698_100478668 | Ga0070698_1004786681 | 263 |
| 10 | 3300053077 | Ga0495601_0447349 | Ga0495601_0447349_18_815 | 265 |
| 11 | 3300007265 | Ga0099794_10018055 | Ga0099794_100180553 | 266 |
| 12 | 3300009147 | Ga0114129_10012711 | Ga0114129_1001271112 | 272 |
| 13 | 3300046492 | Ga0495585_0000166 | Ga0495585_0000166_5162_6043 | 272 |
| 14 | 3300050507 | nmdc:mga05p37_355_c1 | nmdc:mga05p37_355_c1_8251_9084 | 272 |
| 15 | 3300050508 | nmdc:mga09592_4260_c1 | nmdc:mga09592_4260_c1_1018_1851 | 272 |
| 16 | 3300050515 | nmdc:mga0a205_218455_c1 | nmdc:mga0a205_218455_c1_87_920 | 272 |
| 17 | 3300014326 | Ga0157380_10042615 | Ga0157380_100426153 | 276 |
| 18 | 3300049742 | Ga0501080_0197894 | Ga0501080_0197894_42_929 | 276 |
| 19 | 3300013105 | Ga0157369_10001365 | Ga0157369_1000136521 | 278 |
| 20 | 3300031911 | Ga0307412_10074929 | Ga0307412_100749292 | 279 |
| 21 | 3300036401 | Ga0373937_0019578 | Ga0373937_0019578_3522_4364 | 280 |
| 22 | 3300005439 | Ga0070711_100266559 | Ga0070711_1002665591 | 282 |
| 23 | 3300035172 | Ga0373955_0052935 | Ga0373955_0052935_945_1793 | 282 |
| 24 | 3300035410 | Ga0373924_0004192 | Ga0373924_0004192_1721_2569 | 282 |
| 25 | 3300035724 | Ga0373933_0001890 | Ga0373933_0001890_2297_3145 | 282 |
| 26 | 3300036401 | Ga0373937_0047482 | Ga0373937_0047482_2802_3650 | 282 |
| 27 | 3300042876 | Ga0451577_0418599 | Ga0451577_0418599_217_1131 | 282 |
| 28 | 3300044712 | Ga0453684_0180747 | Ga0453684_0180747_1108_2022 | 282 |
| 29 | 3300044712 | Ga0453684_0522312 | Ga0453684_0522312_200_1117 | 282 |
| 30 | 3300047322 | Ga0495680_0055952 | Ga0495680_0055952_564_1412 | 282 |
| 31 | 3300035170 | Ga0373943_0202235 | Ga0373943_0202235_165_1025 | 283 |
| 32 | 3300005436 | Ga0070713_100421954 | Ga0070713_1004219542 | 285 |
| 33 | 3300005985 | Ga0081539_10046080 | Ga0081539_100460804 | 285 |
| 34 | 3300005518 | Ga0070699_100109110 | Ga0070699_1001091103 | 287 |
| 35 | 3300006847 | Ga0075431_100113743 | Ga0075431_1001137432 | 287 |
| 36 | 3300006880 | Ga0075429_100010286 | Ga0075429_1000102865 | 287 |
| 37 | 3300015683 | Ga0183362_10006 | Ga0183362_10006216 | 288 |
| 38 | 3300031911 | Ga0307412_10328442 | Ga0307412_103284422 | 288 |
| 39 | 3300031911 | Ga0307412_10346377 | Ga0307412_103463772 | 288 |
| 40 | 3300032005 | Ga0307411_10417206 | Ga0307411_104172061 | 288 |
| 41 | 3300037312 | Ga0395899_0001183 | Ga0395899_0001183_2955_3851 | 288 |
| 42 | 3300037418 | Ga0395900_0086708 | Ga0395900_0086708_1921_2817 | 288 |
| 43 | 3300037466 | Ga0395898_0003427 | Ga0395898_0003427_3683_4579 | 288 |
| 44 | 3300037471 | Ga0395905_0000345 | Ga0395905_0000345_32291_33199 | 288 |
| 45 | 3300037471 | Ga0395905_0015915 | Ga0395905_0015915_2088_2984 | 288 |
| 46 | 3300038443 | Ga0395901_0011126 | Ga0395901_0011126_2706_3602 | 288 |
| 47 | 3300005353 | Ga0070669_100121220 | Ga0070669_1001212202 | 289 |
| 48 | 3300006914 | Ga0075436_100006861 | Ga0075436_1000068613 | 289 |
| 49 | 3300009177 | Ga0105248_10165913 | Ga0105248_101659133 | 289 |
| 50 | 3300013308 | Ga0157375_10400834 | Ga0157375_104008342 | 289 |
| 51 | 3300025907 | Ga0207645_10056151 | Ga0207645_100561511 | 289 |
| 52 | 3300025923 | Ga0207681_10105444 | Ga0207681_101054442 | 289 |
| 53 | 3300035207 | Ga0373942_0001205 | Ga0373942_0001205_4471_5340 | 289 |
| 54 | 3300049575 | Ga0501039_0053978 | Ga0501039_0053978_1602_2501 | 289 |
| 55 | 3300049576 | Ga0501040_0199824 | Ga0501040_0199824_484_1383 | 289 |
| 56 | 3300049577 | Ga0501041_0150273 | Ga0501041_0150273_210_1109 | 289 |
| 57 | 3300049587 | Ga0501071_0102199 | Ga0501071_0102199_1159_2058 | 289 |
| 58 | 3300049588 | Ga0501072_0021852 | Ga0501072_0021852_2127_3026 | 289 |
| 59 | 3300005456 | Ga0070678_100105285 | Ga0070678_1001052852 | 291 |
| 60 | 3300048917 | Ga0496114_0042922 | Ga0496114_0042922_2202_3164 | 291 |
| 61 | iso_pu_bacteria | 2881412998 | 2881416510 | 291 |
| 62 | iso_pu_bacteria | 2887375801 | 2887377040 | 291 |
| 63 | 3300048909 | Ga0496106_0428607 | Ga0496106_0428607_22_927 | 292 |
| 64 | 3300005330 | Ga0070690_100182227 | Ga0070690_1001822271 | 293 |
| 65 | 3300005343 | Ga0070687_100208907 | Ga0070687_1002089072 | 293 |
| 66 | 3300005466 | Ga0070685_10218713 | Ga0070685_102187132 | 293 |
| 67 | 3300006358 | Ga0068871_100035278 | Ga0068871_1000352783 | 293 |
| 68 | 3300006846 | Ga0075430_100157641 | Ga0075430_1001576411 | 293 |
| 69 | 3300006846 | Ga0075430_100284298 | Ga0075430_1002842982 | 293 |
| 70 | 3300014326 | Ga0157380_10076349 | Ga0157380_100763493 | 293 |
| 71 | 3300025918 | Ga0207662_10075516 | Ga0207662_100755162 | 293 |
| 72 | 3300026095 | Ga0207676_10326883 | Ga0207676_103268832 | 293 |
| 73 | 3300035121 | Ga0373960_0038517 | Ga0373960_0038517_448_1347 | 293 |
| 74 | 3300037068 | Ga0373925_0017633 | Ga0373925_0017633_3569_4531 | 293 |
| 75 | 3300037312 | Ga0395899_0001844 | Ga0395899_0001844_7727_8644 | 293 |
| 76 | 3300037466 | Ga0395898_0007015 | Ga0395898_0007015_172_1089 | 293 |
| 77 | 3300037471 | Ga0395905_0028050 | Ga0395905_0028050_112_1029 | 293 |
| 78 | 3300038443 | Ga0395901_0302714 | Ga0395901_0302714_393_1310 | 293 |
| 79 | 3300050509 | nmdc:mga0qj67_83736_c1 | nmdc:mga0qj67_83736_c1_163_1044 | 293 |
| 80 | 3300050511 | nmdc:mga08y16_130288_c1 | nmdc:mga08y16_130288_c1_577_1458 | 293 |
| 81 | 3300005354 | Ga0070675_100012086 | Ga0070675_1000120861 | 294 |
| 82 | 3300005577 | Ga0068857_100064214 | Ga0068857_1000642143 | 294 |
| 83 | 3300009098 | Ga0105245_10245868 | Ga0105245_102458682 | 294 |
| 84 | 3300009098 | Ga0105245_10465039 | Ga0105245_104650392 | 294 |
| 85 | 3300025940 | Ga0207691_10148681 | Ga0207691_101486812 | 294 |
| 86 | 3300025942 | Ga0207689_10172306 | Ga0207689_101723061 | 294 |
| 87 | 3300026116 | Ga0207674_10248018 | Ga0207674_102480183 | 294 |
| 88 | 3300026121 | Ga0207683_10254100 | Ga0207683_102541002 | 294 |
| 89 | 3300041512 | Ga0451853_2788413 | Ga0451853_2788413_144_1073 | 294 |
| 90 | 3300044712 | Ga0453684_0030044 | Ga0453684_0030044_5784_6755 | 294 |
| 91 | 3300046462 | Ga0495651_0263947 | Ga0495651_0263947_194_1135 | 294 |
| 92 | 3300049586 | Ga0501070_0119434 | Ga0501070_0119434_400_1365 | 294 |
| 93 | 3300005327 | Ga0070658_10001621 | Ga0070658_1000162112 | 295 |
| 94 | 3300005327 | Ga0070658_10065346 | Ga0070658_100653463 | 295 |
| 95 | 3300005330 | Ga0070690_100062059 | Ga0070690_1000620592 | 295 |
| 96 | 3300005331 | Ga0070670_100125487 | Ga0070670_1001254872 | 295 |
| 97 | 3300005331 | Ga0070670_100206484 | Ga0070670_1002064841 | 295 |
| 98 | 3300005334 | Ga0068869_100006459 | Ga0068869_1000064595 | 295 |
| 99 | 3300005335 | Ga0070666_10007429 | Ga0070666_100074293 | 295 |
| 100 | 3300005340 | Ga0070689_100261996 | Ga0070689_1002619962 | 295 |
| 101 | 3300005343 | Ga0070687_100008231 | Ga0070687_1000082314 | 295 |
| 102 | 3300005344 | Ga0070661_100090989 | Ga0070661_1000909892 | 295 |
| 103 | 3300005345 | Ga0070692_10155528 | Ga0070692_101555281 | 295 |
| 104 | 3300005354 | Ga0070675_100024991 | Ga0070675_1000249913 | 295 |
| 105 | 3300005354 | Ga0070675_100058394 | Ga0070675_1000583943 | 295 |
| 106 | 3300005354 | Ga0070675_100340385 | Ga0070675_1003403851 | 295 |
| 107 | 3300005356 | Ga0070674_100006443 | Ga0070674_1000064435 | 295 |
| 108 | 3300005364 | Ga0070673_100046817 | Ga0070673_1000468172 | 295 |
| 109 | 3300005364 | Ga0070673_100094900 | Ga0070673_1000949002 | 295 |
| 110 | 3300005366 | Ga0070659_100028198 | Ga0070659_1000281984 | 295 |
| 111 | 3300005367 | Ga0070667_100008560 | Ga0070667_1000085606 | 295 |
| 112 | 3300005367 | Ga0070667_100166504 | Ga0070667_1001665042 | 295 |
| 113 | 3300005441 | Ga0070700_100023382 | Ga0070700_1000233823 | 295 |
| 114 | 3300005455 | Ga0070663_100100776 | Ga0070663_1001007763 | 295 |
| 115 | 3300005456 | Ga0070678_100102035 | Ga0070678_1001020352 | 295 |
| 116 | 3300005457 | Ga0070662_100036011 | Ga0070662_1000360113 | 295 |
| 117 | 3300005458 | Ga0070681_10176885 | Ga0070681_101768854 | 295 |
| 118 | 3300005459 | Ga0068867_100032160 | Ga0068867_1000321603 | 295 |
| 119 | 3300005518 | Ga0070699_100143175 | Ga0070699_1001431753 | 295 |
| 120 | 3300005530 | Ga0070679_100024406 | Ga0070679_1000244063 | 295 |
| 121 | 3300005536 | Ga0070697_100018941 | Ga0070697_1000189415 | 295 |
| 122 | 3300005543 | Ga0070672_100047870 | Ga0070672_1000478704 | 295 |
| 123 | 3300005543 | Ga0070672_100099453 | Ga0070672_1000994532 | 295 |
| 124 | 3300005549 | Ga0070704_100024399 | Ga0070704_1000243992 | 295 |
| 125 | 3300005563 | Ga0068855_100016737 | Ga0068855_1000167373 | 295 |
| 126 | 3300005563 | Ga0068855_100034018 | Ga0068855_1000340184 | 295 |
| 127 | 3300005563 | Ga0068855_100209951 | Ga0068855_1002099512 | 295 |
| 128 | 3300005563 | Ga0068855_100401544 | Ga0068855_1004015442 | 295 |
| 129 | 3300005578 | Ga0068854_100143265 | Ga0068854_1001432653 | 295 |
| 130 | 3300005616 | Ga0068852_100001192 | Ga0068852_10000119215 | 295 |
| 131 | 3300005616 | Ga0068852_100014793 | Ga0068852_1000147932 | 295 |
| 132 | 3300005616 | Ga0068852_100044025 | Ga0068852_1000440253 | 295 |
| 133 | 3300005617 | Ga0068859_100005588 | Ga0068859_1000055885 | 295 |
| 134 | 3300005718 | Ga0068866_10001401 | Ga0068866_100014016 | 295 |
| 135 | 3300005719 | Ga0068861_100028310 | Ga0068861_1000283104 | 295 |
| 136 | 3300005834 | Ga0068851_10000587 | Ga0068851_1000058715 | 295 |
| 137 | 3300005834 | Ga0068851_10044043 | Ga0068851_100440431 | 295 |
| 138 | 3300005841 | Ga0068863_100003315 | Ga0068863_1000033153 | 295 |
| 139 | 3300005841 | Ga0068863_100008170 | Ga0068863_1000081709 | 295 |
| 140 | 3300005841 | Ga0068863_100022319 | Ga0068863_10002231910 | 295 |
| 141 | 3300005841 | Ga0068863_100085559 | Ga0068863_1000855594 | 295 |
| 142 | 3300005842 | Ga0068858_100021110 | Ga0068858_1000211104 | 295 |
| 143 | 3300005842 | Ga0068858_100234528 | Ga0068858_1002345282 | 295 |
| 144 | 3300005843 | Ga0068860_100000943 | Ga0068860_10000094320 | 295 |
| 145 | 3300005843 | Ga0068860_100025434 | Ga0068860_1000254344 | 295 |
| 146 | 3300006173 | Ga0070716_100014162 | Ga0070716_1000141623 | 295 |
| 147 | 3300006237 | Ga0097621_100011088 | Ga0097621_1000110883 | 295 |
| 148 | 3300006237 | Ga0097621_100053970 | Ga0097621_1000539702 | 295 |
| 149 | 3300006358 | Ga0068871_100011704 | Ga0068871_1000117042 | 295 |
| 150 | 3300006358 | Ga0068871_100244818 | Ga0068871_1002448182 | 295 |
| 151 | 3300006844 | Ga0075428_100305772 | Ga0075428_1003057722 | 295 |
| 152 | 3300006881 | Ga0068865_100003992 | Ga0068865_1000039926 | 295 |
| 153 | 3300006931 | Ga0097620_100005588 | Ga0097620_1000055889 | 295 |
| 154 | 3300009093 | Ga0105240_10065254 | Ga0105240_100652542 | 295 |
| 155 | 3300009093 | Ga0105240_10110137 | Ga0105240_101101372 | 295 |
| 156 | 3300009094 | Ga0111539_10295957 | Ga0111539_102959572 | 295 |
| 157 | 3300009148 | Ga0105243_10007692 | Ga0105243_100076924 | 295 |
| 158 | 3300009176 | Ga0105242_10057452 | Ga0105242_100574526 | 295 |
| 159 | 3300009177 | Ga0105248_10000999 | Ga0105248_1000099910 | 295 |
| 160 | 3300009177 | Ga0105248_10211506 | Ga0105248_102115062 | 295 |
| 161 | 3300009551 | Ga0105238_10001013 | Ga0105238_1000101321 | 295 |
| 162 | 3300013104 | Ga0157370_10081836 | Ga0157370_100818364 | 295 |
| 163 | 3300013104 | Ga0157370_10130695 | Ga0157370_101306953 | 295 |
| 164 | 3300013104 | Ga0157370_10199859 | Ga0157370_101998592 | 295 |
| 165 | 3300013296 | Ga0157374_10068075 | Ga0157374_100680755 | 295 |
| 166 | 3300013306 | Ga0163162_10217031 | Ga0163162_102170312 | 295 |
| 167 | 3300013307 | Ga0157372_10001111 | Ga0157372_100011115 | 295 |
| 168 | 3300013307 | Ga0157372_10094461 | Ga0157372_100944613 | 295 |
| 169 | 3300013307 | Ga0157372_10131295 | Ga0157372_101312953 | 295 |
| 170 | 3300013308 | Ga0157375_10018138 | Ga0157375_100181388 | 295 |
| 171 | 3300013308 | Ga0157375_10067716 | Ga0157375_100677163 | 295 |
| 172 | 3300014326 | Ga0157380_10008057 | Ga0157380_100080573 | 295 |
| 173 | 3300025321 | Ga0207656_10001841 | Ga0207656_100018412 | 295 |
| 174 | 3300025321 | Ga0207656_10035463 | Ga0207656_100354632 | 295 |
| 175 | 3300025899 | Ga0207642_10003046 | Ga0207642_100030466 | 295 |
| 176 | 3300025901 | Ga0207688_10020739 | Ga0207688_100207392 | 295 |
| 177 | 3300025903 | Ga0207680_10010472 | Ga0207680_100104725 | 295 |
| 178 | 3300025908 | Ga0207643_10008699 | Ga0207643_100086995 | 295 |
| 179 | 3300025909 | Ga0207705_10004382 | Ga0207705_100043823 | 295 |
| 180 | 3300025909 | Ga0207705_10168316 | Ga0207705_101683162 | 295 |
| 181 | 3300025912 | Ga0207707_10080970 | Ga0207707_100809702 | 295 |
| 182 | 3300025912 | Ga0207707_10156814 | Ga0207707_101568142 | 295 |
| 183 | 3300025913 | Ga0207695_10025942 | Ga0207695_1002594210 | 295 |
| 184 | 3300025913 | Ga0207695_10078862 | Ga0207695_100788625 | 295 |
| 185 | 3300025918 | Ga0207662_10026718 | Ga0207662_100267183 | 295 |
| 186 | 3300025918 | Ga0207662_10136455 | Ga0207662_101364553 | 295 |
| 187 | 3300025919 | Ga0207657_10185651 | Ga0207657_101856512 | 295 |
| 188 | 3300025923 | Ga0207681_10000823 | Ga0207681_1000082313 | 295 |
| 189 | 3300025924 | Ga0207694_10042199 | Ga0207694_100421992 | 295 |
| 190 | 3300025926 | Ga0207659_10009234 | Ga0207659_100092343 | 295 |
| 191 | 3300025931 | Ga0207644_10000586 | Ga0207644_1000058616 | 295 |
| 192 | 3300025933 | Ga0207706_10021976 | Ga0207706_100219765 | 295 |
| 193 | 3300025933 | Ga0207706_10029538 | Ga0207706_100295383 | 295 |
| 194 | 3300025937 | Ga0207669_10004595 | Ga0207669_100045955 | 295 |
| 195 | 3300025938 | Ga0207704_10016933 | Ga0207704_100169333 | 295 |
| 196 | 3300025939 | Ga0207665_10003906 | Ga0207665_100039067 | 295 |
| 197 | 3300025940 | Ga0207691_10024246 | Ga0207691_100242465 | 295 |
| 198 | 3300025940 | Ga0207691_10120350 | Ga0207691_101203502 | 295 |
| 199 | 3300025941 | Ga0207711_10037929 | Ga0207711_100379292 | 295 |
| 200 | 3300025942 | Ga0207689_10005490 | Ga0207689_1000549012 | 295 |
| 201 | 3300025945 | Ga0207679_10288832 | Ga0207679_102888322 | 295 |
| 202 | 3300025949 | Ga0207667_10264803 | Ga0207667_102648033 | 295 |
| 203 | 3300025949 | Ga0207667_10269916 | Ga0207667_102699162 | 295 |
| 204 | 3300025949 | Ga0207667_10349178 | Ga0207667_103491782 | 295 |
| 205 | 3300025960 | Ga0207651_10137578 | Ga0207651_101375782 | 295 |
| 206 | 3300025961 | Ga0207712_10009065 | Ga0207712_100090655 | 295 |
| 207 | 3300025972 | Ga0207668_10008446 | Ga0207668_100084462 | 295 |
| 208 | 3300026035 | Ga0207703_10004489 | Ga0207703_100044898 | 295 |
| 209 | 3300026067 | Ga0207678_10098417 | Ga0207678_100984171 | 295 |
| 210 | 3300026075 | Ga0207708_10023765 | Ga0207708_100237654 | 295 |
| 211 | 3300026088 | Ga0207641_10009743 | Ga0207641_100097436 | 295 |
| 212 | 3300026088 | Ga0207641_10262790 | Ga0207641_102627902 | 295 |
| 213 | 3300026089 | Ga0207648_10007947 | Ga0207648_100079472 | 295 |
| 214 | 3300026095 | Ga0207676_10029000 | Ga0207676_100290003 | 295 |
| 215 | 3300026118 | Ga0207675_100002298 | Ga0207675_1000022983 | 295 |
| 216 | 3300026142 | Ga0207698_10000307 | Ga0207698_1000030724 | 295 |
| 217 | 3300026142 | Ga0207698_10037999 | Ga0207698_100379993 | 295 |
| 218 | 3300026142 | Ga0207698_10070862 | Ga0207698_100708622 | 295 |
| 219 | 3300026142 | Ga0207698_10126778 | Ga0207698_101267782 | 295 |
| 220 | 3300027671 | Ga0209588_1019512 | Ga0209588_10195122 | 295 |
| 221 | 3300028380 | Ga0268265_10113719 | Ga0268265_101137192 | 295 |
| 222 | 3300028381 | Ga0268264_10001228 | Ga0268264_100012286 | 295 |
| 223 | 3300028381 | Ga0268264_10013510 | Ga0268264_100135108 | 295 |
| 224 | 3300031548 | Ga0307408_100219356 | Ga0307408_1002193562 | 295 |
| 225 | 3300031548 | Ga0307408_100412944 | Ga0307408_1004129442 | 295 |
| 226 | 3300031852 | Ga0307410_10127826 | Ga0307410_101278262 | 295 |
| 227 | 3300031911 | Ga0307412_10262937 | Ga0307412_102629372 | 295 |
| 228 | 3300031995 | Ga0307409_100002795 | Ga0307409_1000027952 | 295 |
| 229 | 3300031995 | Ga0307409_100365095 | Ga0307409_1003650952 | 295 |
| 230 | 3300032002 | Ga0307416_100135390 | Ga0307416_1001353903 | 295 |
| 231 | 3300032126 | Ga0307415_100052750 | Ga0307415_1000527503 | 295 |
| 232 | 3300032126 | Ga0307415_100179770 | Ga0307415_1001797702 | 295 |
| 233 | 3300035086 | Ga0373934_0006261 | Ga0373934_0006261_1684_2628 | 295 |
| 234 | 3300035086 | Ga0373934_0032818 | Ga0373934_0032818_158_1099 | 295 |
| 235 | 3300035111 | Ga0373923_0051585 | Ga0373923_0051585_621_1562 | 295 |
| 236 | 3300035118 | Ga0373954_0000275 | Ga0373954_0000275_17757_18701 | 295 |
| 237 | 3300035118 | Ga0373954_0011793 | Ga0373954_0011793_693_1637 | 295 |
| 238 | 3300035119 | Ga0373956_0011601 | Ga0373956_0011601_67_1011 | 295 |
| 239 | 3300035120 | Ga0373957_0047272 | Ga0373957_0047272_381_1286 | 295 |
| 240 | 3300035170 | Ga0373943_0247500 | Ga0373943_0247500_11_973 | 295 |
| 241 | 3300035171 | Ga0373946_0018642 | Ga0373946_0018642_932_1873 | 295 |
| 242 | 3300035172 | Ga0373955_0011840 | Ga0373955_0011840_1233_2177 | 295 |
| 243 | 3300035410 | Ga0373924_0009906 | Ga0373924_0009906_486_1427 | 295 |
| 244 | 3300035692 | Ga0373935_0018116 | Ga0373935_0018116_2160_3101 | 295 |
| 245 | 3300036401 | Ga0373937_0032062 | Ga0373937_0032062_2279_3223 | 295 |
| 246 | 3300036401 | Ga0373937_0041276 | Ga0373937_0041276_2536_3498 | 295 |
| 247 | 3300037068 | Ga0373925_0128906 | Ga0373925_0128906_142_1086 | 295 |
| 248 | 3300037418 | Ga0395900_0021359 | Ga0395900_0021359_3777_4742 | 295 |
| 249 | 3300044842 | Ga0466957_0003426 | Ga0466957_0003426_4252_5184 | 295 |
| 250 | 3300045049 | Ga0466959_0164252 | Ga0466959_0164252_420_1352 | 295 |
| 251 | 3300046454 | Ga0495592_0004252 | Ga0495592_0004252_928_1872 | 295 |
| 252 | 3300046454 | Ga0495592_0189990 | Ga0495592_0189990_157_1101 | 295 |
| 253 | 3300046461 | Ga0495641_0027076 | Ga0495641_0027076_1112_2053 | 295 |
| 254 | 3300046462 | Ga0495651_0122292 | Ga0495651_0122292_308_1249 | 295 |
| 255 | 3300046463 | Ga0495653_0070250 | Ga0495653_0070250_1514_2455 | 295 |
| 256 | 3300046472 | Ga0495580_0077545 | Ga0495580_0077545_154_1095 | 295 |
| 257 | 3300046472 | Ga0495580_0124340 | Ga0495580_0124340_706_1674 | 295 |
| 258 | 3300046514 | Ga0495618_0114376 | Ga0495618_0114376_702_1643 | 295 |
| 259 | 3300046516 | Ga0495628_0000277 | Ga0495628_0000277_19868_20812 | 295 |
| 260 | 3300046516 | Ga0495628_0002586 | Ga0495628_0002586_13484_14428 | 295 |
| 261 | 3300046516 | Ga0495628_0316374 | Ga0495628_0316374_195_1136 | 295 |
| 262 | 3300046517 | Ga0495630_0039576 | Ga0495630_0039576_1120_2061 | 295 |
| 263 | 3300046529 | Ga0495652_0001564 | Ga0495652_0001564_13883_14827 | 295 |
| 264 | 3300046529 | Ga0495652_0228768 | Ga0495652_0228768_63_1007 | 295 |
| 265 | 3300046531 | Ga0495665_0087166 | Ga0495665_0087166_373_1314 | 295 |
| 266 | 3300046533 | Ga0495640_0031252 | Ga0495640_0031252_85_1026 | 295 |
| 267 | 3300046539 | Ga0495621_0026851 | Ga0495621_0026851_73_1032 | 295 |
| 268 | 3300046543 | Ga0495645_0000603 | Ga0495645_0000603_14093_15037 | 295 |
| 269 | 3300046559 | Ga0495667_0057132 | Ga0495667_0057132_634_1575 | 295 |
| 270 | 3300046663 | Ga0495635_0237449 | Ga0495635_0237449_60_1001 | 295 |
| 271 | 3300046675 | Ga0495657_0213728 | Ga0495657_0213728_67_1008 | 295 |
| 272 | 3300046678 | Ga0495599_0106490 | Ga0495599_0106490_55_999 | 295 |
| 273 | 3300046683 | Ga0495658_0011617 | Ga0495658_0011617_2266_3207 | 295 |
| 274 | 3300046683 | Ga0495658_0055346 | Ga0495658_0055346_520_1479 | 295 |
| 275 | 3300046689 | Ga0495613_0050915 | Ga0495613_0050915_1137_2099 | 295 |
| 276 | 3300046690 | Ga0495624_0080244 | Ga0495624_0080244_894_1835 | 295 |
| 277 | 3300046809 | Ga0495600_0014499 | Ga0495600_0014499_3231_4172 | 295 |
| 278 | 3300047319 | Ga0495674_0127324 | Ga0495674_0127324_676_1617 | 295 |
| 279 | 3300048907 | Ga0496104_0047314 | Ga0496104_0047314_2631_3575 | 295 |
| 280 | 3300048908 | Ga0496105_0080224 | Ga0496105_0080224_739_1683 | 295 |
| 281 | 3300049581 | Ga0501047_0001536 | Ga0501047_0001536_3771_4712 | 295 |
| 282 | 3300049584 | Ga0501068_0181327 | Ga0501068_0181327_162_1103 | 295 |
| 283 | 3300049585 | Ga0501069_0004850 | Ga0501069_0004850_4435_5376 | 295 |
| 284 | 3300049586 | Ga0501070_0007516 | Ga0501070_0007516_3641_4582 | 295 |
| 285 | 3300049586 | Ga0501070_0009848 | Ga0501070_0009848_263_1234 | 295 |
| 286 | 3300049588 | Ga0501072_0109681 | Ga0501072_0109681_225_1166 | 295 |
| 287 | 3300049589 | Ga0501073_0000778 | Ga0501073_0000778_16707_17648 | 295 |
| 288 | 3300049590 | Ga0501074_0006250 | Ga0501074_0006250_335_1306 | 295 |
| 289 | 3300049590 | Ga0501074_0019509 | Ga0501074_0019509_1301_2242 | 295 |
| 290 | 3300049741 | Ga0501079_0004640 | Ga0501079_0004640_7447_8388 | 295 |
| 291 | 3300049742 | Ga0501080_0022290 | Ga0501080_0022290_1155_2096 | 295 |
| 292 | 3300049744 | Ga0501083_0000259 | Ga0501083_0000259_21872_22813 | 295 |
| 293 | 3300049823 | Ga0501044_0074441 | Ga0501044_0074441_1409_2350 | 295 |
| 294 | 3300050514 | nmdc:mga08x19_2801_c1 | nmdc:mga08x19_2801_c1_7514_8476 | 295 |
| 295 | 3300053077 | Ga0495601_0003518 | Ga0495601_0003518_8013_8957 | 295 |
| 296 | 3300053077 | Ga0495601_0008392 | Ga0495601_0008392_2504_3448 | 295 |
| 297 | 3300053078 | Ga0495612_0066263 | Ga0495612_0066263_164_1105 | 295 |
| 298 | 3300053085 | Ga0495619_0080629 | Ga0495619_0080629_1050_2012 | 295 |
| 299 | 3300060353 | Ga0501082_0294744 | Ga0501082_0294744_440_1381 | 295 |
| 300 | 3300005295 | Ga0065707_10095302 | Ga0065707_100953025 | 300 |
| 301 | 3300005345 | Ga0070692_10248632 | Ga0070692_102486321 | 300 |
| 302 | 3300005353 | Ga0070669_100079600 | Ga0070669_1000796002 | 300 |
| 303 | 3300005441 | Ga0070700_100069671 | Ga0070700_1000696712 | 300 |
| 304 | 3300005719 | Ga0068861_100031457 | Ga0068861_1000314572 | 300 |
| 305 | 3300009553 | Ga0105249_10405698 | Ga0105249_104056982 | 300 |
| 306 | 3300025935 | Ga0207709_10014703 | Ga0207709_100147031 | 300 |
| 307 | 3300026075 | Ga0207708_10087811 | Ga0207708_100878113 | 300 |
| 308 | 3300026089 | Ga0207648_10004320 | Ga0207648_100043205 | 300 |
| 309 | 3300026118 | Ga0207675_100039345 | Ga0207675_1000393453 | 300 |
| 310 | 3300028380 | Ga0268265_10152741 | Ga0268265_101527413 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1saw-assembly1.cif.gz_A | x-ray structure of homo sapiens protein flj36880 | 0.9001 | 75 | 300 |
| 6sbj-assembly2.cif.gz_C | x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed | 0.8992 | 75 | 300 |
| 6sbi-assembly2.cif.gz_C | x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate | 0.8959 | 75 | 300 |
| 1wzo-assembly1.cif.gz_A | crystal structure of the hpce from thermus thermophilus hb8 | 0.8952 | 1 | 300 |
| 6fog-assembly4.cif.gz_D | x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. | 0.8943 | 77 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q96GK7_51_314_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8995 | 25 | 298 | 3.90.850.10 |
| af_A0A0R4IWE1_56_289_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8956 | 48 | 298 | 3.90.850.10 |
| af_Q2FZT4_90_300_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8906 | 70 | 298 | 3.90.850.10 |
| af_Q96GK7_51_314_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8899 | 25 | 298 | 3.90.850.10 |
| af_Q9VDE2_1_220_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.8894 | 75 | 300 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537B5T8-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9408 | 106 | 300 |
GO:0016787
GO:0044281 |
| AF-A0A7C3G8Z4-F1-model_v4 | FAA hydrolase family protein | 0.9259 | 1 | 298 |
GO:0016787
GO:0044281 |
| AF-A0A4Q5VS26-F1-model_v4 | deleted | 0.9255 | 84 | 300 |
|
| AF-A0A7C3G8Z4-F1-model_v4 | FAA hydrolase family protein | 0.9227 | 1 | 298 |
GO:0016787
GO:0044281 |
| AF-A0A5C6TWB1-F1-model_v4 | Fumarylacetoacetate hydrolase family protein | 0.9197 | 1 | 300 |
GO:0016787
GO:0044281 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar