F400724

General Info

Members Datasets Scaffolds Average Seq Length
310 204 308 309

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10081836|Ga0157370_100818364
Length 326
Sequence LRVPFCGESGDDVVFMRLITYASGPSLAPRIGVRVGHRVLDIENGSRIDGEPLPNSMKGLLREGRGALSRVQALVRKAQSGAGRFGAAMLEERAIRFLPPVPDPDKFLCVGKNYRAHLEELKKNDLIKEMPEEVTGFVKLNSCLVGHDAKVAIPAAVKHLDYEPELVFVIGRRALGVKGEDAMEYAVGVTILNDLTDRDMQKREVASGSRFWTSKNAPGFGPLGPEIVTMDEIDDPYDLWLTCSVNGEERMRVNTRDQIWKLPAILEHFSRTIPIEPGDMFSTGAPGGVAVGKPNAKDLFLKPGDVVECSIEGITTLRTLIVSPTQ

Samples

Sample ID Description Type Environment
1 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
2 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.61
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10095302 3300005295 Bacteria 3392
2 Ga0070658_10001621 3300005327 Bacteria 19019
3 Ga0070658_10065346 3300005327 Bacteria 2969
4 Ga0070690_100062059 3300005330 Bacteria 2410
5 Ga0070690_100182227 3300005330 Bacteria 1452
6 Ga0070670_100125487 3300005331 Bacteria 2215
7 Ga0070670_100206484 3300005331 Bacteria 1707
8 Ga0068869_100006459 3300005334 Bacteria 7440
9 Ga0070666_10007429 3300005335 Bacteria 6756
10 Ga0070689_100261996 3300005340 Bacteria 1429
11 Ga0070687_100008231 3300005343 Bacteria 4403
12 Ga0070687_100208907 3300005343 Bacteria 1188
13 Ga0070661_100090989 3300005344 Bacteria 2259
14 Ga0070692_10155528 3300005345 Bacteria 1306
15 Ga0070692_10248632 3300005345 Bacteria 1063
16 Ga0070669_100079600 3300005353 Bacteria 2437
17 Ga0070669_100121220 3300005353 Unclassified 1995
18 Ga0070675_100012086 3300005354 Bacteria 6767
19 Ga0070675_100024991 3300005354 Bacteria 4787
20 Ga0070675_100058394 3300005354 Bacteria 3182
21 Ga0070675_100340385 3300005354 Bacteria 1328
22 Ga0070674_100006443 3300005356 Bacteria 6850
23 Ga0070673_100046817 3300005364 Bacteria 3361
24 Ga0070673_100094900 3300005364 Bacteria 2446
25 Ga0070688_100002512 3300005365 Bacteria 9275
26 Ga0070659_100028198 3300005366 Bacteria 4334
27 Ga0070667_100008560 3300005367 Bacteria 8479
28 Ga0070667_100166504 3300005367 Bacteria 1944
29 Ga0070713_100421954 3300005436 Bacteria 1249
30 Ga0070711_100266559 3300005439 Bacteria 1350
31 Ga0070700_100023382 3300005441 Bacteria 3613
32 Ga0070700_100069671 3300005441 Bacteria 2240
33 Ga0070663_100100776 3300005455 Bacteria 2155
34 Ga0070678_100102035 3300005456 Bacteria 2225
35 Ga0070678_100105285 3300005456 Bacteria 2195
36 Ga0070662_100036011 3300005457 Bacteria 3498
37 Ga0070681_10176885 3300005458 Bacteria 2056
38 Ga0068867_100032160 3300005459 Bacteria 3792
39 Ga0070685_10218713 3300005466 Bacteria 1247
40 Ga0070698_100478668 3300005471 Bacteria 1182
41 Ga0070699_100109110 3300005518 Bacteria 2429
42 Ga0070699_100143175 3300005518 Bacteria 2112
43 Ga0070679_100024406 3300005530 Bacteria 5924
44 Ga0070697_100018941 3300005536 Bacteria 5431
45 Ga0070672_100047870 3300005543 Bacteria 3319
46 Ga0070672_100099453 3300005543 Bacteria 2357
47 Ga0070704_100024399 3300005549 Bacteria 3968
48 Ga0068855_100016737 3300005563 Bacteria 8818
49 Ga0068855_100034018 3300005563 Bacteria 6079
50 Ga0068855_100209951 3300005563 Bacteria 2188
51 Ga0068855_100401544 3300005563 Bacteria 1502
52 Ga0068857_100064214 3300005577 Bacteria 3264
53 Ga0068854_100143265 3300005578 Bacteria 1836
54 Ga0068852_100001192 3300005616 Bacteria 17243
55 Ga0068852_100014793 3300005616 Bacteria 6024
56 Ga0068852_100044025 3300005616 Bacteria 3788
57 Ga0068859_100005588 3300005617 Bacteria 12807
58 Ga0068866_10001401 3300005718 Bacteria 10379
59 Ga0068861_100028310 3300005719 Bacteria 4087
60 Ga0068861_100031457 3300005719 Bacteria 3899
61 Ga0068851_10000587 3300005834 Bacteria 15782
62 Ga0068851_10044043 3300005834 Bacteria 2251
63 Ga0068863_100003315 3300005841 Bacteria 15893
64 Ga0068863_100008170 3300005841 Bacteria 10221
65 Ga0068863_100022319 3300005841 Bacteria 6043
66 Ga0068863_100085559 3300005841 Bacteria 2988
67 Ga0068858_100021110 3300005842 Bacteria 6083
68 Ga0068858_100234528 3300005842 Bacteria 1740
69 Ga0068860_100000943 3300005843 Bacteria 32232
70 Ga0068860_100025434 3300005843 Bacteria 5711
71 Ga0081539_10046080 3300005985 Bacteria 2501
72 Ga0070716_100014162 3300006173 Bacteria 4082
73 Ga0097621_100011088 3300006237 Bacteria 6628
74 Ga0097621_100053970 3300006237 Bacteria 3276
75 Ga0068871_100011704 3300006358 Bacteria 6442
76 Ga0068871_100035278 3300006358 Bacteria 3972
77 Ga0068871_100244818 3300006358 Bacteria 1560
78 Ga0075428_100305772 3300006844 Bacteria 1709
79 Ga0075430_100157641 3300006846 Bacteria 1889
80 Ga0075430_100284298 3300006846 Bacteria 1368
81 Ga0075431_100113743 3300006847 Bacteria 2794
82 Ga0075429_100010286 3300006880 Bacteria 8096
83 Ga0068865_100003992 3300006881 Bacteria 8854
84 Ga0075436_100006861 3300006914 Bacteria 7788
85 Ga0097620_100005588 3300006931 Bacteria 12807
86 Ga0099794_10018055 3300007265 Bacteria 3157
87 Ga0105240_10065254 3300009093 Bacteria 4520
88 Ga0105240_10110137 3300009093 Bacteria 3333
89 Ga0111539_10295957 3300009094 Bacteria 1883
90 Ga0105245_10245868 3300009098 Bacteria 1736
91 Ga0105245_10465039 3300009098 Bacteria 1276
92 Ga0114129_10012711 3300009147 Bacteria 11983
93 Ga0105243_10007692 3300009148 Bacteria 8282
94 Ga0105242_10057452 3300009176 Bacteria 3187
95 Ga0105248_10000999 3300009177 Bacteria 31268
96 Ga0105248_10165913 3300009177 Bacteria 2490
97 Ga0105248_10211506 3300009177 Bacteria 2185
98 Ga0105238_10001013 3300009551 Bacteria 28671
99 Ga0105249_10405698 3300009553 Bacteria 1394
100 Ga0157370_10081836 3300013104 Bacteria 3038
101 Ga0157370_10130695 3300013104 Bacteria 2342
102 Ga0157370_10199859 3300013104 Bacteria 1854
103 Ga0157369_10001365 3300013105 Bacteria 30097
104 Ga0157374_10068075 3300013296 Bacteria 3349
105 Ga0157378_10750633 3300013297 Bacteria 999
106 Ga0163162_10217031 3300013306 Bacteria 2043
107 Ga0157372_10001111 3300013307 Bacteria 29223
108 Ga0157372_10094461 3300013307 Bacteria 3405
109 Ga0157372_10131295 3300013307 Bacteria 2882
110 Ga0157375_10018138 3300013308 Bacteria 6377
111 Ga0157375_10067716 3300013308 Bacteria 3568
112 Ga0157375_10400834 3300013308 Bacteria 1538
113 Ga0157380_10008057 3300014326 Bacteria 7507
114 Ga0157380_10042615 3300014326 Bacteria 3548
115 Ga0157380_10076349 3300014326 Bacteria 2727
116 Ga0183362_10006 3300015683 Bacteria 287231
117 Ga0207656_10001841 3300025321 Bacteria 7045
118 Ga0207656_10035463 3300025321 Bacteria 2089
119 Ga0207642_10003046 3300025899 Bacteria 5250
120 Ga0207688_10020739 3300025901 Bacteria 3588
121 Ga0207680_10010472 3300025903 Bacteria 4639
122 Ga0207645_10056151 3300025907 Bacteria 2514
123 Ga0207643_10008699 3300025908 Bacteria 5444
124 Ga0207705_10004382 3300025909 Bacteria 10668
125 Ga0207705_10168316 3300025909 Bacteria 1649
126 Ga0207707_10080970 3300025912 Bacteria 2835
127 Ga0207707_10156814 3300025912 Bacteria 1991
128 Ga0207695_10025942 3300025913 Bacteria 6549
129 Ga0207695_10078862 3300025913 Bacteria 3340
130 Ga0207662_10026718 3300025918 Bacteria 3331
131 Ga0207662_10075516 3300025918 Bacteria 2047
132 Ga0207662_10136455 3300025918 Bacteria 1551
133 Ga0207657_10185651 3300025919 Bacteria 1679
134 Ga0207681_10000823 3300025923 Bacteria 20454
135 Ga0207681_10105444 3300025923 Unclassified 2041
136 Ga0207694_10042199 3300025924 Bacteria 3518
137 Ga0207659_10009234 3300025926 Bacteria 6158
138 Ga0207644_10000586 3300025931 Bacteria 23293
139 Ga0207706_10021976 3300025933 Bacteria 5727
140 Ga0207706_10029538 3300025933 Bacteria 4893
141 Ga0207709_10014703 3300025935 Bacteria 4326
142 Ga0207669_10004595 3300025937 Bacteria 6091
143 Ga0207704_10016933 3300025938 Bacteria 3763
144 Ga0207665_10003906 3300025939 Bacteria 9975
145 Ga0207691_10024246 3300025940 Bacteria 5706
146 Ga0207691_10120350 3300025940 Bacteria 2327
147 Ga0207691_10148681 3300025940 Bacteria 2061
148 Ga0207711_10037929 3300025941 Bacteria 4096
149 Ga0207689_10005490 3300025942 Bacteria 11344
150 Ga0207689_10172306 3300025942 Bacteria 1784
151 Ga0207679_10288832 3300025945 Bacteria 1409
152 Ga0207667_10264803 3300025949 Bacteria 1758
153 Ga0207667_10269916 3300025949 Bacteria 1739
154 Ga0207667_10349178 3300025949 Bacteria 1509
155 Ga0207651_10137578 3300025960 Bacteria 1881
156 Ga0207712_10009065 3300025961 Bacteria 6293
157 Ga0207668_10008446 3300025972 Bacteria 6137
158 Ga0207703_10004489 3300026035 Bacteria 11458
159 Ga0207678_10098417 3300026067 Bacteria 2499
160 Ga0207708_10023765 3300026075 Bacteria 4633
161 Ga0207708_10087811 3300026075 Bacteria 2395
162 Ga0207641_10009743 3300026088 Bacteria 7914
163 Ga0207641_10262790 3300026088 Bacteria 1617
164 Ga0207648_10004320 3300026089 Bacteria 14631
165 Ga0207648_10007947 3300026089 Bacteria 10346
166 Ga0207676_10029000 3300026095 Bacteria 4139
167 Ga0207676_10326883 3300026095 Bacteria 1410
168 Ga0207674_10248018 3300026116 Bacteria 1727
169 Ga0207675_100002298 3300026118 Bacteria 18983
170 Ga0207675_100039345 3300026118 Bacteria 4413
171 Ga0207683_10254100 3300026121 Bacteria 1604
172 Ga0207698_10000307 3300026142 Bacteria 29443
173 Ga0207698_10037999 3300026142 Bacteria 3552
174 Ga0207698_10070862 3300026142 Bacteria 2763
175 Ga0207698_10126778 3300026142 Bacteria 2172
176 Ga0209588_1019512 3300027671 Bacteria 2117
177 Ga0268265_10113719 3300028380 Bacteria 2215
178 Ga0268265_10152741 3300028380 Bacteria 1949
179 Ga0268264_10001228 3300028381 Bacteria 24612
180 Ga0268264_10013510 3300028381 Bacteria 6724
181 Ga0307408_100219356 3300031548 Bacteria 1551
182 Ga0307408_100412944 3300031548 Bacteria 1162
183 Ga0307410_10127826 3300031852 Bacteria 1863
184 Ga0307412_10074929 3300031911 Bacteria 2320
185 Ga0307412_10262937 3300031911 Bacteria 1346
186 Ga0307412_10328442 3300031911 Bacteria 1220
187 Ga0307412_10346377 3300031911 Bacteria 1191
188 Ga0307409_100002795 3300031995 Bacteria 9224
189 Ga0307409_100365095 3300031995 Bacteria 1367
190 Ga0307416_100135390 3300032002 Bacteria 2227
191 Ga0307411_10417206 3300032005 Bacteria 1114
192 Ga0307415_100052750 3300032126 Bacteria 2767
193 Ga0307415_100179770 3300032126 Bacteria 1659
194 Ga0373934_0006261 3300035086 Bacteria 4411
195 Ga0373934_0032818 3300035086 Bacteria 2037
196 Ga0373923_0051585 3300035111 Bacteria 1726
197 Ga0373954_0000275 3300035118 Bacteria 18758
198 Ga0373954_0011793 3300035118 Bacteria 3879
199 Ga0373956_0011601 3300035119 Bacteria 3632
200 Ga0373957_0047272 3300035120 Bacteria 1636
201 Ga0373960_0038517 3300035121 Bacteria 1371
202 Ga0373943_0202235 3300035170 Unclassified 1100
203 Ga0373943_0247500 3300035170 Bacteria 1000
204 Ga0373946_0018642 3300035171 Bacteria 2667
205 Ga0373955_0011840 3300035172 Bacteria 4174
206 Ga0373955_0052935 3300035172 Bacteria 2215
207 Ga0373942_0001205 3300035207 Bacteria 6822
208 Ga0373924_0004192 3300035410 Bacteria 5022
209 Ga0373924_0009906 3300035410 Bacteria 3505
210 Ga0373935_0018116 3300035692 Bacteria 4280
211 Ga0373933_0001890 3300035724 Bacteria 12080
212 Ga0373937_0019578 3300036401 Bacteria 6058
213 Ga0373937_0032062 3300036401 Bacteria 4764
214 Ga0373937_0041276 3300036401 Bacteria 4208
215 Ga0373937_0047482 3300036401 Bacteria 3928
216 Ga0373925_0017633 3300037068 Bacteria 5180
217 Ga0373925_0128906 3300037068 Bacteria 1971
218 Ga0395899_0001183 3300037312 Bacteria 23006
219 Ga0395899_0001844 3300037312 Bacteria 17542
220 Ga0395900_0021359 3300037418 Bacteria 6618
221 Ga0395900_0086708 3300037418 Bacteria 3217
222 Ga0395898_0003427 3300037466 Bacteria 17759
223 Ga0395898_0007015 3300037466 Bacteria 11971
224 Ga0395905_0000345 3300037471 Bacteria 65974
225 Ga0395905_0015915 3300037471 Bacteria 7146
226 Ga0395905_0028050 3300037471 Bacteria 5308
227 Ga0395901_0011126 3300038443 Bacteria 9120
228 Ga0395901_0302714 3300038443 Bacteria 1657
229 Ga0451853_2788413 3300041512 Bacteria 1085
230 Ga0451577_0418599 3300042876 Bacteria 1216
231 Ga0453684_0030044 3300044712 Bacteria 7691
232 Ga0453684_0180747 3300044712 Bacteria 2476
233 Ga0453684_0522312 3300044712 Bacteria 1311
234 Ga0466957_0003426 3300044842 Bacteria 8707
235 Ga0466959_0164252 3300045049 Bacteria 1560
236 Ga0495592_0004252 3300046454 Bacteria 10458
237 Ga0495592_0189990 3300046454 Bacteria 1392
238 Ga0495641_0027076 3300046461 Bacteria 2791
239 Ga0495651_0122292 3300046462 Bacteria 1910
240 Ga0495651_0263947 3300046462 Unclassified 1170
241 Ga0495653_0070250 3300046463 Bacteria 2621
242 Ga0495580_0077545 3300046472 Bacteria 2317
243 Ga0495580_0124340 3300046472 Bacteria 1790
244 Ga0495585_0000166 3300046492 Bacteria 71084
245 Ga0495618_0114376 3300046514 Bacteria 1727
246 Ga0495628_0000277 3300046516 Bacteria 45973
247 Ga0495628_0002586 3300046516 Bacteria 16269
248 Ga0495628_0316374 3300046516 Bacteria 1152
249 Ga0495630_0039576 3300046517 Bacteria 3524
250 Ga0495652_0001564 3300046529 Bacteria 25037
251 Ga0495652_0228768 3300046529 Bacteria 1392
252 Ga0495665_0087166 3300046531 Bacteria 1640
253 Ga0495640_0031252 3300046533 Bacteria 3801
254 Ga0495621_0026851 3300046539 Bacteria 1946
255 Ga0495645_0000603 3300046543 Bacteria 24774
256 Ga0495667_0057132 3300046559 Bacteria 2566
257 Ga0495635_0237449 3300046663 Bacteria 1230
258 Ga0495635_0347366 3300046663 Unclassified 990
259 Ga0495657_0213728 3300046675 Bacteria 1171
260 Ga0495599_0106490 3300046678 Bacteria 1747
261 Ga0495646_0176975 3300046680 Bacteria 1173
262 Ga0495658_0011617 3300046683 Bacteria 4435
263 Ga0495658_0055346 3300046683 Bacteria 2260
264 Ga0495613_0050915 3300046689 Bacteria 3054
265 Ga0495624_0080244 3300046690 Bacteria 2022
266 Ga0495600_0014499 3300046809 Bacteria 4967
267 Ga0495674_0127324 3300047319 Bacteria 2147
268 Ga0495680_0055952 3300047322 Bacteria 3057
269 Ga0496104_0047314 3300048907 Bacteria 4054
270 Ga0496105_0080224 3300048908 Bacteria 2695
271 Ga0496106_0428607 3300048909 Unclassified 1063
272 Ga0496109_0365174 3300048912 Bacteria 1364
273 Ga0496114_0042922 3300048917 Bacteria 3749
274 Ga0501034_0064295 3300049571 Bacteria 3683
275 Ga0501039_0053978 3300049575 Bacteria 3111
276 Ga0501040_0199824 3300049576 Bacteria 1419
277 Ga0501041_0150273 3300049577 Bacteria 1454
278 Ga0501047_0001536 3300049581 Bacteria 22571
279 Ga0501068_0181327 3300049584 Bacteria 1331
280 Ga0501069_0004850 3300049585 Bacteria 6966
281 Ga0501070_0007516 3300049586 Bacteria 9259
282 Ga0501070_0009848 3300049586 Bacteria 8081
283 Ga0501070_0119434 3300049586 Bacteria 2179
284 Ga0501071_0102199 3300049587 Bacteria 2114
285 Ga0501072_0021852 3300049588 Bacteria 4963
286 Ga0501072_0109681 3300049588 Bacteria 2197
287 Ga0501073_0000778 3300049589 Bacteria 22693
288 Ga0501074_0006250 3300049590 Bacteria 8603
289 Ga0501074_0019509 3300049590 Bacteria 4923
290 Ga0501079_0004640 3300049741 Bacteria 10176
291 Ga0501080_0022290 3300049742 Bacteria 5866
292 Ga0501080_0197894 3300049742 Bacteria 1845
293 Ga0501080_0211810 3300049742 Bacteria 1776
294 Ga0501083_0000259 3300049744 Bacteria 33650
295 Ga0501044_0074441 3300049823 Bacteria 3450
296 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
297 nmdc:mga09592_4260_c1 3300050508 Bacteria 11553
298 nmdc:mga0qj67_83736_c1 3300050509 Bacteria 2557
299 nmdc:mga08y16_130288_c1 3300050511 Bacteria 2616
300 nmdc:mga08x19_2801_c1 3300050514 Bacteria 10514
301 nmdc:mga0a205_218455_c1 3300050515 Bacteria 1792
302 Ga0495601_0003518 3300053077 Bacteria 9000
303 Ga0495601_0008392 3300053077 Bacteria 6101
304 Ga0495601_0447349 3300053077 Archaea 836
305 Ga0495612_0066263 3300053078 Bacteria 1501
306 Ga0495619_0080629 3300053085 Bacteria 2190
307 Ga0495619_0270880 3300053085 Bacteria 1177
308 Ga0501082_0294744 3300060353 Bacteria 1412

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005365 Ga0070688_100002512 Ga0070688_1000025123 249
2 3300046663 Ga0495635_0347366 Ga0495635_0347366_176_973 259
3 3300013297 Ga0157378_10750633 Ga0157378_107506332 260
4 3300046680 Ga0495646_0176975 Ga0495646_0176975_36_851 260
5 3300048912 Ga0496109_0365174 Ga0496109_0365174_316_1137 260
6 3300049571 Ga0501034_0064295 Ga0501034_0064295_2854_3666 260
7 3300049742 Ga0501080_0211810 Ga0501080_0211810_25_858 260
8 3300053085 Ga0495619_0270880 Ga0495619_0270880_11_817 260
9 3300005471 Ga0070698_100478668 Ga0070698_1004786681 263
10 3300053077 Ga0495601_0447349 Ga0495601_0447349_18_815 265
11 3300007265 Ga0099794_10018055 Ga0099794_100180553 266
12 3300009147 Ga0114129_10012711 Ga0114129_1001271112 272
13 3300046492 Ga0495585_0000166 Ga0495585_0000166_5162_6043 272
14 3300050507 nmdc:mga05p37_355_c1 nmdc:mga05p37_355_c1_8251_9084 272
15 3300050508 nmdc:mga09592_4260_c1 nmdc:mga09592_4260_c1_1018_1851 272
16 3300050515 nmdc:mga0a205_218455_c1 nmdc:mga0a205_218455_c1_87_920 272
17 3300014326 Ga0157380_10042615 Ga0157380_100426153 276
18 3300049742 Ga0501080_0197894 Ga0501080_0197894_42_929 276
19 3300013105 Ga0157369_10001365 Ga0157369_1000136521 278
20 3300031911 Ga0307412_10074929 Ga0307412_100749292 279
21 3300036401 Ga0373937_0019578 Ga0373937_0019578_3522_4364 280
22 3300005439 Ga0070711_100266559 Ga0070711_1002665591 282
23 3300035172 Ga0373955_0052935 Ga0373955_0052935_945_1793 282
24 3300035410 Ga0373924_0004192 Ga0373924_0004192_1721_2569 282
25 3300035724 Ga0373933_0001890 Ga0373933_0001890_2297_3145 282
26 3300036401 Ga0373937_0047482 Ga0373937_0047482_2802_3650 282
27 3300042876 Ga0451577_0418599 Ga0451577_0418599_217_1131 282
28 3300044712 Ga0453684_0180747 Ga0453684_0180747_1108_2022 282
29 3300044712 Ga0453684_0522312 Ga0453684_0522312_200_1117 282
30 3300047322 Ga0495680_0055952 Ga0495680_0055952_564_1412 282
31 3300035170 Ga0373943_0202235 Ga0373943_0202235_165_1025 283
32 3300005436 Ga0070713_100421954 Ga0070713_1004219542 285
33 3300005985 Ga0081539_10046080 Ga0081539_100460804 285
34 3300005518 Ga0070699_100109110 Ga0070699_1001091103 287
35 3300006847 Ga0075431_100113743 Ga0075431_1001137432 287
36 3300006880 Ga0075429_100010286 Ga0075429_1000102865 287
37 3300015683 Ga0183362_10006 Ga0183362_10006216 288
38 3300031911 Ga0307412_10328442 Ga0307412_103284422 288
39 3300031911 Ga0307412_10346377 Ga0307412_103463772 288
40 3300032005 Ga0307411_10417206 Ga0307411_104172061 288
41 3300037312 Ga0395899_0001183 Ga0395899_0001183_2955_3851 288
42 3300037418 Ga0395900_0086708 Ga0395900_0086708_1921_2817 288
43 3300037466 Ga0395898_0003427 Ga0395898_0003427_3683_4579 288
44 3300037471 Ga0395905_0000345 Ga0395905_0000345_32291_33199 288
45 3300037471 Ga0395905_0015915 Ga0395905_0015915_2088_2984 288
46 3300038443 Ga0395901_0011126 Ga0395901_0011126_2706_3602 288
47 3300005353 Ga0070669_100121220 Ga0070669_1001212202 289
48 3300006914 Ga0075436_100006861 Ga0075436_1000068613 289
49 3300009177 Ga0105248_10165913 Ga0105248_101659133 289
50 3300013308 Ga0157375_10400834 Ga0157375_104008342 289
51 3300025907 Ga0207645_10056151 Ga0207645_100561511 289
52 3300025923 Ga0207681_10105444 Ga0207681_101054442 289
53 3300035207 Ga0373942_0001205 Ga0373942_0001205_4471_5340 289
54 3300049575 Ga0501039_0053978 Ga0501039_0053978_1602_2501 289
55 3300049576 Ga0501040_0199824 Ga0501040_0199824_484_1383 289
56 3300049577 Ga0501041_0150273 Ga0501041_0150273_210_1109 289
57 3300049587 Ga0501071_0102199 Ga0501071_0102199_1159_2058 289
58 3300049588 Ga0501072_0021852 Ga0501072_0021852_2127_3026 289
59 3300005456 Ga0070678_100105285 Ga0070678_1001052852 291
60 3300048917 Ga0496114_0042922 Ga0496114_0042922_2202_3164 291
61 iso_pu_bacteria 2881412998 2881416510 291
62 iso_pu_bacteria 2887375801 2887377040 291
63 3300048909 Ga0496106_0428607 Ga0496106_0428607_22_927 292
64 3300005330 Ga0070690_100182227 Ga0070690_1001822271 293
65 3300005343 Ga0070687_100208907 Ga0070687_1002089072 293
66 3300005466 Ga0070685_10218713 Ga0070685_102187132 293
67 3300006358 Ga0068871_100035278 Ga0068871_1000352783 293
68 3300006846 Ga0075430_100157641 Ga0075430_1001576411 293
69 3300006846 Ga0075430_100284298 Ga0075430_1002842982 293
70 3300014326 Ga0157380_10076349 Ga0157380_100763493 293
71 3300025918 Ga0207662_10075516 Ga0207662_100755162 293
72 3300026095 Ga0207676_10326883 Ga0207676_103268832 293
73 3300035121 Ga0373960_0038517 Ga0373960_0038517_448_1347 293
74 3300037068 Ga0373925_0017633 Ga0373925_0017633_3569_4531 293
75 3300037312 Ga0395899_0001844 Ga0395899_0001844_7727_8644 293
76 3300037466 Ga0395898_0007015 Ga0395898_0007015_172_1089 293
77 3300037471 Ga0395905_0028050 Ga0395905_0028050_112_1029 293
78 3300038443 Ga0395901_0302714 Ga0395901_0302714_393_1310 293
79 3300050509 nmdc:mga0qj67_83736_c1 nmdc:mga0qj67_83736_c1_163_1044 293
80 3300050511 nmdc:mga08y16_130288_c1 nmdc:mga08y16_130288_c1_577_1458 293
81 3300005354 Ga0070675_100012086 Ga0070675_1000120861 294
82 3300005577 Ga0068857_100064214 Ga0068857_1000642143 294
83 3300009098 Ga0105245_10245868 Ga0105245_102458682 294
84 3300009098 Ga0105245_10465039 Ga0105245_104650392 294
85 3300025940 Ga0207691_10148681 Ga0207691_101486812 294
86 3300025942 Ga0207689_10172306 Ga0207689_101723061 294
87 3300026116 Ga0207674_10248018 Ga0207674_102480183 294
88 3300026121 Ga0207683_10254100 Ga0207683_102541002 294
89 3300041512 Ga0451853_2788413 Ga0451853_2788413_144_1073 294
90 3300044712 Ga0453684_0030044 Ga0453684_0030044_5784_6755 294
91 3300046462 Ga0495651_0263947 Ga0495651_0263947_194_1135 294
92 3300049586 Ga0501070_0119434 Ga0501070_0119434_400_1365 294
93 3300005327 Ga0070658_10001621 Ga0070658_1000162112 295
94 3300005327 Ga0070658_10065346 Ga0070658_100653463 295
95 3300005330 Ga0070690_100062059 Ga0070690_1000620592 295
96 3300005331 Ga0070670_100125487 Ga0070670_1001254872 295
97 3300005331 Ga0070670_100206484 Ga0070670_1002064841 295
98 3300005334 Ga0068869_100006459 Ga0068869_1000064595 295
99 3300005335 Ga0070666_10007429 Ga0070666_100074293 295
100 3300005340 Ga0070689_100261996 Ga0070689_1002619962 295
101 3300005343 Ga0070687_100008231 Ga0070687_1000082314 295
102 3300005344 Ga0070661_100090989 Ga0070661_1000909892 295
103 3300005345 Ga0070692_10155528 Ga0070692_101555281 295
104 3300005354 Ga0070675_100024991 Ga0070675_1000249913 295
105 3300005354 Ga0070675_100058394 Ga0070675_1000583943 295
106 3300005354 Ga0070675_100340385 Ga0070675_1003403851 295
107 3300005356 Ga0070674_100006443 Ga0070674_1000064435 295
108 3300005364 Ga0070673_100046817 Ga0070673_1000468172 295
109 3300005364 Ga0070673_100094900 Ga0070673_1000949002 295
110 3300005366 Ga0070659_100028198 Ga0070659_1000281984 295
111 3300005367 Ga0070667_100008560 Ga0070667_1000085606 295
112 3300005367 Ga0070667_100166504 Ga0070667_1001665042 295
113 3300005441 Ga0070700_100023382 Ga0070700_1000233823 295
114 3300005455 Ga0070663_100100776 Ga0070663_1001007763 295
115 3300005456 Ga0070678_100102035 Ga0070678_1001020352 295
116 3300005457 Ga0070662_100036011 Ga0070662_1000360113 295
117 3300005458 Ga0070681_10176885 Ga0070681_101768854 295
118 3300005459 Ga0068867_100032160 Ga0068867_1000321603 295
119 3300005518 Ga0070699_100143175 Ga0070699_1001431753 295
120 3300005530 Ga0070679_100024406 Ga0070679_1000244063 295
121 3300005536 Ga0070697_100018941 Ga0070697_1000189415 295
122 3300005543 Ga0070672_100047870 Ga0070672_1000478704 295
123 3300005543 Ga0070672_100099453 Ga0070672_1000994532 295
124 3300005549 Ga0070704_100024399 Ga0070704_1000243992 295
125 3300005563 Ga0068855_100016737 Ga0068855_1000167373 295
126 3300005563 Ga0068855_100034018 Ga0068855_1000340184 295
127 3300005563 Ga0068855_100209951 Ga0068855_1002099512 295
128 3300005563 Ga0068855_100401544 Ga0068855_1004015442 295
129 3300005578 Ga0068854_100143265 Ga0068854_1001432653 295
130 3300005616 Ga0068852_100001192 Ga0068852_10000119215 295
131 3300005616 Ga0068852_100014793 Ga0068852_1000147932 295
132 3300005616 Ga0068852_100044025 Ga0068852_1000440253 295
133 3300005617 Ga0068859_100005588 Ga0068859_1000055885 295
134 3300005718 Ga0068866_10001401 Ga0068866_100014016 295
135 3300005719 Ga0068861_100028310 Ga0068861_1000283104 295
136 3300005834 Ga0068851_10000587 Ga0068851_1000058715 295
137 3300005834 Ga0068851_10044043 Ga0068851_100440431 295
138 3300005841 Ga0068863_100003315 Ga0068863_1000033153 295
139 3300005841 Ga0068863_100008170 Ga0068863_1000081709 295
140 3300005841 Ga0068863_100022319 Ga0068863_10002231910 295
141 3300005841 Ga0068863_100085559 Ga0068863_1000855594 295
142 3300005842 Ga0068858_100021110 Ga0068858_1000211104 295
143 3300005842 Ga0068858_100234528 Ga0068858_1002345282 295
144 3300005843 Ga0068860_100000943 Ga0068860_10000094320 295
145 3300005843 Ga0068860_100025434 Ga0068860_1000254344 295
146 3300006173 Ga0070716_100014162 Ga0070716_1000141623 295
147 3300006237 Ga0097621_100011088 Ga0097621_1000110883 295
148 3300006237 Ga0097621_100053970 Ga0097621_1000539702 295
149 3300006358 Ga0068871_100011704 Ga0068871_1000117042 295
150 3300006358 Ga0068871_100244818 Ga0068871_1002448182 295
151 3300006844 Ga0075428_100305772 Ga0075428_1003057722 295
152 3300006881 Ga0068865_100003992 Ga0068865_1000039926 295
153 3300006931 Ga0097620_100005588 Ga0097620_1000055889 295
154 3300009093 Ga0105240_10065254 Ga0105240_100652542 295
155 3300009093 Ga0105240_10110137 Ga0105240_101101372 295
156 3300009094 Ga0111539_10295957 Ga0111539_102959572 295
157 3300009148 Ga0105243_10007692 Ga0105243_100076924 295
158 3300009176 Ga0105242_10057452 Ga0105242_100574526 295
159 3300009177 Ga0105248_10000999 Ga0105248_1000099910 295
160 3300009177 Ga0105248_10211506 Ga0105248_102115062 295
161 3300009551 Ga0105238_10001013 Ga0105238_1000101321 295
162 3300013104 Ga0157370_10081836 Ga0157370_100818364 295
163 3300013104 Ga0157370_10130695 Ga0157370_101306953 295
164 3300013104 Ga0157370_10199859 Ga0157370_101998592 295
165 3300013296 Ga0157374_10068075 Ga0157374_100680755 295
166 3300013306 Ga0163162_10217031 Ga0163162_102170312 295
167 3300013307 Ga0157372_10001111 Ga0157372_100011115 295
168 3300013307 Ga0157372_10094461 Ga0157372_100944613 295
169 3300013307 Ga0157372_10131295 Ga0157372_101312953 295
170 3300013308 Ga0157375_10018138 Ga0157375_100181388 295
171 3300013308 Ga0157375_10067716 Ga0157375_100677163 295
172 3300014326 Ga0157380_10008057 Ga0157380_100080573 295
173 3300025321 Ga0207656_10001841 Ga0207656_100018412 295
174 3300025321 Ga0207656_10035463 Ga0207656_100354632 295
175 3300025899 Ga0207642_10003046 Ga0207642_100030466 295
176 3300025901 Ga0207688_10020739 Ga0207688_100207392 295
177 3300025903 Ga0207680_10010472 Ga0207680_100104725 295
178 3300025908 Ga0207643_10008699 Ga0207643_100086995 295
179 3300025909 Ga0207705_10004382 Ga0207705_100043823 295
180 3300025909 Ga0207705_10168316 Ga0207705_101683162 295
181 3300025912 Ga0207707_10080970 Ga0207707_100809702 295
182 3300025912 Ga0207707_10156814 Ga0207707_101568142 295
183 3300025913 Ga0207695_10025942 Ga0207695_1002594210 295
184 3300025913 Ga0207695_10078862 Ga0207695_100788625 295
185 3300025918 Ga0207662_10026718 Ga0207662_100267183 295
186 3300025918 Ga0207662_10136455 Ga0207662_101364553 295
187 3300025919 Ga0207657_10185651 Ga0207657_101856512 295
188 3300025923 Ga0207681_10000823 Ga0207681_1000082313 295
189 3300025924 Ga0207694_10042199 Ga0207694_100421992 295
190 3300025926 Ga0207659_10009234 Ga0207659_100092343 295
191 3300025931 Ga0207644_10000586 Ga0207644_1000058616 295
192 3300025933 Ga0207706_10021976 Ga0207706_100219765 295
193 3300025933 Ga0207706_10029538 Ga0207706_100295383 295
194 3300025937 Ga0207669_10004595 Ga0207669_100045955 295
195 3300025938 Ga0207704_10016933 Ga0207704_100169333 295
196 3300025939 Ga0207665_10003906 Ga0207665_100039067 295
197 3300025940 Ga0207691_10024246 Ga0207691_100242465 295
198 3300025940 Ga0207691_10120350 Ga0207691_101203502 295
199 3300025941 Ga0207711_10037929 Ga0207711_100379292 295
200 3300025942 Ga0207689_10005490 Ga0207689_1000549012 295
201 3300025945 Ga0207679_10288832 Ga0207679_102888322 295
202 3300025949 Ga0207667_10264803 Ga0207667_102648033 295
203 3300025949 Ga0207667_10269916 Ga0207667_102699162 295
204 3300025949 Ga0207667_10349178 Ga0207667_103491782 295
205 3300025960 Ga0207651_10137578 Ga0207651_101375782 295
206 3300025961 Ga0207712_10009065 Ga0207712_100090655 295
207 3300025972 Ga0207668_10008446 Ga0207668_100084462 295
208 3300026035 Ga0207703_10004489 Ga0207703_100044898 295
209 3300026067 Ga0207678_10098417 Ga0207678_100984171 295
210 3300026075 Ga0207708_10023765 Ga0207708_100237654 295
211 3300026088 Ga0207641_10009743 Ga0207641_100097436 295
212 3300026088 Ga0207641_10262790 Ga0207641_102627902 295
213 3300026089 Ga0207648_10007947 Ga0207648_100079472 295
214 3300026095 Ga0207676_10029000 Ga0207676_100290003 295
215 3300026118 Ga0207675_100002298 Ga0207675_1000022983 295
216 3300026142 Ga0207698_10000307 Ga0207698_1000030724 295
217 3300026142 Ga0207698_10037999 Ga0207698_100379993 295
218 3300026142 Ga0207698_10070862 Ga0207698_100708622 295
219 3300026142 Ga0207698_10126778 Ga0207698_101267782 295
220 3300027671 Ga0209588_1019512 Ga0209588_10195122 295
221 3300028380 Ga0268265_10113719 Ga0268265_101137192 295
222 3300028381 Ga0268264_10001228 Ga0268264_100012286 295
223 3300028381 Ga0268264_10013510 Ga0268264_100135108 295
224 3300031548 Ga0307408_100219356 Ga0307408_1002193562 295
225 3300031548 Ga0307408_100412944 Ga0307408_1004129442 295
226 3300031852 Ga0307410_10127826 Ga0307410_101278262 295
227 3300031911 Ga0307412_10262937 Ga0307412_102629372 295
228 3300031995 Ga0307409_100002795 Ga0307409_1000027952 295
229 3300031995 Ga0307409_100365095 Ga0307409_1003650952 295
230 3300032002 Ga0307416_100135390 Ga0307416_1001353903 295
231 3300032126 Ga0307415_100052750 Ga0307415_1000527503 295
232 3300032126 Ga0307415_100179770 Ga0307415_1001797702 295
233 3300035086 Ga0373934_0006261 Ga0373934_0006261_1684_2628 295
234 3300035086 Ga0373934_0032818 Ga0373934_0032818_158_1099 295
235 3300035111 Ga0373923_0051585 Ga0373923_0051585_621_1562 295
236 3300035118 Ga0373954_0000275 Ga0373954_0000275_17757_18701 295
237 3300035118 Ga0373954_0011793 Ga0373954_0011793_693_1637 295
238 3300035119 Ga0373956_0011601 Ga0373956_0011601_67_1011 295
239 3300035120 Ga0373957_0047272 Ga0373957_0047272_381_1286 295
240 3300035170 Ga0373943_0247500 Ga0373943_0247500_11_973 295
241 3300035171 Ga0373946_0018642 Ga0373946_0018642_932_1873 295
242 3300035172 Ga0373955_0011840 Ga0373955_0011840_1233_2177 295
243 3300035410 Ga0373924_0009906 Ga0373924_0009906_486_1427 295
244 3300035692 Ga0373935_0018116 Ga0373935_0018116_2160_3101 295
245 3300036401 Ga0373937_0032062 Ga0373937_0032062_2279_3223 295
246 3300036401 Ga0373937_0041276 Ga0373937_0041276_2536_3498 295
247 3300037068 Ga0373925_0128906 Ga0373925_0128906_142_1086 295
248 3300037418 Ga0395900_0021359 Ga0395900_0021359_3777_4742 295
249 3300044842 Ga0466957_0003426 Ga0466957_0003426_4252_5184 295
250 3300045049 Ga0466959_0164252 Ga0466959_0164252_420_1352 295
251 3300046454 Ga0495592_0004252 Ga0495592_0004252_928_1872 295
252 3300046454 Ga0495592_0189990 Ga0495592_0189990_157_1101 295
253 3300046461 Ga0495641_0027076 Ga0495641_0027076_1112_2053 295
254 3300046462 Ga0495651_0122292 Ga0495651_0122292_308_1249 295
255 3300046463 Ga0495653_0070250 Ga0495653_0070250_1514_2455 295
256 3300046472 Ga0495580_0077545 Ga0495580_0077545_154_1095 295
257 3300046472 Ga0495580_0124340 Ga0495580_0124340_706_1674 295
258 3300046514 Ga0495618_0114376 Ga0495618_0114376_702_1643 295
259 3300046516 Ga0495628_0000277 Ga0495628_0000277_19868_20812 295
260 3300046516 Ga0495628_0002586 Ga0495628_0002586_13484_14428 295
261 3300046516 Ga0495628_0316374 Ga0495628_0316374_195_1136 295
262 3300046517 Ga0495630_0039576 Ga0495630_0039576_1120_2061 295
263 3300046529 Ga0495652_0001564 Ga0495652_0001564_13883_14827 295
264 3300046529 Ga0495652_0228768 Ga0495652_0228768_63_1007 295
265 3300046531 Ga0495665_0087166 Ga0495665_0087166_373_1314 295
266 3300046533 Ga0495640_0031252 Ga0495640_0031252_85_1026 295
267 3300046539 Ga0495621_0026851 Ga0495621_0026851_73_1032 295
268 3300046543 Ga0495645_0000603 Ga0495645_0000603_14093_15037 295
269 3300046559 Ga0495667_0057132 Ga0495667_0057132_634_1575 295
270 3300046663 Ga0495635_0237449 Ga0495635_0237449_60_1001 295
271 3300046675 Ga0495657_0213728 Ga0495657_0213728_67_1008 295
272 3300046678 Ga0495599_0106490 Ga0495599_0106490_55_999 295
273 3300046683 Ga0495658_0011617 Ga0495658_0011617_2266_3207 295
274 3300046683 Ga0495658_0055346 Ga0495658_0055346_520_1479 295
275 3300046689 Ga0495613_0050915 Ga0495613_0050915_1137_2099 295
276 3300046690 Ga0495624_0080244 Ga0495624_0080244_894_1835 295
277 3300046809 Ga0495600_0014499 Ga0495600_0014499_3231_4172 295
278 3300047319 Ga0495674_0127324 Ga0495674_0127324_676_1617 295
279 3300048907 Ga0496104_0047314 Ga0496104_0047314_2631_3575 295
280 3300048908 Ga0496105_0080224 Ga0496105_0080224_739_1683 295
281 3300049581 Ga0501047_0001536 Ga0501047_0001536_3771_4712 295
282 3300049584 Ga0501068_0181327 Ga0501068_0181327_162_1103 295
283 3300049585 Ga0501069_0004850 Ga0501069_0004850_4435_5376 295
284 3300049586 Ga0501070_0007516 Ga0501070_0007516_3641_4582 295
285 3300049586 Ga0501070_0009848 Ga0501070_0009848_263_1234 295
286 3300049588 Ga0501072_0109681 Ga0501072_0109681_225_1166 295
287 3300049589 Ga0501073_0000778 Ga0501073_0000778_16707_17648 295
288 3300049590 Ga0501074_0006250 Ga0501074_0006250_335_1306 295
289 3300049590 Ga0501074_0019509 Ga0501074_0019509_1301_2242 295
290 3300049741 Ga0501079_0004640 Ga0501079_0004640_7447_8388 295
291 3300049742 Ga0501080_0022290 Ga0501080_0022290_1155_2096 295
292 3300049744 Ga0501083_0000259 Ga0501083_0000259_21872_22813 295
293 3300049823 Ga0501044_0074441 Ga0501044_0074441_1409_2350 295
294 3300050514 nmdc:mga08x19_2801_c1 nmdc:mga08x19_2801_c1_7514_8476 295
295 3300053077 Ga0495601_0003518 Ga0495601_0003518_8013_8957 295
296 3300053077 Ga0495601_0008392 Ga0495601_0008392_2504_3448 295
297 3300053078 Ga0495612_0066263 Ga0495612_0066263_164_1105 295
298 3300053085 Ga0495619_0080629 Ga0495619_0080629_1050_2012 295
299 3300060353 Ga0501082_0294744 Ga0501082_0294744_440_1381 295
300 3300005295 Ga0065707_10095302 Ga0065707_100953025 300
301 3300005345 Ga0070692_10248632 Ga0070692_102486321 300
302 3300005353 Ga0070669_100079600 Ga0070669_1000796002 300
303 3300005441 Ga0070700_100069671 Ga0070700_1000696712 300
304 3300005719 Ga0068861_100031457 Ga0068861_1000314572 300
305 3300009553 Ga0105249_10405698 Ga0105249_104056982 300
306 3300025935 Ga0207709_10014703 Ga0207709_100147031 300
307 3300026075 Ga0207708_10087811 Ga0207708_100878113 300
308 3300026089 Ga0207648_10004320 Ga0207648_100043205 300
309 3300026118 Ga0207675_100039345 Ga0207675_1000393453 300
310 3300028380 Ga0268265_10152741 Ga0268265_101527413 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

106

322

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1saw-assembly1.cif.gz_A x-ray structure of homo sapiens protein flj36880 0.9001 75 300
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.8992 75 300
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.8959 75 300
1wzo-assembly1.cif.gz_A crystal structure of the hpce from thermus thermophilus hb8 0.8952 1 300
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.8943 77 300
ID Description Score Start End Superfamily
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8995 25 298 3.90.850.10
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8956 48 298 3.90.850.10
af_Q2FZT4_90_300_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8906 70 298 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8899 25 298 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8894 75 300 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A537B5T8-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9408 106 300 GO:0016787
GO:0044281
AF-A0A7C3G8Z4-F1-model_v4 FAA hydrolase family protein 0.9259 1 298 GO:0016787
GO:0044281
AF-A0A4Q5VS26-F1-model_v4 deleted 0.9255 84 300
AF-A0A7C3G8Z4-F1-model_v4 FAA hydrolase family protein 0.9227 1 298 GO:0016787
GO:0044281
AF-A0A5C6TWB1-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9197 1 300 GO:0016787
GO:0044281

Feature Viewer

pLDDT pTM Quality
87.83 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map